Subido por Nadia Celis

virologia-medica-4a-edicion

Anuncio
VIROLOGÍA
MÉDICA
VIROLOGÍA
MÉDICA
GUADALUPE CARBALLAL
JOSÉ RAÚL OUBIÑA
ERRNVPHGLFRVRUJ
www.corpuslibros.com
La presente es una publicación de:
www.corpuslibros.com
Carballal, Guadalupe
Virología médica / Guadalupe Carballal y José Raúl Oubiña.
DHG&LXGDG$XWyQRPDGH%XHQRV$LUHV&RUSXV/LEURV0pGLFRV\&LHQWt¿FRV
S[FP
,6%1
0HGLFLQD9LURORJtD,2XELxD-RVp5D~O,,7tWXOR
&''
DERECHOS RESERVADOS
‹&RUSXV(GLWRULDO\'LVWULEXLGRUD
[email protected]
[email protected]
www.corpuslibros.com
7XFXPiQ7HO)D[ &$$5 &LXGDG$XWyQRPDGH%XHQRV$LUHV$UJHQWLQD
Editor: Esteban Oscar Mestre
7LUDGDHMHPSODUHV
6HWHUPLQyGHLPSULPLUHQ0DU]RGH
Rosario - Argentina
ISBN: 978-987-1860-10-4
Imágenes de tapa (de izquierda a derecha):
Fila superior: 1 - Células BHK persistentemente infectadas con virus Junín. Inmunofluorescencia indirecta para detección de anticuerpos en suero de pacientes infectados. Dra. G Carballal.
Laboratorio de Virología, CEMIC. 2 - Radiografía de tórax de un paciente con síndrome pulmonar por hantavirus Andes, asistido en el Hospital Zonal Bariloche: se observa un infiltrado intersticial
difuso bilateral correspondiente a la fase cardiopulmonar. Fuente: cortesía de la Dra. María E. Lázaro, Htal. Zonal de Bariloche. 3 - Detección temprana de antígeno p72 de citomegalovirus humano
en núcleos de fibroblastos de prepucio humano en cultivo rápido (shell vial).
Fila media: 1 - Acción citopática de citomegalovirus humano en cultivo de fibroblastos humanos. Hematoxilina-eosina. 2 - Esquema de la estructura de una partícula de adenovirus. 3 - Partículas
del virus causante de la influenza pandémica 2009, observadas al microscopio electrónico. Fuente: Centers for Disease Control and Prevention, USA. Sitio web: http://www.cdc.gov/h1n1flu/
images.htm
Fila inferior: 1 - Análisis filogenético de las primeras secuencias nucleotídicas del virus Hepatitis D caracterizadas en Argentina. Fuente: cortesía de la Lic.Cecilia Delfino y las Dras. Verónica L.
Mathet y Mirna Biglione. Instituto UBA-CONICET de Investigaciones Biomédicas en Retrovirus y SIDA (INBIRS) e Instituto UBA-CONICET de Investigaciones en Microbiología e y Parasitología
Médica (IMPAM). 2 - Frecuencias de virus respiratorios en muestras respiratorias de niños con infección respiratoria aguda en Buenos Aires, Argentina. Los HRV (rinovirus humanos) se detectaron
por RT-PCR en tiempo real. El resto de los virus se detectó por inmunofluorescencia indirecta. Fuente:cortesía de la Bioq. Débora Marcone. Unidad de Virología, CEMIC. 3 - Caracterización mediante
Bootscanning del primer genoma completo recombinante D/A del virus Hepatitis B detectado en América. Fuente: cortesía de la Dra. Julieta Trinks. IMPAM UBA-CONICET.
1R HVWi SHUPLWLGD OD UHSURGXFFLyQ WRWDO R SDUFLDO
de esta obra, ni su tratamiento o transmisión por
cualquier medio o método, sin autorización escrita
de la Editorial.
NOTA
/D PHGLFLQD HV XQD FLHQFLD HQ FRQVWDQWH GHVDUUROOR &RQIRUPH VXUMDQ QXHYRV FRQRFLPLHQWRV VH UHTXHULUiQ FDPELRV GH OD
WHUDSpXWLFD/RVDXWRUHV\ORVHGLWRUHVVHKDQHVIRU]DGRSDUDTXHORVFXDGURVGHGRVL¿FDFLyQPHGLFDPHQWRVDVHDQSUHFLVRV\
acordes con los establecidos en la fecha de publicación. Sin embargo, ante los posibles errores humanos y cambios en la medicina,
ni los editores, ni cualquier otra persona que haya participado en la preparación de la obra garantizan que la información
contenida en ella sea precisa o completa.
&RQYHQGUtDUHFXUULUDRWUDVIXHQWHVGHGDWRVSRUHMHPSOR\GHPDQHUDSDUWLFXODUKDEUiTXHFRQVXOWDUODKRMDGHLQIRUPDFLyQ
TXHVHDGMXQWDFRQFDGDPHGLFDPHQWRSDUDWHQHUFHUWH]DGHTXHODLQIRUPDFLyQGHHVWDREUDHVSUHFLVD\QRVHKDQLQWURGXFLGR
cambios en la dosis recomendada o en las contraindicaciones para su administración. Esto es de particular importancia con
UHVSHFWRDIiUPDFRVQXHYRVRGHXVRQRIUHFXHQWH7DPELpQGHEHUiFRQVXOWDUVHDORVRUJDQLVPRVGHFRQWUROGHPHGLFDPHQWRVGH
cada país para obtener información sobre los valores normales y medicamentos permitidos o recomendados.
DEDICATORIAS
A nuestras familias,
a la memoria de nuestros maestros,
a nuestros alumnos.
AUTORES
CARBALLAL, GUADALUPE
OUBIÑA, JOSÉ RAÚL
Médica. Doctora de la Universidad de Buenos Aires
3URIHVRUD 7LWXODU GH 0LFURELRORJtD , \ ,, (VFXHOD GH 0HGLFLQD
,QVWLWXWR8QLYHUVLWDULR&(0,& ,8&
Investigadora Principal, Instituto de Investigaciones, IUC
Profesora Asociada de la Carrera de Especialistas en Infectología
\ 0DHVWUtD HQ 0LFURELRORJtD )DFXOWDG GH &LHQFLDV GH OD 6DOXG
Universidad Católica Argentina
Profesora Asociada, Especialidad Infectología, IUC
Asesora en Virología Clínica, Centro de Investigación Médica
H,QYHVWLJDFLRQHV&OtQLFDV1RUEHUWR4XLUQR &(0,& ([3URIHVRUD7LWXODU'HSDUWDPHQWRGH0LFURELRORJtD3DUDVLWRORJtD
H,QPXQRORJtD)DFXOWDGGH0HGLFLQD8QLYHUVLGDGGH%XHQRV$LUHV
([3URIHVRUD7LWXODU&iWHGUDGH0LFURELRORJtD)DFXOWDGGH
Medicina, Universidad del Salvador
([,QYHVWLJDGRUDGHO&21,&(7
([5HSUHVHQWDQWHSDUD/DWLQRDPpULFDGHODPan American Society
for Clinical Virology, EE. UU.
3UHPLR.RQH[HQ0LFURELRORJtD%DFWHULRORJtD\9LURORJtD
Médico. Doctor en Medicina de la Universidad de Buenos Aires
3URIHVRU 5HJXODU 7LWXODU 'HSDUWDPHQWR GH 0LFURELRORJtD
3DUDVLWRORJtD H ,QPXQRORJtD )DFXOWDG GH 0HGLFLQD 8QLYHUVLGDG
de Buenos Aires
([ 'LUHFWRU GHO 'HSDUWDPHQWR GH 0LFURELRORJtD 3DUDVLWRORJtD H
,QPXQRORJtD )DFXOWDGGH0HGLFLQD8QLYHUVLGDGGH
Buenos Aires
Vicedirector de la Maestría en Biología Molecular Médica,
Universidad de Buenos Aires
Profesor de Virología Molecular en la Maestría en Biología
Molecular Médica, Universidad de Buenos Aires
([ 3URIHVRU 7LWXODU &iWHGUD GH %LRORJtD 0ROHFXODU )DFXOWDG GH
0HGLFLQD8QLYHUVLGDGGHO6DOYDGRU 86DO%XHQRV$LUHV
,QYHVWLJDGRUGHO&21,&(7
COLABORADORES
Alonio Lidia Virginia. Dra. en Ciencias Biológicas, Universidad de
Buenos Aires. Jefa del Depto. Virología, Instituto Nacional de EnferPHGDGHV,QIHFFLRVDV,1(,$1/,6&DUORV*0DOEUiQ%XHQRV$LUHV
Ávila María Mercedes. /LFHQFLDGDHQ&LHQFLDV%LROyJLFDV)DFXOWDG
GH&LHQFLDV([DFWDV\1DWXUDOHV8QLYHUVLGDGGH%XHQRV$LUHV'RFWRUDGHOD8QLYHUVLGDGGH%XHQRV$LUHV,QYHVWLJDGRUDGHO&21,&(7
Barcán Laura. Médica Infectóloga. Jefa de la Sección Infectología del Hospital Italiano, Buenos Aires. Profesora Asociada de
Infectología, Instituto Universitario, Hospital Italiano.
Baumeinster Elsa. Bioquímica, Universidad de Bs. As. Jefa del
6HUYLFLRGH9LUXV5HVSLUDWRULRV,1(,$1/,6&DUORV*0DOEUiQ
Buenos Aires.
Campos Rodolfo H. Bioquímico. Doctor de la Universidad de
%XHQRV$LUHV3URIHVRU5HJXODU7LWXODUGHOD&iWHGUDGH9LURORJtD
)DFXOWDGGH)DUPDFLD\%LRTXtPLFD8QLYHUVLGDGGH%XHQRV$LUHV
,QYHVWLJDGRUGHO&21,&(7
Candurra Nélida. 'RFWRUD HQ &LHQFLDV 4XtPLFDV )DFXOWDG GH
&LHQFLDV([DFWDV\1DWXUDOHV8QLYHUVLGDGGH%XHQRV$LUHV3URIHVRUD$GMXQWDGH0LFURELRORJtD\9LURORJtD)DFXOWDGGH&LHQFLDV
([DFWDV\1DWXUDOHV8QLYHUVLGDGGH%XHQRV$LUHV
Carobene Mauricio G. Licenciado en Genética. Doctor de la UniYHUVLGDGGH%XHQRV$LUHV,QYHVWLJDGRUGHO&21,&(7
Castilla Viviana. 'RFWRUDHQ&LHQFLDV%LROyJLFDV-HIDGH7UDEDMRV3UiFWLFRVGH0LFURELRORJtD\9LURORJtD)DFXOWDGGH&LHQFLDV
([DFWDV\1DWXUDOHV8QLYHUVLGDGGH%XHQRV$LUHV
Benetucci Jorge A. Médico. Doctor en Ciencias Médicas, Universidad
GH%XHQRV$LUHV([-HIHGHO'HSDUWDPHQWRGH,QIHFFLRVDV+RVSLWDOGH
,QIHFFLRVDV'U)UDQFLVFR-0XxL]3URIHVRU5HJXODU7LWXODUGH,QIHFWRORJtD)DFXOWDGGH0HGLFLQDGHOD8QLYHUVLGDGGH%XHQRV$LUHV
Cisterna Daniel M. Bioquímico. Laboratorio Nacional de Referencia de Rabia Servicio de Neurovirosis, INEI - ANLIS "Dr. CarORV*0DOEUiQ%XHQRV$LUHV
Berini Carolina A. /LFHQFLDGDHQ&LHQFLDV%LROyJLFDV)DFXOWDGGH
&LHQFLDV ([DFWDV \ 1DWXUDOHV 8QLYHUVLGDG GH %XHQRV$LUHV 'UD
en Biología, Universidad de Buenos Aires. Becaria posdoctoral de
&21,&(7$\XGDQWHGHUD'HSWRGH0LFURELRORJtD3DUDVLWRORJtD
H,QPXQRORJtD)DFXOWDGGH0HGLFLQD8QLYHUVLGDGGH%XHQRV$LUHV
Corti Marcelo. Médico. Jefe de División HIV/Sida, Hospital de
(QIHUPHGDGHV,QIHFFLRVDV)-0XxL]3URIHVRU5HJXODU$GMXQto, Departamento de Medicina, Orientación Enfermedades InfecFLRVDV8QLYHUVLGDGGH%XHQRV$LUHV3URIHVRU$GMXQWRGH,QIHFWRORJtD)DFXOWDGGH0HGLFLQD86$/
Berría María I. Médica. Doctora de la Universidad de Buenos
$LUHV([3URIHVRUD5HJXODU7LWXODU\DFWXDO3URIHVRUD7LWXODU&RQsulta del Departamento de Microbiología, Parasitología e InmuQRORJtD)DFXOWDGGH0HGLFLQD8QLYHUVLGDGGH%XHQRV$LUHV([
,QYHVWLJDGRUDGHO&21,&(7
Cuestas María Luján. Bioquímica. Dra. de la Universidad de
%XHQRV$LUHV,QYHVWLJDGRUDGHO&21,&(7-HIDGH7UDEDMRV3UiFticos del Departamento de Microbiología, Parasitología e InmunoORJtD)DFXOWDGGH0HGLFLQD8QLYHUVLGDGGH%XHQRV$LUHV
Biglione Mirna. Médica. Dra. en Medicina de la Universidad de
%XHQRV$LUHV([-HIDGH7UDEDMRV3UiFWLFRVGHO'HSDUWDPHQWRGH
0LFURELRORJtD3DUDVLWRORJtDH,QPXQRORJtD)DFXOWDGGH0HGLFLQD
8QLYHUVLGDGGH%XHQRV$LUHV,QYHVWLJDGRUDGHO&21,&(7
Blejer Jorgelina L. Licenciada en Ciencias Biológicas. Doctora de la
8QLYHUVLGDGGH%XHQRV$LUHV([-HIDGH7UDEDMRV3UiFWLFRVGHO'HSDUWDPHQWRGH0LFURELRORJtD3DUDVLWRORJtDH,QPXQRORJtD)DFXOWDG
de Medicina, Universidad de Buenos Aires. Jefa del Área Serología,
6HFFLyQ0HGLFLQD7UDQVIXVLRQDO)XQGDFLyQ)DYDORUR%XHQRV$LUHV
Bonvehí Pablo. Médico Infectólogo. Jefe de la Sección Infectología, CEMIC. Profesor Asociado de Medicina I y II, Especialización
en Medicina Interna. Director de la Carrera Universitaria de Especialización en Infectología, Instituto Universitario CEMIC.
Bouzas María Belén. Bioquímica. Jefa de la Unidad de Virología,
+RVSLWDOGH,QIHFFLRVDV'U)UDQFLVFR-DYLHU0XxL]&RRUGLQDGRUD
de la Red de Virología del Gobierno de la Ciudad de Buenos Aires.
Caillou Susana. Bioquímica. Profesora Asociada de Virología.
,QVWLWXWR GH 0LFURELRORJtD &iWHGUD GH 9LURORJtD )DFXOWDG GH
%LRTXtPLFD4XtPLFD\)DUPDFLD8QLYHUVLGDG1DFLRQDOGH7Xcuman.
Damonte Elsa B. 'RFWRUDHQ&LHQFLDV4XtPLFDV3URIHVRUD7LWXODU
GH0LFURELRORJtD\9LURORJtD)DFXOWDGGH&LHQFLDV([DFWDV\1DWXUDOHV8QLYHUVLGDGGH%XHQRV$LUHV,QYHVWLJDGRUDGHO&21,&(7
Distéfano Angélica L. Bioquímica, Universidad de Buenos Aires.
0DJtVWHU HQ 0LFURELRORJtD 0ROHFXODU 86$0 -HID GH 6HUYLFLR
9LURVLV&RQJpQLWDV3HULQDWDOHV\7UDQVPLVLyQ6H[XDO,1(,$1/,6&DUORV*0DOEUiQ%XHQRV$LUHV
Dolcini Guillermina. Médica veterinaria. Doctora en Ciencias
animales de la Universidad Nacional del Centro de la Provincia de
%XHQRV$LUHV 81&3%$ Docteur au Microbiologie de la Université Paris XI)UDQFLD3URIHVRUD$GMXQWDGHOÈUHD9LURORJtDGHOD
)DFXOWDGGH&LHQFLDV9HWHULQDULDVGHOD81&3%$
Echavarría Marcela. Bioquímica. Doctora de la Universidad de
%XHQRV$LUHV,QYHVWLJDGRUDGHO&21,&(7&RRUGLQDGRUDGHOÈUHD
Molecular, Laboratorio de Virología Clínica, Centro de Educación
0pGLFD H ,QYHVWLJDFLRQHV &OtQLFDV 1RUEHUWR 4XLUQR &(0,& Profesora Asistente de Microbiología, Parasitología y Virología,
Instituto Universitario CEMIC.
Eirin María E. /LFHQFLDGD HQ &LHQFLDV %LROyJLFDV )DFXOWDG GH
&LHQFLDV([DFWDV\1DWXUDOHV8QLYHUVLGDGGH%XHQRV$LUHV
Enria Delia A. Doctora en Ciencias Médicas. Directora del Instituto Nacional de Enfermedades Virales Humanas "Dr. Julio I. MaizWHJXL ,1(9+ 3HUJDPLQR3URYLQFLDGH%XHQRV$LUHV
Fellner María Dolores. Bioquímica. Profesional de Planta. Servicio de
Virus Oncogénicos, Depto. Virología. Instituto Nacional de EnfermedaGHV,QIHFFLRVDV,1(,$1/,6&DUORV*0DOEUiQ%XHQRV$LUHV
Ferrés Garrido Marcela. 0pGLFD,QIHFWyORJD3HGLDWUD0iVWHUHQ
(SLGHPLRORJtD 3RQWL¿FLD 8QLYHUVLGDG &DWyOLFD GH &KLOH 'HSDUtamento de Pediatría. Directora del Laboratorio de Infectología y
Virología Molecular. Profesora Asociada.
Freire María Cecilia. Médica. Jefa del Servicio Neurovirosis,
'HSDUWDPHQWRGH9LURORJtD,1(,$1/,6'U&DUORV*0DOEUiQ
%XHQRV$LUHV 'RFHQWH$GMXQWD GH OD &iWHGUD GH 0LFURELRORJtD
)DFXOWDGGH&LHQFLDV0pGLFDV8QLYHUVLGDG$XVWUDO
Galiano Mónica. Bioquímica. Doctora de la Universidad de BueQRV$LUHV([EHFDULDGHOD&RPXQLGDG(FRQyPLFD(XURSHDClinical
Scientist, Respiratory Virus Unit, Virus Reference Division, Centre for
Infections, Health Protection Agency, Londres, Reino Unido.
Gómez Carrillo Manuel. Licenciado en Ciencias Biológicas. Doctor
de la Universidad de Buenos Aires. Vice Director del Centro Nacional
de Referencia para el 6,'$ DFWXDOPHQWH,1%,56 'RFHQWH$GVFULSWR
GHO'HSDUWDPHQWRGH0LFURELRORJtD3DUDVLWRORJtDH,QPXQRORJtD)Dcultad de Medicina, Universidad de Buenos Aires. Miembro de la CaUUHUDGHO3URIHVLRQDO\7pFQLFRGH$SR\RGHO&21,&(7
Herrera Fabián. Médico Infectólogo, Sección Infectología, Departamento de Medicina Interna, Centro de Educación Médica e
,QYHVWLJDFLRQHV &OtQLFDV &(0,& 3URIHVRU $VLVWHQWH 'HSDUWDmento de Medicina, Instituto Universitario CEMIC. Profesor AdMXQWR'HSDUWDPHQWRGH0HGLFLQD8QLYHUVLGDG)DYDORUR
Kajon Adriana. Bioquímica. Dra. de la Universidad de Buenos
Aires. Ph.D. Associate Scientist, Lovelace Respiratory Research
Institute, Infectious Disease Program, Albuquerque, EE.UU.
Lázaro María E. Médica. Doctora de la Universidad de Buenos
Aires. Hospital Zonal Bariloche, San Carlos de Bariloche, Provincia de Río Negro.
Levis Silvana del C. 'RFWRUD HQ &LHQFLDV %LROyJLFDV )DFXOWDG
de Bioquímica y Ciencias Biológicas, Universidad Nacional del
Litoral. Jefa del Depto. de Investigación, Instituto Nacional de EnIHUPHGDGHV 9LUDOHV +XPDQDV 'U -XOLR , 0DL]WHJXL ,1(9+ Pergamino, Provincia de Buenos Aires.
Livellara Beatriz. Bioquímica. Jefa de Biología Molecular, LaERUDWRULR&HQWUDO+RVSLWDO,WDOLDQR3URIHVRUD$GMXQWD&iWHGUDGH
0LFURELRORJtD)DFXOWDGGH0HGLFLQD+RVSLWDO,WDOLDQR
López Camelo Jorge. 'RFWRUHQ*HQpWLFD8QLYHUVLGDG)HGHUDOGH
5LRGH-DQHLUR%UDVLO,QYHVWLJDGRUGHO&21,&(7&(0,&H,QVWLWXWR0XOWLGLVFLSOLQDULRHQ%LRORJtD&HOXODU ,0%,&( /D3ODWD
Buenos Aires. Director de Investigación, CEMIC.
López de Caillou María Susana. Bioquímica. Profesora Asociada
GHOD&iWHGUDGH9LURORJtD)DFXOWDGGH%LRTXtPLFD4XtPLFD\)DUPDFLD8QLYHUVLGDG1DFLRQDOGH7XFXPiQ
Mangano Andrea. Bioquímica del Laboratorio de Biología Celular y Retrovirus, Hospital de Pediatría "Prof. Dr. Juan P. Garrahan".
,QYHVWLJDGRUDGHO&21,&(73URIHVRUD$GMXQWDGH0LFURELRORJtD
)DFXOWDGGH)DUPDFLD\%LRTXtPLFD8%$
Marcone Débora. Bioquímica, Doctora de laUniversidad de Bue-
QRV$LUHV%HFDULDSRVWGRFWRUDOGHO&21,&(7HQHO/DERUDWRULRGH
Virología Clínica del Hospital Universitario CEMIC.
Martínez Alfredo. %LRTXtPLFR 8QLYHUVLGDG 1DFLRQDO GH 7XFXPiQ&RRUGLQDGRUGHOÈUHD$VLVWHQFLDO/DERUDWRULRGH9LURORJtD
Clínica, Centro de Educación Médica e Investigaciones Clínicas
1RUEHUWR4XLUQR &(0,& -HIHGH6HURORJtDGH%DQFRVGH6DQJUH&(0,&\)/(1,&RRUGLQDGRU'RFHQWHGHOD&DUUHUDGH(VSHcialización en Bioquímica Clínica, CEMIC.
Martínez Peralta Liliana. Médica. Doctora de la Universidad
1DFLRQDOGH/D3ODWD3URIHVRUD5HJXODU7LWXODUGHO'HSDUWDPHQWR
GH 0LFURELRORJtD 3DUDVLWRORJtD H ,QPXQRORJtD )DFXOWDG GH 0Hdicina, Universidad de Buenos Aires. Investigadora Clínica del
&21,&(7
Mathet Verónica L. Licenciada en Ciencias Biológicas. Magíster
en Biotecnología y Doctora de la Universidad de Buenos Aires.
Docente Autorizada del Departamento de Microbiología, ParasitoORJtDH,QPXQRORJtD)DFXOWDGGH0HGLFLQD8QLYHUVLGDGGH%XHQRV$LUHV,QYHVWLJDGRUDGHO&21,&(7
Mbayed Viviana. Bioquímica. Doctora de la Universidad de BueQRV$LUHV3URIHVRUD$GMXQWDGHOD&iWHGUDGH9LURORJtD)DFXOWDG
GH)DUPDFLD\%LRTXtPLFD8QLYHUVLGDGGH%XHQRV$LUHV,QYHVWLJDGRUDGHO&21,&(7
Mersich Susana E. 'RFWRUD HQ &LHQFLDV 4XtPLFDV )DFXOWDG GH
&LHQFLDV ([DFWDV \ 1DWXUDOHV 8QLYHUVLGDG GH %XHQRV$LUHV ([
3URIHVRUD$GMXQWDGH0LFURELRORJtD\9LURORJtD)DFXOWDGGH&LHQFLDV([DFWDV\1DWXUDOHV8QLYHUVLGDGGH%XHQRV$LUHV
Minassian María Laura. Bioquímica. Dra. en Bioquímica de la
8QLYHUVLGDGGH%XHQRV$LUHV([%HFDULDGHO&21,&(7'RFHQWH
del Departamento de Microbiología, Parasitología e Inmunología,
)DFXOWDGGH0HGLFLQD8QLYHUVLGDGGH%XHQRV$LUHV
Mistchenko Alicia. Médica, Dra. en Medicina. Investigadora de la
&RPLVLyQGH,QYHVWLJDFLRQHV&LHQWt¿FDVGHOD3URYLQFLDGH%XHQRV
$LUHV &,& -HIDGHO/DERUDWRULRGH9LURORJtD+RVSLWDOGH3HGLDtría "R. Gutiérrez", Buenos Aires.
Morales María Alejandra. %LRTXtPLFD-HIDGH7UDEDMRV3UiFWLFRV GH OD &iWHGUD GH ,QWURGXFFLyQ D 4XtPLFD ,QRUJiQLFD GH 81NOBA. Profesional del Depto. Investigación INEVH "Dr. Julio I.
Maiztegui". Coordinadora de la Red Nacional de Laboratorios para
diagnóstico de dengue y otros arbovirus.
Mykietiuk Analía. Doctora en Ciencias Médicas, Universidad de
Barcelona, España. Médica Infectóloga, Sección Infectología, Departamento de Medicina Interna, CEMIC. Servicio de Infectología
Hospital Interzonal General de Agudos "Profesor Dr. R. Rossi".
Nates Silvia V. Doctora en Ciencias Químicas, Universidad NacioQDOGH&yUGRED,QVWLWXWRGH9LURORJtD'U-09DQHOOD)DFXOWDG
de Ciencias Médicas, Universidad Nacional de Córdoba. Jefa del Laboratorio de gastroenteritis virales y sarampión. Profesora Asociada.
Padula Paula J. 'RFWRUDHQ&LHQFLDV4XtPLFDV)DFXOWDGGH&LHQFLDV ([DFWDV \ 1DWXUDOHV 8QLYHUVLGDG GH %XHQRV$LUHV -HID GHO
Laboratorio de Referencia para el diagnóstico e investigación de
hantavirus, Instituto de Enfermedades Infecciosas INEI-ANLIS
'U&DUORV*0DOEUiQ%XHQRV$LUHV3URIHVRUD$GMXQWD&iWHGUD9LURORJtD8QLYHUVLGDG&$(&(,QYHVWLJDGRUDGHO&21,&(7
† Paganini Hugo. Médico Infectólogo. Médico Principal, Servicio de Control Epidemiológico e Infectología, Hospital "Prof. Dr.
-XDQ3*DUUDKDQ0pGLFR,QIHFWyORJRGH)81&(,\+RVSLWDO$OHPiQ3URIHVRU$VRFLDGR,QVWLWXWR8QLYHUVLWDULR&(0,&
Pando María de los Ángeles. Licenciada en Ciencias Biológicas. Doctora de la Universidad de Buenos Aires. Investigadora
GHO&21,&(7'RFHQWHGHO'HSDUWDPHQWRGH0LFURELRORJtD3DUDVLWRORJtDH,QPXQRORJtD)DFXOWDGGH0HGLFLQD8QLYHUVLGDGGH
Buenos Aires.
Pérez Celeste. Bioquímica. Dra. de la Universidad de Buenos Aires. Magíster en Microbiología Molecular, Universidad Nacional
de San Martín. Instituto Nacional de Enfermedades Infecciosas,
,1(,$1/,6 &DUORV * 0DOEUiQ 6HUYLFLR &XOWLYR GH 7HMLGRV
Departamento Virología. Buenos Aires.
Picconi M. Alejandra. Bioquímica. Jefa Servicio Virus Oncogénicos. Laboratorio de Referencia de Papilomavirus, Instituto Nacional
GH (QIHUPHGDGHV ,QIHFFLRVDV ,1(,$1/,6 &DUORV * 0DOEUiQ
Buenos Aires.
Poletta Fernando. Licenciado en Genética. Investigador del
&21,&(7HQHO/DERUDWRULRGH*HQpWLFDGHO&HQWURGH(GXFDFLyQ
Médica e Investigaciones Clínicas "Norberto Quirno", CEMIC.
Rivero Cintia W. Licenciada en Biotecnología y Dra. de la UniYHULGDG GH 4XLOPHV ,QYHVWLJDGRUD GHO &21,&(7 ,QVWUXFWRUD GH
Química II, Universidad Nacional de Quilmes.
Romanowski Víctor. Químico. Licenciado en Bioquímica. Doctor
en Ciencias Bioquímicas, Universidad Nacional de La Plata. ProfeVRU5HJXODU7LWXODUÈUHD%LRWHFQRORJtD\%LRORJtD0ROHFXODU'HSDUWDPHQWRGH&LHQFLDV%LROyJLFDV)DFXOWDGGH&LHQFLDV([DFWDV
Universidad Nacional de La Plata.
Sabattini Marta S. ([3URIHVRUD7LWXODU\'LUHFWRUDGHO,QVWLWXWR
GH9LURORJtD-09DQHOOD)DFXOWDGGH&LHQFLDV0pGLFDV8QLYHUVLGDG 1DFLRQDO GH &yUGRED $VHVRUD &LHQWt¿FD GHO ,QVWLWXWR
Nacional de Enfermedades Virales Humanas "Dr. J.I. Maiztegui",
Pergamino. Académica de número, Academia de Ciencias Médicas, Córdoba.
Salomón Horacio. Bioquímico. Doctor de la Universidad de
Buenos Aires. Director del Centro Nacional de Referencia para el
6,'$ DFWXDOPHQWH,1%,56 -HIHGH7UDEDMRV3UiFWLFRV\'RFHQte Autorizado del Departamento de Microbiología, Parasitología e
,QPXQRORJtD)DFXOWDGGH0HGLFLQD8QLYHUVLGDGGH%XHQRV$LUHV
,QYHVWLJDGRUGHO&21,&(7
Sanjuan Norberto A. Médico. Doctor de la Universidad de BueQRV$LUHV3URIHVRU5HJXODU7LWXODU(['LUHFWRUGHO'HSDUWDPHQWR
GH 0LFURELRORJtD 3DUDVLWRORJtD H ,QPXQRORJtD )DFXOWDG GH 0HGLFLQD8QLYHUVLGDGGH%XHQRV$LUHV,QYHVWLJDGRUGHO&21,&(7
Savy Vilma Lidia. %LRTXtPLFD\/LFHQFLDGDHQ$QiOLVLVFOtQLFRV
)DFXOWDGGH)DUPDFLD\%LRTXtPLFD8QLYHUVLGDGGH%XHQRV$LUHV
([-HIDGHO6HUYLFLRGH9LUXVUHVSLUDWRULRV,1(,$1/,6&DUORV*
0DOEUiQ%XHQRV$LUHV
Sen Luisa. Médica. Dra. de la Universidad de Buenos Aires Jefa del
Laboratorio de Biología Celular y Retrovirus, Hospital de Pediatría
3URI'U-XDQ3*DUUDKDQ,QYHVWLJDGRUDGHO&21,&(7
Temporiti Elena R. Médica Infectóloga, Sección Infectología,
Departamento de Medicina Interna, Centro de Educación Médica e
,QYHVWLJDFLRQHV&OtQLFDV &(0,& Teyssié Angélica. %LRTXtPLFD([-HIDGHO'HSDUWDPHQWRGH9LURlogía, Instituto Nacional de Microbiología INEI-ANLIS "Carlos G.
0DOEUiQ([,QYHVWLJDGRUDGHO&21,&(7
Torres Marta. Licenciada en Ciencias Químicas, Universidad de
%XHQRV $LUHV 'LUHFWRUD 7pFQLFD GHO 3URJUDPD %XHQRV $LUHV GH
&RQWURO GH &DOLGDG ([WHUQR SDUD /DERUDWRULRV &OtQLFRV &,5+(
CEMIC. Especialista en Bioquímica endocrinológica, ABA-SAEM.
Trento Alfonsina. %LRTXtPLFD([-HIDGH5HVLGHQWHVGH%LRTXtmica FOtQLFD &(0,& 'RFWRUDGR HQ HO ,QVWLWXWR &DUORV 7HUFHUR
0DMDGDKRQGD(VSDxD
Trinks Julieta. 0pGLFD ,QYHVWLJDGRUD GHO &21,&(7 ,QVWLWXWR GH
&LHQFLDV%iVLFDV\0HGLFLQD([SHULPHQWDO+RVSLWDO,WDOLDQR3URIHsora asistente de Medicina Molecular, Hospital Italiano. Profesora de
Microbiología, Universidad del Salvador, Buenos Aires.
Uez Osvaldo. Bioquímico. Doctor de la Universidad de Buenos
Aires. Jefe del Servicio de Virología, Instituto Nacional de Epidemiología "Dr. Juan H. Jara", Centro Nacional de Referencia para la
YLJLODQFLDHSLGHPLROyJLFDGHOYLUXVLQÀXHQ]D0DUGHO3ODWD
Videla Cristina M. /LFHQFLDGD HQ &LHQFLDV %LROyJLFDV )DFXOWDG GH
&LHQFLDV([DFWDV\1DWXUDOHV8QLYHUVLGDGGH%XHQRV$LUHV'RFWRUD
de la Universidad de Buenos Aires. Coordinadora del Área Asistencial,
Laboratorio de Virología Clínica, Centro de Educación Médica e InvesWLJDFLRQHV&OtQLFDV1RUEHUWR4XLUQR &(0,& 3URIHVRUD7LWXODU0Lcrobiología, Parasitología y Virología, Instituto Universitario CEMIC.
Zapata Marta T. 'RFWRUD HQ &LHQFLDV 4XtPLFDV ([ 3URIHVRUD
7LWXODU&RQVXOWD)DFXOWDGGH&LHQFLDV0pGLFDV8QLYHUVLGDG1DFLRQDO GH &yUGRED ([ 'LUHFWRUD GHO ,QVWLWXWR GH9LURORJtD -0
Vanella".
ÍNDICE GENERAL
PRÓLOGO / 29
Guadalupe Carballal - José Raúl Oubiña
PRÓLOGO A LA 4ª EDICIÓN / 31
Mercedes Weissenbacher
PARTE 1: INICIACIÓN A LA VIROLOGÍA
MÉDICA: ASPECTOS GENERALES
CAPÍTULO 1 INTRODUCCIÓN AL ESTUDIO DE LA
VIROLOGÍA HUMANA
Guadalupe Carballal
1. EL DESARROLLO DE LA VIROLOGÍA COMO CIENCIA / 35
1.1 IMPACTO DE LAS ENFERMEDADES VIRALES EN LA HISTORIA
HUMANA / 35
1.2 BREVE HISTORIA DE LA VIROLOGÍA / 35
2. ¿QUÉ SON LOS VIRUS? / 36
2.1 TAMAÑO / 36
2.2 ESTRUCTURA, FUNCIONES Y PROPIEDADES / 36
2.3 DIFERENCIAS CON EUBACTERIAS, CLAMIDIAS, MICOPLASMAS Y
RICKETTSIAS / 37
2.4 COMPOSICIÓN QUÍMICA DE LOS VIRUS / 38
2.5 CONCEPTO DE SIMETRÍA: HELICOIDAL, ICOSAÉDRICA, COMPLEJA Y
BINARIA / 39
3. ¿CÓMO SE REPLICAN LOS VIRUS? / 40
3.1 INTERACCIÓN DE LOS VIRUS CON SUS HOSPEDADORES / 41
3.2 NOCIONES DE BACTERIÓFAGOS / 41
3.3 LOS VIRUS: ¿SON SERES VIVOS? / 41
4. INTRODUCCIÓN A LA PATOGÉNESIS VIRAL / 41
4.1 INTERACCIÓN DE LOS VIRUS CON LA CÉLULA HOSPEDADORA / 41
4.2 INTERACCIÓN DE LOS VIRUS CON EL ORGANISMO
IMNUNOCOMPETENTE / 42
5. FUNDAMENTOS DE LA CLASIFICACIÓN Y NOMENCLATURA DE
LOS VIRUS / 42
6. L OS VIRUS NO SON LOS AGENTES PATÓGENOS
MÁS PEQUEÑOS : ¿Q UÉ SON LOS VIRIONES , LOS
VIROIDES Y LOS PRIONES ? / 43
7. ¿CÓMO PUEDEN INACTIVARSE LOS VIRUS? EFECTO DE LOS
AGENTES FÍSICO-QUÍMICOS / 43
8. NOCIONES DE ESTERILIZACIÓN Y DESINFECCIÓN / 45
9. NOMENCLATURA DE LOS VIRUS / 46
CAPÍTULO 2 REPLICACIÓN VIRAL
Viviana Castilla - Elsa B. Damonte
1. INTRODUCCIÓN / 47
2. CICLO DE REPLICACIÓN VIRAL / 47
2.1 ADSORCIÓN / 47
2.2 PENETRACIÓN / 47
2.3 DESNUDAMIENTO / 48
2.4 EXPRESIÓN Y REPLICACIÓN DEL GENOMA / 48
2.5 ENSAMBLAJE Y LIBERACIÓN / 49
2.6 CURVA DE CRECIMIENTO DE UN SOLO CICLO / 50
CAPÍTULO 3 ¿CÓMO SE ESTUDIAN LOS VIRUS?
Susana Mersich - Nélida Candurra
1. PROCEDIMIENTOS FISICOQUÍMICOS / 53
1.1 MICROSCOPIA ELECTRÓNICA: VISUALIZACIÓN Y ENUMERACIÓN DE
PARTÍCULAS VIRALES / 53
1.2 DETECCIÓN DE PARTÍCULAS VIRALES POR HEMAGLUTINACIÓN / 54
1.3 PROTEÍNAS VIRALES / 54
1.4 LOS ÁCIDOS NUCLEICOS: TÉCNICAS DE HIBRIDACIÓN, PCR Y
SECUENCIAMIENTO NUCLEOTÍDICO / 55
2. PROCEDIMIENTOS DE DETECCIÓN DE INFECTIVIDAD:
AISLAMIENTO VIRAL / 56
2.1 REQUERIMIENTOS PARA UN LABORATORIO DE CULTIVOS / 56
2.2 AISLAMIENTO DE VIRUS / 56
CAPÍTULO 4 GENÉTICA VIRAL
Víctor Romanowski
1. INTRODUCCIÓN A LA TERMINOLOGÍA / 63
2. BASES MOLECULARES DE LOS CAMBIOS EN LOS GENOMAS / 63
2.1 MUTACIONES / 63
3. INTERACCIONES GENÉTICAS ENTRE VIRUS / 65
3.1. RECOMBINACIÓN / 65
3.2. REASOCIACIÓN DE SEGMENTOS GENÓMICOS (REASSORTMENT) / 65
3.3. COMPLEMENTACIÓN / 66
4. INTERACCIONES NO GENÉTICAS ENTRE VIRUS / 67
4.1. HETEROCIGOSIS / 67
4.2. INTERFERENCIA / 67
4.3. MEZCLA FENOTÍPICA / 68
5. INTERACCIONES GENÉTICAS ENTRE LOS VIRUS Y LA CÉLULA
HOSPEDERA / 68
5.1. TRANSFORMACIÓN / 68
5.2. INTEGRACIÓN / 69
5.3. INFECCIÓN PERSISTENTE / 69
6. EVOLUCIÓN VIRAL / 69
7. TÉCNICAS DE BIOLOGÍA MOLECULAR PARA EL ANÁLISIS DE
GENOMAS / 70
8. VIRUS COMO VECTORES DE EXPRESIÓN DE GENES / 71
CAPÍTULO 5 PATOGENIA DE LAS INFECCIONES
VIRALES
Verónica Lidia Mathet - José Raúl Oubiña
1. INTRODUCCIÓN / 73
1.1. UNA APROXIMACIÓN AL VOCABULARIO / 73
2. PUERTAS DE ENTRADA / 74
2.1 PIEL / 74
2.2 OROFARINGE Y TRACTO RESPIRATORIO / 76
2.3 OROFARINGE Y TRACTO ENTÉRICO / 78
2.4 APARATO GÉNITO-URINARIO / 80
2.5 VÍA CONJUNTIVAL / 82
3. VÍAS DE DISEMINACIÓN EN EL ORGANISMO / 82
3.1 DISEMINACIÓN SOBRE SUPERFICIES EPITELIALES / 82
3.2 INVASIÓN SUBEPITELIAL Y DISEMINACIÓN LINFÁTICA / 83
3.3 DISEMINACIÓN SANGUÍNEA E INVASIÓN TISULAR / 83
3.4 DISEMINACIÓN NEURAL / 88
4. TRANSMISIÓN DE VIRUS AL EXTERIOR DEL ORGANISMO / 89
5. EFECTOS DE LA INFECCIÓN VIRAL SOBRE LAS CÉLULAS / 90
5.1. INFECCIÓN PRODUCTIVA / 91
5.2. INFECCIÓN NO PRODUCTIVA / 93
5.3. I NFECCIÓN VIRAL CON ESCASA Y CONTINUA PRODUCCIÓN
VIRAL / 94
6. ALGUNOS ASPECTOS DE LA RELACIÓN VIRUS-CÉLULA / 94
6.1. CONCEPTOS INTRODUCTORIOS / 94
6.2. ¿CÓMO INGRESA UN VIRUS A UNA CÉLULA? ¿QUÉ HACE EN ELLA? / 94
6.3. MECANISMOS DIRECTOS DE LESIÓN CELULAR / 100
6.4. MECANISMOS INDIRECTOS DE LESIÓN CELULAR / 121
7. MODELOS DE INFECCIÓN / 127
7.1. INFECCIONES AGUDAS / 127
7.2. INFECCIONES PERSISTENTES / 127
8. CONCLUSIONES / 128
CAPÍTULO 6 ONCOGÉNESIS VIRAL
Norberto A. Sanjuan
INTRODUCCIÓN / 131
MECANISMOS ONCOGÉNICOS / 131
EL VIRUS PAPILOMA HUMANO: SU PARTICIPACIÓN
EN LA ONCOGÉNESIS / 132
CAPÍTULO 7 MECANISMOS DE DEFENSA DEL
HOSPEDADOR FRENTE A LAS INFECCIONES
VIRALES
José Raúl Oubiña - María Laura Minassian Verónica Lidia Mathet
1. INTRODUCCIÓN / 135
1.1. HISTORIA / 135
1.2. GENERALIDADES / 135
2. RESISTENCIA INESPECÍFICA E INMUNIDAD INNATA / 137
2.1. CÉLULAS QUE PARTICIPAN EN LA INMUNIDAD INNATA / 138
2.2. FACTORES SOLUBLES QUE PARTICIPAN EN LA INMUNIDAD INNATA / 147
2.3. RNA INTERFERENTES: MIRNA Y SIRNA / 155
3. INMUNIDAD ADAPTATIVA / 157
3.1. INMUNIDAD HUMORAL / 158
3.2. INMUNIDAD CELULAR ADAPTATIVA / 164
4. INTERACCIONES PROTEÍNA-GLICANOS EN EL CONTROL DE
LAS RESPUESTAS INNATA Y ADAPTATIVA: ROL DE LAS
GALECTINAS / 167
4.1. FUNCIÓN DE LAS GALECTINAS / 168
4.2. ESPECIFICIDAD Y AFINIDAD DE LA UNIÓN A GLICANOS / 169
4.3. GALECTINA-1 / 169
4.4. GALECTINA-3 / 169
4.5. GALECTINA-9 / 170
5. APOPTOSIS / 170
5.1. FAMILIA DE LAS CASPASAS / 171
5.2. FAMILIA DE PROTEÍNAS BCL-2 / 172
5.3. VÍA INTRÍNSECA DE LA APOPTOSIS / 174
5.4. VÍA EXTRÍNSECA DE LA APOPTOSIS / 176
6. CONTROL DE LA INFECCIÓN VIRAL / 178
CAPÍTULO 8 EVASIÓN VIRAL A LA RESPUESTA
INMUNE DEL HOSPEDADOR
Verónica Lidia Mathet - José Raúl Oubiña
1. ALTERACIÓN
DEL RECONOCIMIENTO POR PARTE DEL
/ 181
1.1. VARIACIÓN ANTIGÉNICA / 181
1.2 DISMINUCIÓN DE LA EXPRESIÓN GÉNICA VIRAL / 186
1.3 DISOCIACIÓN TEMPORAL DE LA EXPRESIÓN GÉNICA / 186
2. ALTERACIÓN DE LOS MECANISMOS DE DEFENSA DEL
HOSPEDADOR / 187
2.1 INHIBICIÓN DE LA PRESENTACIÓN ANTIGÉNICA / 187
SISTEMA INMUNE
2.2. INHIBICIÓN O MODIFICACIÓN DE LA ACTIVIDAD DEL SISTEMA
INTERFERÓN (IFN) / 187
2.3 MODIFICACIÓN DE LA ACTIVIDAD MEDIADA POR OTRAS
CITOQUINAS / 192
2.4. INFECCIÓN DE CÉLULAS DEL SISTEMA INMUNE O ACCIÓN SOBRE
LAS MISMAS / 192
2.5. REGULACIÓN DE LA APOPTOSIS / 199
2.6. MODIFICACIÓN DE LA ACTIVIDAD DEL SISTEMA DEL
COMPLEMENTO / 202
2.7. SOBRE-EXPRESIÓN DE RECEPTORES PARA FC Y CONSIGUIENTE
UNIÓN DE IGS / 202
2.8. INTERACCIÓN DE PROTEÍNAS VIRALES CON RECEPTORES/
CORRECEPTORES CELULARES –MOLÉCULAS CD– / 203
3. CONCLUSIONES Y PERSPECTIVAS / 203
CAPÍTULO 9 DIAGNÓSTICO VIROLÓGICO
Guadalupe Carballal, José Raúl Oubiña
1. CONCEPTOS INTRODUCTORIOS / 205
1.1 IMPORTANCIA DEL DIAGNÓSTICO VIROLÓGICO / 205
1.2 FUNDAMENTOS DE LA UTILIZACIÓN DE MÉTODOS DIRECTOS E
INDIRECTOS O SEROLÓGICOS / 205
1.3. CONCEPTO DE MÉTODOS DIRECTOS E INDIRECTOS / 206
2. MUESTRAS / 207
2.1. OBTENCIÓN / 207
2.2. OBTENCIÓN DE MUESTRAS PARA AISLAMIENTO VIRAL /207
2.3 OBTENCIÓN DE MUESTRAS PARA DIVERSOS PROCEDIMIENTOS
DIAGNÓSTICOS / 207
2.4 CONSERVACIÓN Y TRANSPORTE AL LABORATORIO / 209
3. MÉTODOS INDIRECTOS O SEROLÓGICOS / 212
3.1 FUNDAMENTO Y APLICACIONES / 212
3.2 DETERMINACIÓN DEL ESTADO INMUNE / 213
3.3 DIAGNÓSTICO DE INFECCIÓN RECIENTE / 213
3.4 TÉCNICAS PARA DIAGNÓSTICO SEROLÓGICO / 213
3.5 TÉCNICAS CONFIRMATORIAS O SUPLEMENTARIAS: WESTERN BLOT E
INMUNOBLOT / 215
4. MÉTODOS DIRECTOS CLÁSICOS: AISLAMIENTO VIRAL / 216
4.1 FUNDAMENTO Y APLICACIONES / 216
4.2. AISLAMIENTO EN CULTIVOS CELULARES / 217
4.3 AISLAMIENTO EN ANIMALES Y HUEVOS EMBRIONADOS / 217
4.4 IDENTIFICACIÓN DE LOS VIRUS AISLADOS / 217
4.5 AISLAMIENTO POR CULTIVO RÁPIDO (SHELL VIAL) / 219
4.6 MEZCLAS DE LÍNEAS CELULARES / 219
4.7 LÍNEAS MODIFICADAS GENÉTICAMENTE / 219
4.8 CUANTIFICACIÓN DE VIRUS / 220
5. DETECCIÓN DE ANTÍGENOS VIRALES / 220
5.1 FUNDAMENTOS Y APLICACIONES / 220
5.2 INMUNOFLUORESCENCIA DIRECTA (IFD) E INDIRECTA (IFI) PARA
DETECCIÓN DE ANTÍGENOS VIRALES / 221
5.3 RADIOINMUNOENSAYO (RIA) / 221
5.4 ENZIMOINMUNOENSAYOS (EIA Y ELISA) / 221
5.5 ELECTROQUIMIOLUMINISCENCIA / 222
5.6 INMUNOPEROXIDASA (IP Y PAP) / 223
6. HISTOPATOLOGÍA Y CITOLOGÍA EXFOLIATIVA / 223
7. MICROSCOPIA ELECTRÓNICA (ME) / 224
8. DETECCIÓN, CARACTERIZACIÓN Y CUANTIFICACIÓN DE
ÁCIDOS NUCLEICOS MEDIANTE TÉCNICAS MOLECULARES / 224
8.1 FUNDAMENTO Y APLICACIONES / 224
8.2 HIBRIDACIÓN CON SONDAS / 225
8.3 AMPLIFICACIÓN SELECTIVA DE ÁCIDOS NUCLEICOS / 226
8.4 ANÁLISIS MEDIANTE ENZIMAS DE RESTRICCIÓN: POLIMORFISMO DE
LA LONGITUD DE LOS FRAGMENTOS (RFLP) / 233
8.5 SECUENCIACIÓN NUCLEOTÍDICA / 233
8.6 MICRODISPOSICIONES DE DNA O MICROARRAYS / 237
8.7 CARGA VIRAL / 239
9. RESPONSABILIDAD MÉDICA EN LA CONSERVACIÓN, MANIPULACIÓN
Y PROCESAMIENTO DE LAS MUESTRAS CLÍNICAS / 240
10. SÍNTESIS Y PERSPECTIVAS / 240
CAPÍTULO 10 ENSAYOS AUTOMATIZADOS PARA
EL DIAGNÓSTICO VIROLÓGICO
Alfredo Martínez
1. INTRODUCCIÓN / 241
1.1 ENZIMOINMUNOENSAYO (EIE O ELISA) / 241
1.2 QUIMIOLUMINISCENCIA / 241
2. ENSAYOS AUTOMATIZADOS: DEFINICIÓN Y CLASIFICACIÓN / 242
2.1 ENSAYOS AUTOMATIZADOS CUALITATIVOS / 242
2.2 ENSAYOS AUTOMATIZADOS CUANTITATIVOS / 243
3. CALIFICACIÓN DEL INSTRUMENTAL / 243
4. VALIDACIÓN Y/O VERIFICACIÓN DE LOS ENSAYOS / 243
4.1 ESTANDARIZACIÓN / 243
4.2 CONTROLES, CALIBRADORES Y ESTÁNDARES / 243
5. CONCLUSIONES / 243
CAPÍTULO 11 INTRODUCCIÓN AL
ASEGURAMIENTO DE LA CALIDAD Y CONTROL
DE LA CALIDAD EN EL LABORATORIO DE
VIROLOGÍA CLÍNICA
Cristina M. Videla - Marta Torres
1. INTRODUCCIÓN / 245
2. DEFINICIONES / 245
3. CONTROL DE CALIDAD EN EL LABORATORIO
VIROLOGÍA / 246
3.1 CONTROL DE CALIDAD INTERNO / 246
3.2 CONTROL DE CALIDAD EXTERNO / 248
4. ELECCIÓN DE MÉTODOS DE DIAGNÓSTICO
Y SU VALIDACIÓN / 249
CAPÍTULO 14 ORTHOMYXOVIRUS
Vilma L. Savy - Elsa G. Baumeister
DE
CAPÍTULO 12 CONCEPTOS SOBRE
EPIDEMIOLOGÍA DE LAS INFECCIONES VIRALES
Jorge López Camelo - Fernando Poletta
1. ¿QUE ES LA EPIDEMIOLOGÍA? / 253
2. DISEÑOS E INDICADORES DE EFECTO / 253
2.1. TIPOS DE ESTUDIOS EN EPIDEMIOLOGÍA / 253
2.2. INDICADORES DE EFECTO / 255
3. EPIDEMIOLOGÍA DE INFECCIONES VIRALES / 255
4. LÍNEAS DE TIEMPO DE LA INFECCIÓN / 255
5. PROBABILIDAD DE TRANSMISIÓN / 256
5.1. ESTIMACIÓN DE LA PROBABILIDAD DE TRANSMISIÓN / 256
5.2. TASA DE ATAQUE SECUNDARIA / 256
5.3. EL MODELO BINOMIAL / 256
6. NÚMERO BÁSICO DE REPRODUCCIÓN / 257
6.1. ESTIMANDO EL NÚMERO BÁSICO DE REPRODUCCIÓN / 257
7. LA TASA DE INCIDENCIA COMO FUNCIÓN DE LA
PREVALENCIA Y LA TASA DE CONTACTO / 257
7.1. TASAS DE CONTACTO Y MODELOS / 257
8. VIGILANCIA EPIDEMIOLÓGICA / 257
PARTE 2: LOS PATÓGENOS VIRALES
HUMANOS
CAPÍTULO 13 INFECCIONES RESPIRATORIAS
DE ORIGEN VIRAL: IMPACTO Y DIAGNÓSTICO
ETIOLÓGICO
Guadalupe Carballal - Marcela Echavarría
1. DEFINICIONES / 261
1.1 IMPACTO / 261
2. VIRUS RESPIRATORIOS
4.1 EL COMIENZO DE UNA NUEVA ERA EN EL DIAGNÓSTICO Y LA
EPIDEMIOLOGÍA DE LOS VIRUS RESPIRATORIOS / 263
4.2 MUESTRAS: OBTENCIÓN / 264
4.3 CONSERVACIÓN Y TRANSPORTE DE MUESTRAS / 265
4.4 TIEMPO DE ESPERA DE RESULTADOS / 266
5. AISLAMIENTO EN CULTIVO / 266
5.1 EN CULTIVO CLÁSICO / 266
5.2 AISLAMIENTO EN CULTIVO RÁPIDO / 266
6. MÉTODOS DIRECTOS Y RÁPIDOS: DETECCIÓN DE
ANTÍGENOS VIRALES / 267
6.1 INMUNOFLUORESCENCIA (IF) / 267
6.2 ENZIMOINMUNOENSAYOS (ELISAS) / 268
6.3 OTROS NUEVOS MÉTODOS RÁPIDOS: ELISA DE MEMBRANA,
INMUNOENSAYOS ÓPTICOS (OIA); INMUNOCROMATOGRAFÍA / 268
7. TÉCNICAS MOLECULARES / 269
7.1 PCR INDIVIDUALES / 269
7.2 PCR MÚLTIPLES / 269
7.3 PCR EN TIEMPO REAL / 270
8. SEROLOGÍA / 272
9. CONCLUSIONES / 272
1. INTRODUCCIÓN / 273
2. ESTRUCTURA / 273
2.1 MORFOLOGÍA / 273
2.2 COMPOSICIÓN QUÍMICA / 273
2.3 ÁCIDO NUCLEICO / 273
2.4 PROTEÍNAS / 274
3. CICLO REPLICATIVO / 276
3.1 ENTRADA / 276
3.2 TRANSCRIPCIÓN Y REPLICACIÓN / 276
3.3 ENSAMBLE Y LIBERACIÓN DE LOS VIRIONES / 276
4. PATOGENIA E INMUNIDAD / 276
4.1 PUERTA DE ENTRADA Y TRANSMISIÓN / 278
4.2 PATOGENIA / 278
4.3 RESPUESTA INMUNE / 279
5. CUADROS CLÍNICOS / 279
5.1 COMPLICACIONES / 280
6. DIAGNÓSTICO VIROLÓGICO / 281
6.1 DIAGNÓSTICO RÁPIDO / 281
6.2 CULTIVO / 281
6.3 SUBTIPIFICACIÓN / 281
6.4 DETECCIÓN DE RNA VIRAL / 282
6.5 DIAGNÓSTICO SEROLÓGICO / 282
7. PROFILAXIS / 282
7.1 VACUNAS INACTIVADAS / 282
7.2. VACUNAS A VIRUS VIVOS / 283
7.3 VACUNAS PARA LA PREVENCIÓN DE LA INFLUENZA PANDÉMICA / 283
8. TRATAMIENTO ANTIVIRAL / 284
9. EPIDEMIOLOGÍA / 284
9.1 VIGILANCIA EPIDEMIOLÓGICA / 284
10. INFLUENZA PANDÉMICA / 285
10.1. LA PANDEMIA DE INFLUENZA A H1N1 / 286
CAPÍTULO 15 PARAMYXOVIRUS
Guadalupe Carballal - Mónica Galiano - Alicia Mistchenko Cristina M. Videla
CAPÍTULO 15.1 CARACTERÍSTICAS DE LA
FAMILIA PARAMYXOVIRIDAE
Guadalupe Carballal - Cristina M. Videla
QUE AFECTAN AL SER HUMANO Y
NOCIONES DE EPIDEMIOLOGÍA
/ 261
3. IMPORTANCIA DEL DIAGNÓSTICO
4. MÉTODOS DIAGNÓSTICOS / 263
ETIOLÓGICO
/ 263
1. TAXONOMÍA / 290
2. MORFOLOGÍA Y ESTRUCTURA
3. CULTIVO / 291
4. CICLO REPLICATIVO / 292
ANTIGÉNICA
/ 290
CAPÍTULO 15.2 VIRUS SINCICIAL RESPIRATORIO
(RSV)
Guadalupe Carballal - Cristina M. Videla
1. CARACTERÍSTICAS / 294
2. ESTRUCTURA ANTIGÉNICA / 295
3. GENOTIPOS / 295
4. CUADROS CLÍNICOS / 295
5. PATOGENIA / 295
6. EPIDEMIOLOGÍA / 296
6.1 EPIDEMIOLOGÍA EN ARGENTINA / 296
7. PROFILAXIS Y TRATAMIENTO / 297
7.1 TRATAMIENTO / 297
7.2 PROFILAXIS PASIVA / 297
7.3 VACUNAS / 298
8. DIAGNÓSTICO / 298
8.1 AISLAMIENTO / 299
8.2 PROCEDIMIENTOS RÁPIDOS / 299
8.3 TÉCNICAS MOLECULARES / 299
8.4 SEROLOGÍA / 299
CAPÍTULO 15.3 VIRUS PARAINFLUENZA Y VIRUS
DE PAROTIDITIS
1.3 CLASIFICACIÓN DE LOS ADENOVIRUS HUMANOS / 310
1.4 REPLICACIÓN / 311
1.5 RESISTENCIA A AGENTES FÍSICO-QUÍMICOS / 311
1.6 MODOS DE TRANSMISIÓN / 311
2. CUADROS CLÍNICOS / 312
2.1 INFECCIONES RESPIRATORIAS / 312
2.2 INFECCIONES OCULARES / 312
2.3 INFECCIONES GASTROINTESTINALES / 312
2.4 INFECCIONES EN PACIENTES INMUNOCOMPROMETIDOS / 313
3. EPIDEMIOLOGÍA / 313
3.1 INFECCIONES RESPIRATORIAS EN NIÑOS DE ARGENTINA / 314
4. PATOGÉNESIS / 314
4.1 LATENCIA Y PERSISTENCIA / 314
4.2 ONCOGENICIDAD / 315
5. RESPUESTA INMUNE / 315
6. DIAGNÓSTICO / 315
6.1 MÉTODOS DIRECTOS / 315
6.2 MÉTODOS INDIRECTOS O SEROLÓGICOS / 317
7. PREVENCIÓN Y TRATAMIENTO / 317
7.1 VACUNAS / 317
7.2 TRATAMIENTO / 317
8. ADENOVIRUS COMO VECTORES / 317
Cristina M. Videla
CAPÍTULO 17 VIGILANCIA EPIDEMIOLÓGICA DE
1. VIRUS PARAINFLUENZA / 300
1.1 CUADROS CLÍNICOS Y EPIDEMIOLOGÍA / 300
1.2 DIAGNÓSTICO / 300
1.3 TRATAMIENTO Y PROFILAXIS / 300
2. VIRUS PAROTIDITIS / 301
2.1 CUADROS CLÍNICOS Y COMPLICACIONES / 301
2.2 PATOGÉNESIS / 301
2.3 DIAGNÓSTICO / 301
2.4 EPIDEMIOLOGÍA Y PROFILAXIS / 301
Osvaldo Uez
CAPÍTULO 15.4 METAPNEUMOVIRUS HUMANO
Guadalupe Carballal - Mónica Galiano - Cristina M. Videla
1. HISTORIA DE SU DESCUBRIMIENTO / 303
2. ESTRUCTURA / 303
3. PATOGENIA / 303
4. CUADROS CLÍNICOS / 303
4.1 EN POBLACIÓN PEDIÁTRICA / 303
4.2 EN POBLACIÓN ADULTA / 304
5. DIAGNÓSTICO / 304
6. PREVENCIÓN Y TRATAMIENTO / 304
7. EPIDEMIOLOGÍA / 304
8. PRIMEROS ESTUDIOS SOBRE HMPV EN ARGENTINA / 304
CAPÍTULO 15.5 SARAMPIÓN
Alicia S. Mistchenko
1. ESTRUCTURA VIRAL / 306
2. PATOGENIA / 306
3. CUADROS CLÍNICOS / 307
3.1 INFECCIÓN PERSISTENTE / 307
4. DIAGNÓSTICO / 307
4.1 DETECCIÓN DEL VIRUS / 307
4.2 CARACTERIZACIÓN MOLECULAR DE GENOTIPOS / 307
4.3 DETECCIÓN DE ANTICUERPOS / 308
5. EPIDEMIOLOGÍA / 308
6. TRATAMIENTO Y PROFILAXIS / 308
CAPÍTULO 16 ADENOVIRUS
Marcela Echavarría
1. GENERALIDADES / 309
1.1 TAXONOMÍA / 309
1.2 ESTRUCTURA / 309
LAS VIROSIS RESPIRATORIAS EN ARGENTINA
1. SISTEMA DE NOTIFICACIÓN OBLIGATORIA DE CASOS / 319
2. VIGILANCIA VIROLÓGICA / 319
3. V IGILANCIA POR EL S ISTEMA DE M ÉDICOS
C ENTINELAS / 319
4. V IGILANCIA POR EL SISTEMA DE U NIDADES
C ENTINELAS / 320
5. IMPORTANCIA DE LA TIPIFICACIÓN Y SUBTIPIFICACIÓN DE
LAS CEPAS DE INFLUENZA EN RELACIÓN A LA FÓRMULA
VACUNAL
/ 320
CAPÍTULO 18 RUBÉOLA
Marta T. Zapata
1. CARACTERÍSTICAS DEL VIRUS RUBÉOLA / 323
1.1 MORFOLOGÍA Y CULTIVO / 323
1.2 PROTEÍNAS ESTRUCTURALES Y NO ESTRUCTURALES / 323
1.3 COMPOSICIÓN ANTIGÉNICA Y GENOTIPOS / 323
2. CUADROS CLÍNICOS Y ETIOPATOGENIA / 324
2.1 RUBÉOLA POST-NATAL / 324
2.2 RUBÉOLA CONGÉNITA / 325
3. EPIDEMIOLOGÍA / 327
3.1 EPIDEMIOLOGÍA EN ARGENTINA / 327
3.2 DISTRIBUCIÓN ETARIA Y PREVALENCIA / 328
4. DIAGNÓSTICO / 328
4.1 MÉTODOS DIAGNÓSTICOS / 328
4.2 SITUACIONES DIAGNÓSTICAS / 329
5. PROFILAXIS Y VACUNACIÓN / 329
CAPÍTULO 19 PARVOVIRUS
Guadalupe Carballal - José Raúl Oubiña
ERYTHROVIRUS
/ 331
2. ESTRUCTURA / 332
3. REPLICACIÓN / 333
4. PATOGÉNESIS / 334
5. CUADROS CLÍNICOS / 334
6. DIAGNÓSTICO / 336
6.1 MICROSCOPIA ELECTRÓNICA / 336
6.2 AISLAMIENTO DEL B19 / 336
6.3 DETECCIÓN DE ÁCIDOS NUCLEICOS / 336
6.4 SEROLOGÍA / 336
1. EL
DESCUBRIMIENTO DE
HUMANOS
Y
BOCAVIRUS
7. EPIDEMIOLOGÍA / 336
8. TRATAMIENTO Y PROFILAXIS / 336
CAPÍTULO 20 ENTEROVIRUS
María Cecilia Freire
1. CARACTERÍSTICAS GENERALES / 339
2. ESTRUCTURA / 339
3. PATOGENIA / 340
4. CUADROS CLÍNICOS / 341
4.1 POLIOMIELITIS / 341
4.2 SÍNDROME POST-POLIO / 341
4.3 MENINGITIS Y ENCEFALITIS / 341
4.4 ENFERMEDAD CARDÍACA / 342
4.5 ENFERMEDAD MUSCULAR Y PLEURODINIA / 342
4.6 DIABETES / 342
4.7 INFECCIONES OCULARES / 342
4.8 INFECCIONES RESPIRATORIAS, HERPANGINA, ENFERMEDAD MANOPIE-BOCA / 342
4.9 ENFERMEDAD NEONATAL / 342
5. DIAGNÓSTICO / 342
5.1 TOMA DE LA MUESTRA / 343
5.2 MÉTODOS DIRECTOS / 343
5.3 MÉTODOS INDIRECTOS / 344
6. TRATAMIENTO / 344
7. PROFILAXIS / 344
8. EPIDEMIOLOGÍA / 345
8.1 EPIDEMIOLOGÍA EN ARGENTINA / 345
9. P ROGRAMA DE ERRADICACIÓN DEL VIRUS POLIO
SALVAJE / 345
CAPÍTULO 21 VIRUS PRODUCTORES DE DIARREA
Silvia V. Nates
1. IMPACTO DE LAS DIARREAS VIRALES EN SALUD / 347
1.1 VIRUS PRODUCTORES DE DIARREAS EN HUMANOS / 347
1.2 VIRUS DEL ESCENARIO ENDÉMICO Y EPIDÉMICO / 347
2. VIRUS DEL ESCENARIO ENDÉMICO / 348
3. ROTAVIRUS / 349
3.1 CLASIFICACIÓN / 349
3.2 PROPIEDADES FÍSICO-QUÍMICAS / 349
3.3 ESTRUCTURA DE LOS ROTAVIRUS GRUPO A / 349
3.4 GENOMA VIRAL / 350
3.5 ESTRUCTURA ANTIGÉNICA DE LAS PROTEÍNAS VIRALES / 350
3.6 REPLICACIÓN VIRAL / 352
3.7 PATOGÉNESIS VIRAL / 353
3.8 HISTORIA NATURAL Y CURSO CLÍNICO DE LA INFECCIÓN POR
ROTAVIRUS / 353
3.9 EPIDEMIOLOGÍA / 353
3.10 INMUNIDAD Y RESISTENCIA DEL HOSPEDADOR / 354
3.11 DIAGNÓSTICO DE LA INFECCIÓN POR ROTAVIRUS / 354
3.12 TRATAMIENTO / 355
3.13 PROFILAXIS / 355
4. VIRUS DEL ESCENARIO EPIDÉMICO / 356
CAPÍTULO 22 RETROVIRUS
María Mercedes Ávila - Mirna Biglione - María Belén Bouzas
- Manuel Gómez Carrillo - Guillermina Dolcini - María de los
Ángeles Pando - Liliana Martínez Peralta - Luisa Sen
CAPÍTULO 22.1 VIRUS DE LA
INMUNODEFICIENCIA HUMANA (HIV)
Manuel Gómez Carrillo
1. VIRUS DE LA INMUNODEFICIENCIA
1.1 ESTRUCTURA VIRAL / 360
1.2 REPLICACIÓN / 362
1.3 ENTRADA / 362
HUMANA
/ 360
1.4 SÍNTESIS DE DNA PROVIRAL / 362
1.5 INTEGRACIÓN / 364
1.6 EXPRESIÓN Y TRANSPORTE DE RNA / 364
1.7 ENSAMBLE, EGRESO Y MADURACIÓN / 364
2. ORIGEN, VARIABILIDAD Y DIVERSIDAD DEL HIV / 364
2.1 VARIABILIDAD / 365
2.2 TIPOS, SUBTIPOS Y RECOMBINANTES / 365
3. EPIDEMIOLOGÍA MOLECULAR DEL HIV-1 / 365
CAPÍTULO 22.2 EPIDEMIOLOGÍA DE LA
INFECCIÓN POR HIV
María Mercedes Ávila - María de los Ángeles Pando
1. HIV/SIDA EN EL MUNDO / 367
2. HIV/SIDA EN LA ARGENTINA / 368
CAPÍTULO 22.3 PATOGENIA DE LA INFECCIÓN
POR HIV-1
Luisa Sen - Andrea Mangano
1. CURSO
HIV-1. HISTORIA
/ 371
1.1 INFECCIÓN AGUDA PRIMARIA / 371
1.2 LATENCIA CLÍNICA ASINTOMÁTICA Y SIDA ENFERMEDAD / 371
2. CATEGORÍAS CLÍNICAS E INMUNOLÓGICAS /372
3. ENTRADA DEL HIV-1 / 372
3.1 EL RECEPTOR PRIMARIO CD4 / 373
3.2 CORRECEPTORES Y QUIMIOQUINAS / 373
4. HIV-1 Y RESPUESTA DEL SISTEMA INMUNE / 374
4.1 RESPUESTA ESPECÍFICA CELULAR / 374
4.2 RESPUESTA ESPECÍFICA HUMORAL / 375
4.3 RESPUESTA ANTIVIRAL DE LA INMUNIDAD INNATA / 375
5. I N M U N O PAT O G É N E S I S D E L A I N F E C C I Ó N P O R E L
HIV-1 / 375
DE LA INFECCIÓN POR EL
NATURAL DE LA INFECCIÓN
CAPÍTULO 22.4 DIAGNÓSTICO DE INFECCIÓN
POR HIV-1/2
María Belén Bouzas
1. INTRODUCCIÓN / 377
2. ENSAYOS DE TAMIZAJE / 377
2.1 ENZIMOINMUNOENSAYOS (ELISAS) / 377
2.2 OTROS ENSAYOS DE TAMIZAJE / 378
3. ENSAYOS SUPLEMENTARIOS / 379
4. ALGORITMO DE DIAGNÓSTICO / 380
5. ANTÍGENO P24 Y DETECCIÓN DE ÁCIDOS NUCLEICOS / 380
5.1 ANTÍGENO P 24 / 380
5.2 DETECCIÓN DE ÁCIDOS NUCLEICOS / 381
5.3 CUANTIFICACIÓN DE RNA DE HIV EN PLASMA / 381
6. DIAGNÓSTICO PEDIÁTRICO / 382
7. CONCLUSIONES / 382
CAPÍTULO 22.5 TRANSMISIÓN MADRE-HIJO DEL
HIV
Guillermina Dolcini - Liliana Martínez Peralta
1. INTRODUCCIÓN / 384
2. EMBARAZO Y PROGRESIÓN DE LA INFECCIÓN POR HIV / 384
3. MODOS DE TRANSMISIÓN MADRE-HIJO Y FACTORES DE
RIESGO / 384
4. PUERTAS DE ENTRADA Y PREVENCIÓN / 385
5. DIAGNÓSTICO DE LA INFECCIÓN PEDIÁTRICA / 385
CAPÍTULO 22.6 VACUNAS PARA EL HIV/SIDA
Liliana Martínez Peralta
1. DIFICULTADES PARA EL DESARROLLO DE UNA VACUNA
PREVENTIVA / 387
2. VACUNAS ATENUADAS / 387
3. VACUNAS INACTIVADAS / 387
4. PARTÍCULAS VIRUS-SÍMIL / 387
5. VACUNAS A SUBUNIDADES / 388
5.1. BASADAS EN ENVOLTURA / 388
5.2. VACUNA A SUBUNIDADES DE PROTEÍNAS NO ESTRUCTURALES / 388
6. VACUNAS A DNA Y VECTORES VACUNALES / 388
7. EL DESARROLLO DE LAS COMBINACIONES PRIMERA VACUNAREFUERZO / 388
8. PROTEÍNAS DE FUSIÓN Y PÉPTIDOS / 388
9. CONCLUSIONES Y PERSPECTIVAS / 388
CAPÍTULO 22.7 VIRUS LINFOTRÓPICO T HUMANO
I Y II (HTLV-I/II)
María E. Eirin - Carolina A. Berini - Mirna M. Biglione
1. HISTORIA Y CLASIFICACIÓN / 390
2. ORGANIZACIÓN DEL VIRIÓN / 390
2.1 ESTRUCTURA GENÓMICA / 390
3. VÍAS DE TRANSMISIÓN / 390
4. ASPECTOS EPIDEMIOLÓGICOS / 391
5. PATOGENIA / 391
5.1. ENFERMEDADES ASOCIADAS AL HTLV-I / 391
5.2 HTLV-II Y ENFERMEDAD / 391
6. A SPECTOS MOLECULARES Y DISTRIBUCIÓN
GEOGRÁFICA / 392
7. DIAGNÓSTICO DE INFECCIÓN POR HTLV-I/II / 392
CAPÍTULO 23 HERPESVIRUS
Virginia Alonio - Guadalupe Carballal - Dolores Fellner Marcela Ferrés - Beatriz Livellara - Celeste Pérez - Alejandra
Piconi - Cristina M. Videla
CAPÍTULO 23.1 CARACTERÍSTICAS DE LA
FAMILIA HERPESVIRIDAE
Marcela Ferrés
1. ESTRUCTURA / 394
2. REPLICACIÓN / 395
CAPÍTULO 23.2 VIRUS HERPES SIMPLEX:
HERPESVIRUS HUMANO (HHV) 1 Y HHV-2
Marcela Ferrés
1. ESTRUCTURA / 396
2. INFECCIÓN AGUDA, LATENCIA Y REACTIVACIÓN / 396
3. PUERTA DE ENTRADA Y CUADROS CLÍNICOS / 398
3.1 INFECCIÓN ORO-FACIAL / 398
3.2 HERPES GENITAL / 399
3.3 ENCEFALITIS HERPÉTICA / 399
3.4. INFECCIÓN DEL RECIÉN NACIDO / 399
4. DIAGNÓSTICO DE LABORATORIO / 399
5. TRATAMIENTO / 400
CAPÍTULO 23.3 VIRUS VARICELA-ZÓSTER (VZV)
O HHV-3
Marcela Ferrés
1. INFECCIÓN AGUDA, LATENCIA Y REACTIVACIÓN / 401
2. PUERTA DE ENTRADA Y DISEMINACIÓN / 401
3. CUADROS CLÍNICOS / 401
4. DIAGNÓSTICO / 402
5. EPIDEMIOLOGÍA / 402
6. TRATAMIENTO / 402
7. PREVENCIÓN / 402
CAPÍTULO 23.4 CITOMEGALOVIRUS HUMANO
(HERPESVIRUS HUMANO 5 O HHV-5)
Guadalupe Carballal - Cristina M. Videla
INTRODUCCIÓN / 404
1. ESTRUCTURA / 404
2. REPLICACIÓN / 405
3. PATOGENIA / 405
3.1 CONTROL DEL CMV POR EL SISTEMA INMUNE / 405
3.2 MECANISMOS DE INTERFERENCIA CON LA RESPUESTA INNMUNE / 406
4. VÍAS DE INFECCIÓN / 406
5. CUADROS CLÍNICOS / 406
5.1 EN INMUNOCOMPETENTES / 406
5.2 EN INMUNOCOMPROMETIDOS / 406
5.3 INFECCIÓN CONGÉNITA / 407
6. DIAGNÓSTICO / 407
6.1 SEROLOGÍA / 407
6.2 MÉTODOS DIRECTOS / 407
7. VALOR DIAGNÓSTICO DE LOS DIFERENTES MÉTODOS
DIRECTOS / 413
8. EPIDEMIOLOGÍA Y PREVENCIÓN / 413
9. VACUNAS EN DESARROLLO PARA CITOMEGALOVIRUS / 414
10. TRATAMIENTO / 414
11. R ESISTENCIA A ANTIVIRALES Y ENSAYOS DE
DETECCIÓN / 414
CAPÍTULO 23.5 HERPESVIRUS HUMANO 6 (HHV6) Y HERPESVIRUS HUMANO 7 (HHV-7)
Beatriz I. Livellara
1. INTRODUCCIÓN / 416
2. BIOLOGÍA / 416
2.1 MORFOLOGÍA / 416
2.2 GENOMA / 416
3. TAXONOMÍA / 417
4. CICLO REPLICATIVO / 417
5. TROPISMO CELULAR / 418
6. EPIDEMIOLOGÍA / 418
7. TRANSMISIÓN / 418
8. ASPECTOS CLÍNICOS Y PATOGÉNESIS / 418
9. TERAPIA ANTIVIRAL / 419
10. DIAGNÓSTICO / 419
11. R ESPUESTA INMUNE FRENTE AL HHV-6 Y AL
HHV-7 / 419
12. O PORTUNIDAD DEL MUESTREO PARA HHV-6 Y
HHV-7 / 421
CAPÍTULO 23.6 VIRUS EPSTEIN-BARR (EBV) O HHV-4
M. Dolores Fellner - M. Alejandra Picconi
1. GENERALIDADES / 422
2. CLASIFICACIÓN Y ESTRUCTURA / 422
3. INFECCIÓN VIRAL / 422
3.1 IN VITRO / 422
3.2 EN EL HOSPEDADOR NATURAL / 424
4. EPIDEMIOLOGÍA / 426
5. PATOLOGÍAS ASOCIADAS / 426
6. DIAGNÓSTICO / 427
6.1 MÉTODOS INDIRECTOS / 427
6.2 MÉTODOS DIRECTOS / 427
7. TERAPÉUTICA Y PERSPECTIVAS PARA
VACUNA / 428
8. CONCLUSIONES / 428
UNA FUTURA
CAPÍTULO 23.7 HERPESVIRUS HUMANO 8
(HHV-8)
Luisa V. Alonio - Celeste Pérez
1. INTRODUCCIÓN / 429
2. CARACTERÍSTICAS DEL VIRUS / 429
2.1 ESTRUCTURA / 429
3. TRANSMISIÓN Y SEROPREVALENCIA / 429
4. PATOGENIA / 430
4.1 PATOLOGÍAS MALIGNAS INDUCIDAS POR EL HHV-8 / 430
5. DIAGNÓSTICO / 431
5.1 SEROLOGÍA / 431
5.2 DETECCIÓN DE DNA VIRAL EN FLUIDOS CORPORALES / 432
6. PREVENCIÓN Y TRATAMIENTO / 432
6.1 PREVENCIÓN / 432
6.2 TRATAMIENTO / 432
CAPÍTULO 24 HEPATITIS VIRALES
María Luján Cuestas - Verónica Lidia Mathet - María Laura
Minassian - José Raúl Oubiña - Cintia Wanda Rivero - Julieta
Trinks
CAPÍTULO 24.1 HEPATITIS VIRALES
José Raúl Oubiña
1. INTRODUCCIÓN / 434
2 EL HÍGADO COMO BLANCO DE INFECCIÓN Y ÓRGANO
INMUNOLÓGICO / 436
3. REGISTRO DE HEPATITIS VIRALES EN ARGENTINA / 439
CAPÍTULO 24.2 HEPATITIS A
Julieta Trinks - José Raúl Oubiña
1. MORFOLOGÍA / 441
2. ASPECTOS BIOLÓGICOS DEL VIRUS / 441
3. ORGANIZACIÓN ESTRUCTURAL Y FUNCIONAL / 441
4. PATOGENIA / 443
5. EPIDEMIOLOGÍA / 445
6. CUADRO CLÍNICO / 447
7. DIAGNÓSTICO / 447
8. PROFILAXIS / 448
CAPÍTULO 24.3 VIRUS HEPATITIS B
Verónica Lidia Mathet - María Luján Cuestas - José Raúl
Oubiña
1. MORFOLOGÍA / 450
2. ORGANIZACIÓN ESTRUCTURAL Y FUNCIONAL / 450
2.1 INTRODUCCIÓN / 450
2.2 GENOMA / 450
2.3 PROTEÍNAS VIRALES / 453
3. ÚNICO TIPO, MÚLTIPLES SUBTIPOS SEROLÓGICOS,
GENOTIPOS Y SUBGENOTIPOS / 457
3.1 GENOTIPOS VIRALES / 459
3.2 SUBGENOTIPOS, CLUSTERS Y RECOMBINANTES
INTERGENOTÍPICAS / 459
3.3 IMPORTANCIA MÉDICA DE LA DETERMINACIÓN DE GENOTIPOS
DEL HBV / 459
4. ASPECTOS BIOLÓGICOS DE LA INFECCIÓN POR
HBV / 459
4.1 ADSORCIÓN A LA MEMBRANA Y PENETRACIÓN / 459
4.2 INFECCIÓN PRODUCTIVA / 460
4.3 INFECCIÓN LATENTE / 464
4.4 INTEGRACIÓN VIRAL / 464
5. ANTÍGENOS VIRALES Y RESPUESTA INMUNE DEL
HOSPEDADOR / 464
5.1 RESPUESTA INMUNE INNATA / 464
5.2 RESPUESTA INMUNE ADAPTATIVA / 464
6. PATOGENIA / 467
6.1 EVOLUCIÓN
TEMPORAL DE LA INFECCIÓN POR
HBV
Y
SU CORRELACIÓN CON LOS MARCADORES SEROLÓGICOS Y
VIROLÓGICOS / 469
7. DIAGNÓSTICO DE LABORATORIO: INTERPRETACIÓN DE
RESULTADOS / 478
7.1 MARCADORES SEROLÓGICOS A SOLICITAR / 478
7.2 APLICACIONES CLÍNICAS DE LAS TÉCNICAS DE BIOLOGÍA
MOLECULAR / 480
7.3 INFECCIÓN OCULTA CON HBV / 482
7.4 CAUSAS DE SERONEGATIVIDAD PARA HBS AG EN INDIVIDUOS
VIRÉMICOS / 482
7.5 C AUSAS DE CODETECCIÓN DE HB S A G Y ANTICUERPOS
ANTI -HB S / 482
8. EPIDEMIOLOGÍA / 482
8.1 RESERVORIO / 482
8.2 FUENTES DE INFECCIÓN / 482
8.3 VÍAS DE TRANSMISIÓN / 482
8.4 PREVALENCIA E INCIDENCIA / 483
8.5 MORTALIDAD / 483
8.6 CONTROL / 483
9. PROFILAXIS / 483
9.1 PROFILAXIS ACTIVA / 483
9.2 PROFILAXIS PASIVA / 486
10. TRATAMIENTO ANTIVIRAL / 487
11. PERSPECTIVAS / 490
CAPÍTULO 24.4 HEPATITIS D
Julieta Trinks - José Raúl Oubiña
1. INTRODUCCIÓN / 492
2. MORFOLOGÍA / 492
3. ESTRUCTURA Y ORGANIZACIÓN FUNCIONAL / 492
3.1 GENOMA VIRAL / 493
3.2 PROTEÍNAS / 494
3.3 REPLICACIÓN / 495
4. PATOGENIA / 495
5. EPIDEMIOLOGÍA / 497
5.1 VÍAS DE TRANSMISIÓN / 497
5.2 PREVALENCIA E INCIDENCIA / 497
5.3 EPIDEMIOLOGÍA MOLECULAR / 498
6. CUADRO CLÍNICO / 498
6.1 SIGNIFICADO CLÍNICO DE LOS GENOTIPOS DEL HDV / 499
7. DIAGNÓSTICO / 499
8. PROFILAXIS / 500
9. TRATAMIENTO / 501
CAPÍTULO 24.5 HEPATITIS C
María Laura Minassian - Cintia Wanda Rivero - José Raúl
Oubiña
1. ASPECTOS HISTÓRICOS / 504
2. EVOLUCIÓN NATURAL DE LA INFECCIÓN / 504
3. AGENTE ETIOLÓGICO / 504
3.1. MORFOLOGÍA / 504
3.2. ORGANIZACIÓN ESTRUCTURAL Y FUNCIONAL / 504
4. REPLICACIÓN VIRAL / 505
5. DIVERSIDAD, VARIABILIDAD GENÓMICA Y SUS IMPLICANCIAS
CLÍNICO-PATOGÉNICAS / 508
6. PATOGÉNESIS MOLECULAR / 509
6.1. INFECCIÓN AGUDA / 510
6.2. INFECCIÓN CRÓNICA / 513
6.3. INFECCIÓN OCULTA / 517
6.4. MANIFESTACIONES EXTRA-HEPÁTICAS / 518
7. DIAGNÓSTICO / 519
7.1. MÉTODOS INDIRECTOS: DETECCIÓN DE ANTICUERPOS / 519
7.2. MÉTODOS DIRECTOS: DETECCIÓN DEL GENOMA VIRAL Y DEL
ANTÍGENO DEL CORE. / 519
8. EPIDEMIOLOGÍA / 523
8.1. RESERVORIO / 523
8.2. FUENTE DE INFECCIÓN / 524
8.3. PREVALENCIA E INCIDENCIA / 524
9. PREVENCIÓN / 526
10. TRATAMIENTO / 528
CAPÍTULO 24.6 HEPATITIS E
Julieta Trinks - José Raúl Oubiña
1. INTRODUCCIÓN / 530
2. MORFOLOGÍA Y CARACTERÍSTICAS DEL HEV / 530
3. PATOGENIA / 531
4. EPIDEMIOLOGÍA / 531
4.1 CARACTERÍSTICAS GENERALES / 531
4.2 RESERVORIOS DEL VIRUS / 532
4.3 VÍAS DE TRANSMISIÓN / 532
4.4 EPIDEMIOLOGÍA MOLECULAR / 533
5. CUADRO CLÍNICO / 533
5.1 SIGNIFICADO CLÍNICO DE LOS GENOTIPOS VIRALES / 533
6. DIAGNÓSTICO / 533
7. PROFILAXIS / 533
CAPÍTULO 24.7 OTROS VIRUS QUE FUERON
POSTULADOS INICIALMENTE COMO
POTENCIALES AGENTES ETIOLÓGICOS DE
HEPATITIS
Julieta Trinks - José Raúl Oubiña
1. VIRUS DE LA HEPATITIS FRANCESA (HFV) / 535
2. VIRUS GB TIPO C (GBV-C) / VIRUS HEPATITIS G
(HGV) / 535
3. VIRUS TT (TTV) / 535
4. VIRUS SEN (SENV) / 536
CAPÍTULO 25 FIEBRES HEMORRÁGICAS DE
ORIGEN VIRAL
Guadalupe Carballal - José Raúl Oubiña
CAPÍTULO 25.1 FAMILIA ARENAVIRIDAE
Guadalupe Carballal - José Raúl Oubiña
1. CARACTERÍSTICAS GENERALES / 538
1.1 ARENAVIRUS Y SUS RESERVORIOS / 539
1.2 ORGANIZACIÓN GENÓMICA Y REPLICACIÓN / 539
2. BASES GENÉTICAS Y MOLECULARES DE LA PERSISTENCIA
VIRAL / 546
3. A RENAVIRUS DEL NUEVO MUNDO O COMPLEJO
TACARIBE / 547
3.1 VIRUS JUNÍN: FIEBRE HEMORRÁGICA ARGENTINA (FHA) / 547
3.2 VIRUS MACHUPO: FIEBRE HEMORRÁGICA BOLIVIANA / 557
3.3 VIRUS GUANARITO: FIEBRE HEMORRÁGICA VENEZOLANA
(FHV) / 557
3.4. VIRUS SABIÁ / 557
3.5. VIRUS CHAPARE / 557
4. ARENAVIRUS DEL VIEJO MUNDO / 558
4.1 VIRUS DE LA CORIOMENINGITIS LINFOCITARIA (LCM,
LYMPHOCYTIC CHORIOMENINGITIS VIRUS) / 558
4.2 VIRUS LASSA: FIEBRE HEMORRÁGICA AFRICANA / 558
5. PERSPECTIVAS / 559
CAPÍTULO 25.2 OTRAS FIEBRES HEMORRÁGICAS
DE ORIGEN VIRAL
Guadalupe Carballal
1. INTRODUCCIÓN / 560
2. FILOVIRUS: FIEBRES HEMORRÁGICAS POR VIRUS MARBURG
Y ÉBOLA / 560
2.1 CARACTERÍSTICAS DE LA FAMILIA FILOVIRIDAE / 560
2.2 TRANSMISIÓN Y CUADROS CLÍNICOS / 560
2.3 EPIDEMIOLOGÍA / 560
2.4 DIAGNÓSTICO VIROLÓGICO / 561
2.5 PREVENCIÓN Y TRATAMIENTO / 562
3. FIEBRES HEMORRÁGICAS CON COMPROMISO RENAL:
HANTAVIRUS / 562
3.1 CARACTERÍSTICAS Y NOCIONES DE EPIDEMIOLOGÍA / 562
3.2 SÍNDROME PULMONAR POR HANTAVIRUS / 562
CAPÍTULO 26 VIRUS DE LA RABIA
Daniel M. Cisterna
1. GENERALIDADES / 565
1.1. CLASIFICACIÓN / 565
1.2. ESTRUCTURA / 565
1.3. REPLICACIÓN / 565
1.4. PROPIEDADES BIOLÓGICAS / 566
1.5. INACTIVACIÓN POR AGENTES QUÍMICOS Y FÍSICOS / 566
2. CUADROS CLÍNICOS / 566
3. PATOGÉNESIS Y RESPUESTA INMUNE / 566
4. EPIDEMIOLOGÍA / 567
4.1. CICLOS DE LA RABIA / 568
5. DIAGNÓSTICO / 568
6. PROFILAXIS PRE-EXPOSICIÓN DE LA RABIA HUMANA / 569
7. PROFILAXIS POST-EXPOSICIÓN / 569
7.1. ACCIONAR LOCAL EN LAS HERIDAS CON POSIBLE EXPOSICIÓN AL VIRUS
DE LA RABIA: MEDIDAS RECOMENDADAS EN TODOS LOS CASOS / 570
8. MEDIDAS A EJECUTAR CON EL ANIMAL AGRESOR / 570
9. CONTROL DE LA RABIA ANIMAL / 570
CAPÍTULO 27 VIRUS TRANSMITIDOS POR
ARTRÓPODOS
Marta S. Sabattini
1. DEFINICIÓN / 573
2. CICLOS SILVESTRES / 573
3. CICLOS URBANOS / 573
4. CLASIFICACIÓN / 573
4.1 SEROLÓGICA / 573
4.2 TAXONÓMICA / 574
5. NOMENCLATURA / 575
6. ASOCIACIÓN CON ENFERMEDADES / 575
7. DIAGNÓSTICO Y ENSAYO VIRAL / 575
7.1 DETECCIÓN DE VIRUS / 575
7.2 DETECCIÓN DE ANTICUERPOS / 577
7.3 INTERPRETACIÓN DE RESULTADOS DIAGNÓSTICOS / 578
8. EPIDEMIOLOGÍA / 578
9. PREVENCIÓN Y CONTROL / 579
CAPÍTULO 28 FAMILIA POXVIRIDAE
Guadalupe Carballal - Susana Mersich
1. LOS VIRUS POX QUE PUEDEN INFECTAR AL HOMBRE / 581
1.1 ASPECTOS HISTÓRICOS / 581
1.2 MORFOLOGÍA DE LOS VIRUS POX / 582
1.3 COMPOSICIÓN QUÍMICA / 582
1.4 REPLICACIÓN / 582
1.5 INTERACCIÓN CON LA CÉLULA HOSPEDADORA / 583
2. VIRUELA / 583
2.1 VÍA DE INFECCIÓN Y FORMAS CLÍNICAS / 583
2.2 PATOGENIA / 583
2.3 DIAGNÓSTICO / 583
2.4 TRATAMIENTO / 584
2.5 EPIDEMIOLOGÍA / 584
3. EL ÉXITO DEL PROGRAMA DE ERRADICACIÓN DE LA
VIRUELA DEL PLANETA / 584
3.1 VACUNA ANTIVARIÓLICA / 586
3.2 INDICACIONES DE LA VACUNACIÓN ANTIVARIÓLICA / 586
3.3 CONTRAINDICACIONES / 586
4. ELIMINACIÓN DEFINITIVA DE LA ESPECIE VIRUELA / 586
5. CONCEPTOS SOBRE BIOTERRORISMO / 586
6. EL VIRUS VACCINIA COMO VECTOR / 587
7. VIRUS DEL MOLUSCO CONTAGIOSO / 587
PARTE 3: VIROSIS EMERGENTES Y
RE-EMERGENTES
CAPÍTULO 29 PAPILOMAVIRUS HUMANOS (HPV)
CAPÍTULO 32 VIRUS EMERGENTES Y REEMERGENTES
María Alejandra Picconi - Angélica Teyssié
1. INTRODUCCIÓN / 589
2. TAXONOMÍA / 589
3. TROPISMO / 589
4. ESTRUCTURA / 589
5. CLASIFICACIÓN EN GENOTIPOS / 590
5.1 ¿CUÁNDO SE HABLA DE UN NUEVO TIPO VIRAL? / 590
5.2 TIPOS VIRALES DE ALTO Y DE BAJO RIESGO, ¿CUÁL ES LA
DIFERENCIA? / 590
6. CICLO DE REPLICACIÓN DEL HPV. DISTINTOS TIPOS DE
INFECCIONES / 590
6.1 INFECCIÓN LATENTE / 590
6.2 INFECCIÓN PRODUCTIVA / 590
7. EPIDEMIOLOGÍA Y PATOGENIA / 591
7.1 LESIONES CUTÁNEAS / 591
7.2 PAPILOMA LARÍNGEO / 591
7.3 LESIONES ANOGENITALES / 592
8. RESPUESTA INMUNE / 593
9. EL HPV EN LA GÉNESIS DEL CÁNCER / 593
10. COFACTORES ASOCIADOS A LA CARCINOGÉNESIS INDUCIDA
POR HPV / 594
11. DIAGNÓSTICO DEL HPV EN EL LABORATORIO: ¿CUÁNDO Y
CÓMO? / 594
11.1 APLICACIÓN CLÍNICA DE LA DETECCIÓN Y GENOTIPIFICACIÓN DEL
HPV / 595
11.2 DIAGNÓSTICO MOLECULAR: DETECCIÓN DE ÁCIDOS NUCLEICOS
VIRALES / 595
11.3 SEROLOGÍA / 596
12. PREVENCIÓN Y CONTROL / 597
13. CONCLUSIONES / 597
CAPÍTULO 30 POLIOMAVIRUS: VIRUS BK Y JC
Marcela Echavarría - Guadalupe Carballal
1. INTRODUCCIÓN / 599
1.1 ESTRUCTURA / 599
1.2 GENOMA / 599
1.3 REPLICACIÓN / 599
2. VIRUS BK / 600
2.1 CUADROS CLÍNICOS / 600
2.2 DIAGNÓSTICO / 600
3. VIRUS JC / 601
3.1 CUADROS CLÍNICOS / 601
3.2 DIAGNÓSTICO / 601
CAPÍTULO 31 ENCEFALOPATÍAS
ESPONGIFORMES TRANSMISIBLES
María I. Berría
1. INTRODUCCIÓN / 603
2. EETS EN ANIMALES / 603
2.1. OVINA (SCRAPIE) / 603
2.2. BOVINA / 603
3. EETS EN HUMANOS / 604
3.1. ENFERMEDAD DE CREUTZFELDT-JAKOB / 604
3.2. SÍNDROME DE GERSTMANN-STRAÜSSLER-SCHEINKER / 604
3.3. INSOMNIO FAMILIAR FATAL / 604
3.4. ADQUIRIDAS / 604
4. ESTRUCTURA Y BIOLOGÍA DE LA PRP / 604
5. PATOGENIA DE LA PRP / 605
6. DIAGNÓSTICO / 605
7. PREVENCIÓN DE LA TRANSMISIÓN ACCIDENTAL / 605
7.1. ENFERMEDAD ANIMAL / 605
7.2. ENFERMEDAD HUMANA / 605
8. TRATAMIENTO / 605
Guadalupe Carballal
1. DENGUE / 610
2. INFLUENZA DE ORIGEN AVIARIO CON POTENCIAL PANDÉMICO / 610
3. CONCLUSIÓN / 610
CAPÍTULO 33 DENGUE
Delia A. Enria - María A. Morales
1. INTRODUCCIÓN / 615
2. ESTRUCTURA Y REPLICACIÓN VIRAL / 615
3. EPIDEMIOLOGÍA / 615
3.1. ORIGEN E HISTORIA NATURAL / 615
3.2. SITUACIÓN MUNDIAL / 615
3.3. SITUACIÓN EN ARGENTINA / 616
4. CUADRO CLÍNICO / 616
5. PATOGENIA / 616
6. TRATAMIENTO / 617
7. DIAGNÓSTICO / 617
8. PREVENCIÓN / 618
CAPÍTULO 34 VIRUS DEL NILO OCCIDENTAL
(WEST NILE VIRUS)
Delia A. Enría - María A. Morales
1. INTRODUCCIÓN / 619
2. ESTRUCTURA Y REPLICACIÓN
3. EPIDEMIOLOGÍA / 619
4. CUADRO CLÍNICO / 620
5. PATOGENIA / 620
6. DIAGNÓSTICO / 621
7. PROFILAXIS / 621
8. TRATAMIENTO / 621
VIRAL
/ 619
CAPÍTULO 35 HANTAVIRUS
Delia A. Enría - María E. Lázaro - Silvana del C. Levis
1. INTRODUCCIÓN / 623
2. ESTRUCTURA / 623
3. REPLICACIÓN / 623
4. EPIDEMIOLOGÍA / 623
4.1. HOSPEDADORES RESERVORIOS / 623
4.2. INFECCIÓN EN EL HOMBRE / 624
4.3. SÍNDROME PULMONAR POR HANTAVIRUS (SPH) EN
ARGENTINA / 624
5. CUADRO CLÍNICO / 624
5.1. FIEBRE HEMORRÁGICA CON SÍNDROME RENAL / 624
5.2. SÍNDROME PULMONAR POR HANTAVIRUS / 624
6. PATOGENIA / 625
7. TRATAMIENTO / 625
8. DIAGNÓSTICO ETIOLÓGICO / 626
9. PROFILAXIS / 626
CAPÍTULO 36 SÍNDROME RESPIRATORIO AGUDO
GRAVE
Julieta Trinks - José Raúl Oubiña
1. RESEÑA HISTÓRICA / 627
2. D ETECCIÓN Y CARACTERIZACIÓN DEL AGENTE
ETIOLÓGICO / 627
2.1. AISLAMIENTO EN CULTIVOS CELULARES / 627
2.2. MICROSCOPIA ELECTRÓNICA / 627
2.3. ANÁLISIS MOLECULAR / 627
2.4. ESTRUCTURA DEL GENOMA VIRAL / 628
3. PATOGÉNESIS / 628
3.1. TROPISMO VIRAL Y RECEPTORES CELULARES / 628
3.2. EFECTO CITOPÁTICO VIRAL: ROL DE LAS PROTEÍNAS VIRALES / 629
3.3. RESPUESTA INMUNE / 629
3.4. SUSCEPTIBILIDAD GENÉTICA DEL HOSPEDERO / 631
4. CUADRO CLÍNICO Y LABORATORIO / 631
5. EPIDEMIOLOGÍA / 632
5.1. VÍAS DE TRANSMISIÓN / 632
5.2. RESERVORIOS DEL VIRUS / 632
5.3. EPIDEMIOLOGÍA MOLECULAR / 632
6. DIAGNÓSTICO / 633
6.1. DIAGNÓSTICO DIRECTO / 633
6.2 DIAGNÓSTICO INDIRECTO / 634
7. PROFILAXIS / 634
7.1. MEDIDAS GENERALES DE PREVENCIÓN / 634
7.2. PROFILAXIS ACTIVA / 634
7.3. PROFILAXIS PASIVA (POST-EXPOSICIÓN) / 634
8. TRATAMIENTO / 634
9. DESAFÍOS FUTUROS / 635
PARTE 4: INFECCIONES VIRALES POR
SISTEMAS
CAPÍTULO 37 INFECCIONES RESPIRATORIAS EN
PEDIATRÍA
Hugo Paganini †
1. INTRODUCCIÓN / 639
2. EPIDEMIOLOGÍA / 639
3. AGENTES ETIOLÓGICOS / 639
4. SÍNDROMES CLÍNICOS / 640
5. TRATAMIENTO / 640
6. PREVENCIÓN / 640
CAPÍTULO 38 INFECCIONES RESPIRATORIAS EN
ADULTOS
Pablo Bonvehí
3.5 ERUPCIONES PURPÚRICAS / 650
3.6 ERUPCIONES PAPULARES Y NODULARES / 650
4. CONCLUSIONES / 650
CAPÍTULO 40 DIAGNÓSTICO DE
GASTROENTERITIS VIRALES
Alfredo Martinez
INTRODUCCIÓN / 651
1. AGENTES VIRALES PRODUCTORES DE DIARREA / 651
1.1 DIARREAS EN INMUNOCOMPETENTES / 651
1.2 DIARREAS EN INMUNOCOMPROMETIDOS / 651
1.3 AGENTES VIRALES / 651
2. DIAGNÓSTICO DE LAS DIARREAS VIRALES / 651
CAPÍTULO 41 HEPATITIS VIRALES: DIAGNÓSTICO
DIFERENCIAL
Alfredo Martinez
1. INTRODUCCIÓN / 653
2. DIAGNÓSTICO DE INFECCIÓN AGUDA / 653
2.1 HEPATITIS A AGUDA / 653
2.2 HEPATITIS B AGUDA / 653
2.3 HEPATITIS D AGUDA / 654
2.4 INFECCIÓN AGUDA POR HCV / 654
2.5 INFECCIÓN AGUDA POR HEV / 654
3. INFECCIÓN PERSISTENTE / 654
4. ALGORITMO DIAGNÓSTICO DE HEPATITIS VIRAL / 654
CAPÍTULO 42 INFECCIONES GENITOURINARIAS
DE ORIGEN VIRAL
Analía Mykietiuk
1. INTRODUCCIÓN / 657
2. INFECCIONES GENITALES VIRALES / 657
2.1 HERPES GENITAL / 657
2.2 PAPILOMAVIRUS HUMANO (HPV) / 658
3. INFECCIONES URINARIAS DE ORIGEN VIRAL / 659
3.1. CISTITIS HEMORRÁGICA / 659
CAPÍTULO 43 INFECCIONES VIRALES EN LA
EMBARAZADA Y EL RECIÉN NACIDO
1. INTRODUCCIÓN / 643
2. RESFRÍO COMÚN O RINITIS AGUDA / 643
2.1 PRESENTACIÓN CLÍNICA / 643
2.2 EPIDEMIOLOGÍA Y AGENTES ETIOLÓGICOS / 643
2.3 TRATAMIENTO / 643
2.4 PREVENCIÓN / 643
2.5 COMPLICACIONES / 644
3. INFLUENZA / 644
3.1 PRESENTACIÓN CLÍNICA / 644
3.2 COMPLICACIONES / 644
3.3 TRATAMIENTO ANTIVIRAL / 645
3.4 VACUNACIÓN ANTIGRIPAL / 645
4. OTROS VIRUS RESPIRATORIOS EN ADULTOS / 645
4.1 CORONAVIRUS / 645
4.2 PARAINFLUENZA / 646
4.3 VIRUS SINCICIAL RESPIRATORIO / 646
4.4 METAPNEUMOVIRUS HUMANO (HMPV) / 646
FETO / 661
3. VÍAS DE TRANSMISIÓN / 661
3.1 INFECCIONES TRANSPLACENTARIAS O CONGÉNITAS (ASCENDENTES O
NO) / 661
3.2 INFECCIONES PERINATALES / 662
4. DIAGNÓSTICO / 662
4.1 EL DIAGNÓSTICO EN LA EMBARAZADA / 662
4.2 EL DIAGNÓSTICO EN EL RECIÉN NACIDO / 662
5. EPIDEMIOLOGÍA DE LAS INFECCIONES VIRALES CONGÉNITAS
EN ARGENTINA / 663
6. CONCLUSIONES / 664
CAPÍTULO 39 INFECCIONES VIRALES DE PIEL Y
MUCOSAS
CAPÍTULO 44 INFECCIONES VIRALES
TRANSMISIBLES POR VÍA TRANSFUSIONAL
Elena R. Temporiti
1. PATOGÉNESIS DE LA INFECCIÓN VIRAL EN LA PIEL / 647
2. RESPUESTA INMUNE / 647
3. EXANTEMAS: CLASIFICACIÓN / 647
3.1 ERUPCIONES MÁCULO-PAPULOSAS DE DISTRIBUCIÓN CENTRAL / 647
3.2 ERUPCIONES MÁCULO-PAPULOSAS DE DISTRIBUCIÓN PERIFÉRICA / 649
3.3 ERUPCIONES VESÍCULO-COSTROSAS / 649
3.4 ERUPCIONES URTICARIANAS / 649
Angélica L. Distéfano
1. INTRODUCCIÓN / 661
2. FACTORES QUE DETERMINAN
LA APARICIÓN Y EVOLUCIÓN
DE LA ENFERMEDAD EN LA EMBARAZADA Y EL EMBRIÓN O
Jorgelina L. Blejer
1. INTRODUCCIÓN / 665
2. INFECCIONES POR HBV, HCV Y OTROS VIRUS
CAUSANTES DE HEPATITIS / 665
2.1. VIRUS HEPATITIS B / 665
2.2. VIRUS HEPATITIS C / 665
2.3. OTROS VIRUS CAUSANTES DE HEPATITIS / 666
3. INFECCIONES POR RETROVIRUS / 666
3.1. HIV / 666
3.2. HTLV- I Y II / 666
4. INFECCIONES POR OTROS VIRUS / 666
4.1. CITOMEGALOVIRUS (CMV) / 666
4.2. PARVOVIRUS B19 / 666
5. INFECCIONES POR VIRUS EMERGENTES / 666
5.1. VIRUS GB-C (GBV-C) / 666
5.2. TTV / 667
5.3. SEN-V / 667
5.4. HERPESVIRUS HUMANO-8 (HHV-8) / 667
5.5. CORONAVIRUS ASOCIADO AL SARS / 667
5.6. VIRUS DEL OESTE DEL NILO (WEST NILE VIRUS [WNV]) / 667
6. TÉCNICAS PARA DETECCIÓN DE ÁCIDOS NUCLEICOS (NAT)
EN MEDICINA TRANSFUSIONAL / 667
CAPÍTULO 45 INFECCIONES VIRALES EN
PACIENTES CON INMUNOSUPRESIÓN POSTTRASPLANTE
2. HERPES SIMPLEX (HSV) / 683
2.1 ENFERMEDAD OCULAR / 683
2.2 ENFERMEDAD MUCOCUTÁNEA / 684
2.3 ENFERMEDAD NEUROLÓGICA / 684
2.4 ENFERMEDAD GASTROINTESTINAL / 684
3. VIRUS VARICELA-ZÓSTER (VZV) / 684
3.1 ENFERMEDAD OCULAR / 684
3.2 ENFERMEDAD NEUROLÓGICA / 684
3.3 ENFERMEDAD CUTÁNEA / 684
4. POLIOMAVIRUS JC / 684
4.1 LEUCOENCEFALOPATÍA MULTIFOCAL PROGRESIVA (LEMP) / 684
5. VIRUS EPSTEIN-BARR (EBV) / 685
5.1 LEUCOPLASIA ORAL VELLOSA / 685
5.2 LINFOMAS PRIMARIOS DEL SISTEMA NERVIOSO CENTRAL
(LPSNC) / 685
6. VIRUS PAPILOMA HUMANO (HPV) / 685
Laura Barcán - Fabián Herrera
1. INTRODUCCIÓN / 669
1.1 INFECCIONES EN TRASPLANTES DE CÉLULAS PROGENITORAS
HEMATOPOYÉTICAS (TCPH) / 669
1.2 INFECCIONES EN TRASPLANTES DE ÓRGANO SÓLIDO (TOS) / 669
2. CITOMEGALOVIRUS HUMANO (HCMV) / 669
2.1 TCPH / 669
2.2 TOS / 670
3. VIRUS EPSTEIN-BARR (EBV) / 671
3.1. TCPH / 671
3.2 TOS / 672
4. VIRUS HERPES SIMPLEX (HSV) / 672
4.1. TCPH / 672
4.2. TOS / 673
5. VIRUS VARICELA-ZÓSTER (VZV) / 673
5.1. TCPH / 673
5.2 TOS / 673
6. HERPESVIRUS HUMANO 6 (HHV-6) / 673
6.1. TCPH / 673
6.2 TOS / 674
7. HERPESVIRUS HUMANO 7 (HHV-7) / 674
8. HERPESVIRUS HUMANO 8 (HHV-8) / 674
9. VIRUS RESPIRATORIOS / 674
9.1 TCPH / 674
9.2 TOS / 675
10. VIRUS HEPATITIS B (HBV) / 676
10.1. TCPH / 676
10.2 TOS / 676
11. VIRUS HEPATITIS C (HCV) / 676
11.1 TPCH / 676
11.2 TOS / 677
12. OTROS VIRUS / 677
12.1 VIRUS BK / 677
12.2 VIRUS JC / 677
12.3 PARVOVIRUS B19 / 678
12.4 ADENOVIRUS / 678
CAPÍTULO 46 INFECCIONES VIRALES DEL
SISTEMA NERVIOSO CENTRAL / 679
Jorge A. Benetucci - Marcelo Corti
CAPÍTULO 47 INFECCIONES OPORTUNISTAS
VIRALES EN PACIENTES CON ENFERMEDAD
HIV/SIDA
Jorge A. Benetucci - Marcelo Corti
1. CITOMEGALOVIRUS HUMANO (HCMV) / 683
1.1 ENFERMEDAD OCULAR / 683
1.2 ENFERMEDAD GASTROINTESTINAL / 683
1.3 ENFERMEDAD NEUROLÓGICA / 683
PARTE 5: PROFILAXIS Y TRATAMIENTO
DE LAS INFECCIONES VIRALES
CAPÍTULO 48 VACUNAS VIRALES
Guadalupe Carballal - José Raúl Oubiña
INTRODUCCIÓN / 689
1. ASPECTOS HISTÓRICOS / 690
2. FACTORES ESENCIALES A CONSIDERAR EN LA PREPARACIÓN
DE VACUNAS / 690
2.1 INDUCCIÓN DE INMUNIDAD CON LOS DIFERENTES TIPOS DE
VACUNAS / 691
2.2 D ESARROLLO DE MODELOS EN ANIMALES DE
EXPERIMENTACIÓN / 691
2.3 CEPA VIRAL / 691
2.4 SUSTRATO / 692
2.5 MÉTODOS DE INACTIVACIÓN Y DE ATENUACIÓN / 692
2.6 BASES GENÉTICAS DE LA ATENUACIÓN / 694
2.7 PURIFICACIÓN / 694
2.8 EL USO DE ADYUVANTES PARA AUMENTAR LA
INMUNOGENICIDAD / 694
3. BENEFICIOS VERSUS RIESGOS EN LA VACUNACIÓN / 695
4. VACUNAS A VIRUS INACTIVADO / 695
4.1 A VIRUS COMPLETO / 695
4.2 VACUNAS INACTIVADAS CON FRACCIÓN ANTIGÉNICA, A
SUBUNIDADES Y VLPS / 696
VLPS (Virus Like Particles) / 697
4.3 ETAPAS EN LA PREPARACIÓN DE UNA VACUNA A VIRUS
INACTIVADO / 698
5. VACUNAS A VIRUS VIVO Y ATENUADO / 698
VENTAJAS / 698
DESVENTAJAS / 698
5.1 ETAPAS EN LA OBTENCIÓN DE VACUNAS A VIRUS VIVO Y
ATENUADO / 699
6. VACUNAS DE USO ACTUAL EN ADULTOS Y NIÑOS:
CALENDARIO OFICIAL DE VACUNACIÓN EN ARGENTINA / 699
VACUNAS OBLIGATORIAS PARA NIÑOS, SEGÚN EL CALENDARIO
OFICIAL DE VACUNACIÓN EN ARGENTINA Y OTRAS VACUNAS NO
OBLIGATORIAS / 699
7. PERSPECTIVAS PARA EL FUTURO / 700
7.1 EL POTENCIAL USO DE OLIGODESOXINUCLEÓTIDOS (ODN) CON
ISLAS CPG / 700
7.2 VACUNAS A DNA / 700
7.3 VACUNAS A VIRUS RECOMBINANTES / 703
7.4 PLANTAS TRANSGÉNICAS / 705
7.5 NUEVAS APROXIMACIONES PARA LA ATENUACIÓN VIRAL / 705
7.6 CONCLUSIONES / 705
CAPÍTULO 49 AGENTES ANTIVIRALES
Elsa B. Damonte - Susana E. Mersich
1. INTRODUCCIÓN / 707
2. ESTRATEGIAS PARA EL
UNA DROGA ANTIVIRAL
3. PROBABLES
DESARROLLO Y LA APROBACIÓN DE
/ 707
BLANCOS DE ATAQUE POR ANTIVIRALES EN EL
/ 708
4. PRINCIPALES ANTIVIRALES EN USO CLÍNICO / 709
4.1 INFECCIONES POR HERPESVIRUS / 709
4.2 HEPATITIS VIRALES / 712
4.3 INFECCIONES RESPIRATORIAS / 713
5. PERSPECTIVAS FUTURAS: APLICACIÓN DE LA GENÓMICA
PARA EL DISEÑO DE ANTIVIRALES / 714
4. VIABILIDAD DE LOS VIRUS ENTÉRICOS / 726
5. MÉTODOS PARA CONCENTRAR VIRUS ENTÉRICOS / 726
6. EPIDEMIOLOGÍA DE ENFERMEDADES VIRALES TRANSMITIDAS
POR AGUA Y ALIMENTOS / 726
7. C ONTROL DE VIRUS ENTÉRICOS EN AGUA Y
ALIMENTOS / 727
8. PERSPECTIVAS / 727
CICLO DE MULTIPLICACIÓN VIRAL
CAPÍTULO 50 INTRODUCCIÓN AL TRATAMIENTO
ANTIRRETROVIRAL Y RESISTENCIA EN LA
INFECCIÓN POR HIV-1
Mauricio G. Carobene - Horacio Salomón
1. TRATAMIENTO ANTIRRETROVIRAL / 717
1.1 INHIBIDORES DE LA ENTRADA Y LA FUSIÓN (FIS) / 717
1.2 INHIBIDORES NUCLEOSÍDICOS DE LA TRANSCRIPTASA INVERSA
(NRTIS, NUCLEOSIDE REVERSE TRANSCRIPTASE INHIBITORS) / 717
1.3 INHIBIDORES NUCLEOTÍDICOS DE LA TRANSCRIPTASA INVERSA / 717
1.4 INHIBIDORES NO NUCLEOSÍDICOS DE LA TRANSCRIPTASA
INVERSA (NNRTIS, NON-NUCLEOSIDE REVERSE TRANSCRIPTASE
INHIBITORS) / 717
1.5 INHIBIDORES DE LA INTEGRASA VIRAL (INS, INTEGRASE
INHIBITORS) / 718
1.6 INHIBIDORES DE LA ENTRADA VIRAL (EIS, ENTRY INHIBITORS) / 718
1.7 INHIBIDORES DE LA MADURACIÓN VIRAL (MIS, MATURATION
INHIBITORS) / 718
1.8 INHIBIDORES DE LA PROTEASA VIRAL (PIS, PROTEASE
INHIBITORS) / 718
1.9 TRATAMIENTOS COMBINADOS / 718
2 VARIABILIDAD DEL HIV / 718
2.1 MUTACIÓN / 718
2.2 INSERCIONES Y DELECIONES / 718
2.3 RECOMBINACIÓN / 719
3 CUASIESPECIES Y RESISTENCIA A DROGAS. CONCEPTO DE
FITNESS VIRAL / 719
4 RESISTENCIA A DROGAS ANTIRRETROVIRALES / 719
4.1 GENOTIPO Y FENOTIPO / 719
4.2 MECANISMOS DE RESISTENCIA DEL HIV-1 A DROGAS
ANTIRRETROVIRALES / 719
4.3 FENÓMENOS ASOCIADOS A LA RESISTENCIA / 720
4.4 MUTACIONES ASOCIADAS A RESISTENCIA A ANTIRRETROVIRALES / 720
5 ENSAYOS DE RESISTENCIA DEL HIV-1 A DROGAS
ANTIRRETROVIRALES / 720
5.1 ENSAYOS FENOTÍPICOS / 720
5.2 ENSAYOS GENOTÍPICOS / 721
5.3 P ROBLEMAS INHERENTES A LOS SISTEMAS DE
GENOTIPIFICACIÓN / 721
5.4 ENSAYOS GENOTÍPICOS VERSUS FENOTÍPICOS PARA EL ESTUDIO DE
LA RESISTENCIA / 722
6. LA RESISTENCIA DEL HIV-1 A ANTIRRETROVIRALES COMO
CAUSA DE FALLA AL TRATAMIENTO / 722
7 GENOTIPO/FENOTIPO VIRAL E IMPLEMENTACIÓN DE
TRATAMIENTO / 722
8 CONCLUSIONES / 723
CAPÍTULO 51 VIROLOGÍA AMBIENTAL: VIRUS
TRANSMITIDOS POR AGUA Y ALIMENTOS
María Susana López de Caillou
1. AGUA: RECURSO ESTRATÉGICO DEL SIGLO XXI / 725
2. VIRUS TRANSMITIDOS POR AGUA Y ALIMENTOS / 725
3. CARACTERÍSTICAS DE LOS VIRUS EN MUESTRAS
AMBIENTALES / 726
PARTE 6: EPIDEMIOLOGÍA MOLECULAR
DE ALGUNAS INFECCIONES VIRALES
EN ARGENTINA
CAPÍTULO 52 EVOLUCIÓN VIRAL
Rodolfo H. Campos - Viviana Mbayed
1. INTRODUCCIÓN / 731
2. MÉTODOS UTILIZADOS PARA EL ANÁLISIS DE LA EVOLUCIÓN
DE LOS VIRUS / 731
3. EL PROCESO EVOLUTIVO / 733
4. LOS VIRUS Y SU ENTORNO. PRESIONES SELECTIVAS / 734
5. RESPUESTA DE LOS VIRUS A LAS PRESIONES DEL
ENTORNO / 734
6. GENERACIÓN DE HETEROGENEIDAD VIRAL / 734
6.1. MUTACIÓN / 734
6.2. REASOCIACIÓN EN GENOMAS FRAGMENTADOS / 735
6.3. RECOMBINACIÓN / 735
7. LIMITACIONES DEL PROCESO EVOLUTIVO VIRAL / 736
8. COEVOLUCIÓN HOSPEDADOR-PARÁSITO / 736
9. ORIGEN DE LOS VIRUS: TEORÍAS / 737
10. CONCLUSIONES FINALES / 737
CAPÍTULO 53 EPIDEMIOLOGÍA MOLECULAR
DEL VIRUS SINCICIAL RESPIRATORIO EN
ARGENTINA / 739
Mónica Galiano - Alfonsina Trento - Cristina Videla
CAPÍTULO 54 EPIDEMIOLOGÍA MOLECULAR DEL
METAPNEUMOVIRUS HUMANO / 743
Mónica Galiano - Alfonsina Trento - Cristina Videla
CAPÍTULO 55 EPIDEMIOLOGÍA MOLECULAR DE
LAS INFECCIONES RESPIRATORIAS AGUDAS
POR ADENOVIRUS
Adriana E. Kajon
1. INTRODUCCIÓN / 745
2. GENOTIPIFICACIÓN MEDIANTE ANÁLISIS CON ENZIMAS DE
RESTRICCIÓN / 745
3. ENSAYOS MOLECULARES PARA LA DETERMINACIÓN DE
ESPECIE Y SEROTIPO DE CEPAS DE ADENOVIRUS / 745
4. EPIDEMIOLOGÍA MOLECULAR DE LA INFECCIÓN
RESPIRATORIA AGUDA BAJA EN HOSPITALES DE LA CIUDAD
DE
BUENOS AIRES
Y ALREDEDORES
/ 746
CAPÍTULO 56 EPIDEMIOLOGÍA MOLECULAR DE
HANTAVIRUS / 747
Paula J. Padula
PARTE 7: BIOSEGURIDAD
CAPÍTULO 57 BIOSEGURIDAD EN LA PRÁCTICA
BIOMÉDICA Y EN EL LABORATORIO
Liliana Martínez Peralta
1. INTRODUCCIÓN / 753
2. PRINCIPIOS DE BIOSEGURIDAD / 753
2.1 BARRERAS PRIMARIAS: PRÁCTICAS Y TÉCNICAS DE LABORATORIO / 754
2.2 BARRERAS PRIMARIAS: EQUIPO DE SEGURIDAD / 754
2.3 BARRERAS SECUNDARIAS: DISEÑO DE LAS INSTALACIONES / 755
3. NIVELES DE BIOSEGURIDAD / 755
3.1. NIVEL 1 (BSL 1) / 755
3.2. NIVEL 2 (BSL 2) / 755
3.3. NIVEL 3 (BSL 3) / 756
3.4. NIVEL 4 (BSL 4) / 757
3.5. BIOTERIOS DE ANIMALES / 757
4. INMUNIZACIÓN Y TRATAMIENTO DEL PERSONAL / 757
PARTE 8: NUEVOS VIRUS
RESPIRATORIOS EMERGENTES
INCLUYENDO EL VIRUS DE LA
INFLUENZA PANDÉMICA H1N1 (2009)
CAPÍTULO 58 VIRUS RESPIRATORIOS
EMERGENTES Y EL NUEVO IMPACTO DE LOS
RINOVIRUS POR MEDIO DEL DIAGNÓSTICO
MOLECULAR
Guadalupe Carballal - Débora N. Marcone - Cristina M. Videla
INTORDUCCIÓN / 761
1. LOS NUEVOS PARVOVIRUS HUMANOS / 761
1.1. EL DESCUBRIMIENTO DEL BOCAVIRUS HUMANO (HBOV) / 761
1.2 CARACTERÍSTICAS DE LA FAMILIA PARVOVIRIDAE Y LA INCLUSIÓN
DEL HBOV EN ELLA / 762
2. BOCAVIRUS HUMANO (HBOV) / 762
2.1 FRECUENCIA Y CUADROS CLÍNICOS / 762
2.2 HBO V Y DIARREA: ¿UN NUEVO PATÓGENO ENTÉRICO? / 763
2.3 DIAGNÓSTICO / 763
2.4 CONCLUSIONES / 763
3. PARV4: ¿UN NUEVO VIRUS EMERGENTE DE PROBABLE
TRANSMISIÓN POR SANGRE? / 764
4. CORONAVIRUS / 764
4.1 CARACTERÍSTICAS DE LA FAMILIA CORONAVIRIDAE / 764
4.2 CORONAVIRUS CLÁSICOS / 764
4.3 LOS NUEVOS CORONAVIRUS RESPIRATORIOS / 764
5. POLIOMAVIRUS RESPIRATORIOS: KI Y WU / 765
6. RINOVIRUS / 765
6.1 CARACTERÍSTICAS DE LOS RINOVIRUS / 765
6.2 CUADROS CLÍNICOS Y EPIDEMIOLOGÍA / 766
6.3 PATOGENIA DE LOS RINOVIRUS / 766
6.4 DIAGNÓSTICO / 767
6.5 EL NUEVO IMPACTO DE LOS RINOVIRUS EN LAS IRA ALTAS Y
BAJAS EN LA POBLACIÓN PEDIÁTRICA POR MEDIO DEL DIAGNÓSTICO
MOLECULAR / 768
6.6 TRATAMIENTO Y PREVENCIÓN / 768
6.7 CONCLUSIONES / 768
CAPÍTULO 59 LOS COMIENZOS DE LA
PANDEMIA POR UNA NUEVA CEPA DE
INFLUENZA A (H1N1), 2009
Guadalupe Carballal - Débora Marcone - Osvaldo Uez
1. CARACTERÍSTICAS
DE LOS VIRUS INFLUENZA A Y EL
POTENCIAL PANDÉMICO DE LAS CEPAS DE INFLUENZA
AVIAR / 771
1.1. LAS PANDEMIAS DEL SIGLO XX / 771
2. LOS INICIOS DE LA PANDEMIA POR EL
INFLUENZA A (H1N1) / 771
NUEVO VIRUS
3. FASES DE ALERTA DE PANDEMIA: DEFINICIONES / 772
4. EL VIRUS: SU NOMBRE Y PATOGÉNESIS / 772
4.1. PATOGÉNESIS / 772
5. TRANSMISIÓN VIRAL Y PERÍODO DE CONTAGIO / 774
5.1 PERÍODO DE CONTAGIO / 774
6. CUADRO CLÍNICO Y DEFINICIONES / 774
6.1 DEFINICIONES DE CASO PROBABLE, SOSPECHOSO Y
CONFIRMADO / 774
6.2 DEFINICIONES DE CASO PARA INFLUENZA A (H1N1) / 774
7. DIAGNÓSTICO VIROLÓGICO / 775
7.1. MUESTRAS RESPIRATORIAS / 775
7.2 PROCEDIMIENTO DE OBTENCIÓN / 775
7.3 ALMACENAMIENTO Y ENVÍO DE MUESTRAS EN CONDICIONES DE
BIOSEGURIDAD / 775
7.4 INSUMOS PARA OBTENCIÓN DE MUESTRAS / 776
8. DIAGNÓSTICO VIROLÓGICO: METODOLOGÍA / 776
8.1 DETECCIÓN DEL RNA VIRAL POR RT-PCR EN TIEMPO REAL / 776
8.2 AISLAMIENTO EN CULTIVO / 776
8.3 DETECCIÓN DE ANTÍGENO VIRAL POR INMUNOFLUORESCENCIA U
OTROS MÉTODOS RÁPIDOS / 776
9. NOCIONES DE TRATAMIENTO / 777
9.1 RESISTENCIA A ANTIVIRALES / 777
10. PREVENCIÓN / 777
11. DATOS INICIALES DEL NUEVO VIRUS INFLUENZA A H1N1
EN ARGENTINA / 777
CAPÍTULO 59.1 VACUNAS PARA EL VIRUS DE
INFLUENZA PANDÉMICA A H1N1, 2009
Débora N. Marcone, Guadalupe Carballal
INFLUENZA PANDÉMICA / 782
1. DESARROLLO DE VACUNAS CONTRA INFLUENZA
PANDÉMICA / 782
1.1 OBJETIVOS DE LA CAMPAÑA NACIONAL DE VACUNACIÓN 2010 EN
ARGENTINA / 782
1.2 INDICACIONES DE LA VACUNACIÓN CONTRA INFLUENZA PANDÉMICA
DURANTE EL AÑO 2010 / 783
1.3 INDICACIONES DE LA VACUNACIÓN CONTRA INFLUENZA A PARTIR
DEL AÑO 2011 / 783
2. VACUNA MONOVALENTE INACTIVADA PARA GRIPE
PANDÉMICA / 783
2.1 COMPOSICIÓN / 783
2.2 DOSIS Y VÍAS DE ADMINISTRACIÓN / 783
2.3 CONSIDERACIONESPARA EL EMBARAZO Y LA LACTANCIA / 784
2.4 CONSERVACIÓN, PRESENTACIÓN Y VACUNACIÓN SEGURA / 784
2.5 CONTRAINDICACIONES PARA LA VACUNACIÓN / 784
3. VACUNA TRIVALENTE PARA GRIPE PANDÉMICA / 784
3.1 COMPOSICIÓN / 784
3.2 PRESENTACIÓN, DOSIS Y VÍAS DE ADMINISTRACIÓN / 784
4. VACUNA INTRANASAL A VIRUS VIVO Y ATENUADO / 784
5. EFICACIA Y SEGURIDAD DE LAS VACUNAS PARA
INFLUENZA / 784
5.1 EFICACIA / 784
5.2 VACUNACIÓN SEGURA / 784
6. VIGILANCIA Y NOTIFICACIÓN DE EFECTOS ADVERSOS
SUPUESTAMENTE ATRIBUIDOS A VACUNACIÓN (ESAVI) / 785
6.1 VIGILANCIA Y NOTIFICACIÓN / 785
6.2 CLASIFICACIÓN / 785
6.3 ESAVI EN RELACIÓN A VACUNAS INACTIVADAS PARA GRIPE
PANDÉMICA / 785
6.4 ESAVI NOTIFICADOS EN RELACIÓN A LA VACUNA ANTIINFLUENZA / 785
7. CONCLUSIÓN / 785
Todo tiene su belleza, pero no todos pueden verla.
Confucio
PRÓLOGO
'DGRHOp[LWRHGLWRULDOGHODrª edición de Virología MédicaSXEOLFDGDHQSRU(GLWRULDO(O$WHQHRGHELPRVDFWXDOL]DUHVWHOLEUR
HQ dHGLFLyQ \–nuevamente–HQ rHGLFLyQ (VWHWH[WRIXHGHXWLOLGDGSDUDPLOHVGHHVWXGLDQWHVGHJUDGRGHODVFDUUHUDV
de Medicina, Bioquímica y Biología en Argentina, así como en muchos otros países de América Latina. A nivel posgrado, fue consultado por médicos clínicos, pediatras e infectólogos.
/DVLQIHFFLRQHVYLUDOHVVRQXQDGHODVPiVLPSRUWDQWHVFDXVDVGHHQIHUPHGDGKXPDQDHQODDFWXDOLGDG+DVWDKDFHSRFDVGpFDGDVORV
YLUXVHVWDEDQUHOHJDGRVHQODSUiFWLFDPpGLFDGHELGRDODVGL¿FXOWDGHVLQKHUHQWHVDVXdiagnóstico y a la ausencia de tratamientos especí¿FRV(VWRVGRVIDFWRUHVVHPRGL¿FDURQVXVWDQFLDOPHQWH(QODDFWXDOLGDGHVSRVLEOHHOGLDJQyVWLFRUiSLGR\SUHFLVRGHQXPHURVRVYLUXV
SDUDYDULRVGHORVFXDOHVH[LVWHQWUDWDPLHQWRVHIHFWLYRVFX\Rp[LWRGHEHVHUPRQLWRUHDGR
(QORV~OWLPRVDxRVODH[SDQVLyQGHOD9LURORJtD0pGLFDKDVLGRYHUWLJLQRVD6HGHVFXEULHURQQXHYRVYLUXV ERFDYLUXVPHWDSQHXPRYLUXVKXPDQRHQWUHRWURV VHSURGXMHURQFDVRVKXPDQRVDVRFLDGRVDODHPHUJHQFLDGHQXHYRVYLUXV coronavirus asociado al síndrome
respiratorio agudo grave, LQÀXHQ]D$+1DVRFLDGRDODJULSHDYLDULDHWF (QHOVHUHJLVWUyXQDSDQGHPLDSRUXQQXHYRYLUXV
LQÀXHQ]D$+1VHGHWHFWyODUHHPHUJHQFLDGHDOJXQRVYLUXVTXHVHFUHtDQHUUDGLFDGRVHQ$UJHQWLQD ORVDJHQWHVGHOD¿HEUHDPDULOOD
\HOGHQJXH VHSURIXQGL]yHOHVWXGLRGHORVJHQRPDVYLUDOHV\GHVXHSLGHPLRORJtDPROHFXODUVHDYDQ]yHQHOFRQRFLPLHQWRGHORV
PHFDQLVPRVSDWRJpQLFRVPROHFXODUHV\GHODLQWHUDFFLyQYLUXVKRVSHGDGRUVHGHVDUUROODURQQXHYRVPpWRGRVPROHFXODUHVGHH[TXLVLWD
VHQVLELOLGDG\HVSHFL¿FLGDGTXHKR\UHVXOWDQLPSUHVFLQGLEOHVHQHOdiagnóstico y en el monitoreo de tratamientos antivirales de las infecciones por HIV, virus hepatitis B, virus hepatitis C y FLWRPHJDORYLUXVKXPDQRVHGHVDUUROODURQQXHYRVantivirales y nuevas vacunas
FRQSURFHGLPLHQWRVWRWDOPHQWHLQQRYDGRUHVFRPRODVGHVDUUROODGDVSDUDSUHYHQLUODVGLDUUHDVSRUURWDYLUXV\HOFiQFHUSRUDOJXQRVWLSRV
genómicos de papilomavirus humanos.
(VWRVDYDQFHVDVtFRPRORVUHJLVWUDGRVHQODViUHDVGH,QPXQRORJtD\%LRORJtD0ROHFXODUHQUHODFLyQDOD9LURORJtDQRVFRQGXMHURQ
DHVFULELUHVWDQXHYDHGLFLyQGH9LURORJtD0pGLFDFRQHOREMHWLYRGHRIUHFHULQIRUPDFLyQDFWXDOL]DGDVREUHdiagnóstico, patogenia y prevención de las enfermedades virales.
El GLVHxRGHHVWHWH[WRKDVLGRWRWDOPHQWHUHHVWUXFWXUDGR\VHDxDGLHURQFDStWXORVVREUH,QIHFFLRQHV9LUDOHVSRUVLVWHPDVYLURVLV
emergentes y re-emergentes y SUR¿OD[LV\tratamiento de las infecciones virales.
Deseamos que esta obra permita a cada alumno descubrir un mundo fascinante por el que prohombres de la talla de Louis Pasteur y
muchos sabios de nuestro tiempo dedicaron su vida y nos legaron su entusiasmo.
)LQDOPHQWHTXHUHPRVDJUDGHFHUHOYDOLRVtVLPRDSRUWHGHWRGRVORVFRDXWRUHVTXHFRODERUDURQHQODUHGDFFLyQGHGLIHUHQWHVFDStWXORV
HQWUHJDQGRORPHMRUGHVtPLVPRV'HVHDPRVWDPELpQGDUJUDFLDVDQXHVWURV0DHVWURVSRUSHUPLWLUQRVFRQRFHUVXVLQGHOHEOHVKXHOODVD
ORVDOXPQRVGHJUDGR\SRVJUDGRTXHFRQVXVSUHJXQWDVQRVREOLJDURQDHVWXGLDUHLQYHVWLJDUSDUDDFHUFDUQRVMXQWRVDODYHUGDG\PX\
especialmente, a Ma. Belén Kisielnicki y a Juan Simón Saavedra diseñadores de Corpus EditorialTXLHQHVUHDOL]DURQXQDH[FHOHQWHODERU
PRÓLOGO
En primer lugar deseo agradecer a los autores por haberme brindado el honor y el placer de redactar el prólogo de la cuarta edición
GHHVWHOLEUR/DVROLFLWXGGHHVFULELUORDGHPiVGHVHUXQLQGLFDGRUGHHVWLPDPHOOHYyDUHFRUGDUODVDPDEOHVFRQYHUVDFLRQHVHOLQWHUFDPELRGHLGHDV\ODVLQWHUHVDQWHVGLVFXVLRQHVFLHQWt¿FDVFRQORVSURIHVRUHV*XDGDOXSH&DUEDOODO\-RVp5D~O2XELxDDVtFRPRFRQ
otros investigadores y docentes, lo cual constituyó una de mis grandes satisfacciones en el quehacer de la investigación. En el discurrir
GHODVPLVPDVHQHO'HSDUWDPHQWRGH0LFURELRORJtDGHOD)DFXOWDGGH0HGLFLQDGHOD8QLYHUVLGDGGH%XHQRV$LUHV\GXUDQWHPXFKRV
años, surgieron ideas que luego evolucionaron a proyectos de investigación sobre diversas enfermedades virales de gran importancia
HQODVDOXGS~EOLFDGHOD$UJHQWLQDWDOHVFRPROD¿HEUHKHPRUUiJLFDDUJHQWLQDODVLQIHFFLRQHVUHVSLUDWRULDVDJXGDVODVLQIHFFLRQHVSRU
hantavirus, las hepatitis virales y el HIV/SIDA. Durante décadas, con bastante esfuerzo y dedicación se implementaron diversas líneas
de investigación focalizadas en las enfermedades virales mencionadas, cuyos resultados luego se plasmaron en numerosas publicacioQHVFLHQWt¿FDVHQFRODERUDFLyQ\HQDOJXQDViUHDVORVFRQRFLPLHQWRVREWHQLGRVVHQWDURQODVEDVHVFLHQWt¿FDVSDUDVXXWLOL]DFLyQHQHO
campo de la salud en la Argentina.
(QORVSURIHVRUHV*XDGDOXSH&DUEDOODO\-RVp5D~O2XELxDLGHQWL¿FDURQODQHFHVLGDGGHUHFRSLODU\KDFHUDFFHVLEOHHQXQVROR
OLEUR\FRQXQHQIRTXHLQWHJUDGRHOPDWHULDOFLHQWt¿FRH[LVWHQWHUHODFLRQDGRDWRGDVODVHQIHUPHGDGHVYLUDOHVKXPDQDV(OORVVDEtDQ
TXHQRKD\HVIXHU]RPiVUHQWDEOHTXHODFDOLGDGHQODFDSDFLWDFLyQ\IRUPDFLyQPpGLFD$VtQDFLyODSULPHUDHGLFLyQGHVirología médica cuyos destinatarios preferenciales fueron los estudiantes de ciencias médicas y los profesionales del equipo de salud.
7UDQVFXUULGRVFLQFRDxRVORVDXWRUHVFRQVLGHUDURQLQGLVSHQVDEOHDFWXDOL]DUHVWDREUDHQXQDVHJXQGDHGLFLyQGHELGRDODQXPHURVDLQIRUPDFLyQFLHQWt¿FDTXHVXUJLyHQHOSHUtRGRORTXHWDPELpQORVPRWLYySDUDDPSOLDUVXVWDQFLDOPHQWHVirología médica en una
WHUFHUDHGLFLyQSXEOLFDGDHQ
$xRVPiVWDUGHGHELGRDODDYDODQFKDGHQXHYRVFRQRFLPLHQWRVFLHQWt¿FRV\FUHDWLYRVGHVDUUROORVWHFQROyJLFRVDVtFRPRDODFUHFLHQte emergencia y diseminación de nuevas enfermedades virales humanas, se tornó imprescindible la realización de la cuarta edición de Virología Médica. Ésta surgió como en las ediciones previas, gracias al conocimiento, esfuerzo, compromiso y dedicación de los coautores de
ORVGLVWLQWRVFDStWXORV(QPXFKRVFDStWXORVGHVWDFDGRVYLUyORJRVSURIHVLRQDOHVGHOiUHDGHODPHGLFLQDTXtPLFDELRORJtDRELRTXtPLFD
FRQWULEX\HURQGLUHFWDPHQWHDOSURJUHVRFLHQWt¿FRHQVXiUHDGHWUDEDMRDWUDYpVGHVXVSURSLDVLQYHVWLJDFLRQHV/DPD\RUtDGHORVFDStWXORV
WLHQHXQHQIRTXHLQWHUGLVFLSOLQDULRGHOWHPDGHVGHORVDVSHFWRVEiVLFRVGHODYLURORJtD\GHODWHUDSLDDQWLYLUDOKDVWDODHWLRSDWRJHQLDGHOD
enfermedad, aspectos relevantes de clínica, epidemiología, prevención y fundamentalmente del diagnóstico de laboratorio.
&UHRTXHORVDXWRUHVWXYLHURQXQREMHWLYRDPELFLRVRDOFUHDUHVWDHGLFLyQGHVirología médica y sin duda lo han alcanzado.
&RQVLJXLHURQGHVFULELUGHXQPRGRFODUR\GLGiFWLFRHOFRPSOHMRPXQGRGHODVLQIHFFLRQHVYLUDOHVKXPDQDVH[SUHVDGRHQXQVHQFLOOR
OHQJXDMHFLHQWt¿FRORFXDOUHYHODXQSURIXQGRFRQRFLPLHQWR\FDOLGDGGRFHQWHSDUDWUDVPLWLUOR
+DQVDELGRVHOHFFLRQDU\DJUXSDUORVWHPDVGHPDQHUDOOHYDGHUDVLQH[FHVLYDVLVWHPDWL]DFLyQFRPRVHYLVOXPEUDDOKRMHDUODVSiJLQDVGHOtQGLFH\VHFRUURERUDGXUDQWHHODYDQFHHQODOHFWXUDGHOFRQWHQLGR7RGRHVWRSHUPLWHDJLOL]DUODOHFWXUDXQDPHMRUFRPSUHQVLyQ
GHOWH[WRFRRUGLQDUHOFRQRFLPLHQWR\DSUHFLDUORFRPRFRQMXQWR
(QHVWDHGLFLyQVHLQFRUSRUDQQXHYRVFDStWXORV\VHUHDOL]DXQDLPSRUWDQWHPRGL¿FDFLyQ\DPSOLDFLyQGHRWURVHQUHODFLyQFRQOD
HGLFLyQDQWHULRU6XFRQWHQLGRGHDOUHGHGRUGHSiJLQDVHVWiGLVWULEXLGRGLGiFWLFDPHQWHHQSDUWHV\FDStWXORVTXHDEDUFDQODV
iUHDVPiVUHOHYDQWHVGHODYLURORJtDPpGLFD(OHVSDFLRDVLJQDGRDODVGLYHUVDViUHDVGHOWH[WRHVWiSHUIHFWDPHQWHUHODFLRQDGRDODLPSRUWDQFLDTXHODVPLVPDVWLHQHQHQODVDOXGKXPDQD(QOD3DUWHVHRIUHFHXQDGHVFULSFLyQJHQHUDOGHODUHSOLFDFLyQ\JHQpWLFDYLUDO
patogenia de las infecciones virales, mecanismos de defensa del hospedador, conceptos sobre epidemiología de las infecciones virales
\GLDJQyVWLFRYLUROyJLFRTXHLQFOX\HHODVHJXUDPLHQWR\FRQWUROGHODFDOLGDGGHOPLVPR/D3DUWHGHVFULEHHQIRUPDH[KDXVWLYD
WRGRVORVYLUXVGHLQWHUpVPpGLFR\SDUDFDGDXQRGHHOORVVHHVSHFL¿FDQODVFDUDFWHUtVWLFDVGHOYLUXVVXIRUPDGHWUDVPLVLyQSDWRJHQLD
cuadro clínico, diagnóstico, tratamiento y prevención. Un aspecto valioso e interesante fue la inclusión de la epidemiología de las enIHUPHGDGHVYLUDOHVHQOD$UJHQWLQD(QOD3DUWHVHWUDWDQHVSHFt¿FDPHQWHODVHQIHUPHGDGHVYLUDOHVHPHUJHQWHV\UHHPHUJHQWHViUHD
de gran importancia actual y futura por su impacto en la salud pública. En la Parte 4 se describen las infecciones virales agrupadas por
sistemas, las infecciones de las embarazadas y recién nacidos, las trasmisibles por vía transfusional y las infecciones virales prevalentes
HQSDFLHQWHVLQPXQRVXSULPLGRV(VWDDJUXSDFLyQVLQGXGDEULQGDUiDOOHFWRUXQFRQRFLPLHQWR~WLOSDUDHOGLDJQyVWLFRGLIHUHQFLDOGH
GLFKDVLQIHFFLRQHVYLUDOHV(QOD3DUWHVHGHVFULEHQGLIHUHQWHVWLSRVGHYDFXQDVYLUDOHVHQXVR\ODVSHUVSHFWLYDVSDUDODHODERUDFLyQ
GHIXWXUDVYDFXQDVFRQWHFQRORJtDVLQQRYDGRUDV6HSURIXQGL]DHQHOiUHDGHODVGURJDVDQWLYLUDOHV\ORVPHFDQLVPRVGHUHVLVWHQFLDDODV
mismas, así como las herramientas disponibles para detectar dicha resistencia y optimizar la terapia.
/DV3DUWHV\FRQWLHQHQFDStWXORVTXHHQIRFDQODHSLGHPLRORJtDPROHFXODUGHDOJXQDVLQIHFFLRQHVYLUDOHVHQOD$UJHQWLQD\OD
ELRVHJXULGDGHQODSUiFWLFDELRPpGLFDDVtFRPRHQHOODERUDWRULR(O~OWLPRGHHVWRVFDStWXORVHVWiGHGLFDGRDORVQXHYRVYLUXVUHVSLUDtorios emergentes, tema de gran relevancia actual.
En las últimas décadas se pudo observar la aparición de nuevas epidemias virales sin antecedentes históricos y también un sorprenGHQWHVDOWRDOSDVDGRGHELGRDODUHDSDULFLyQGHYLHMDVHQIHUPHGDGHVHSLGpPLFDV
En los distintos capítulos se describen los notables cambios observados en la historia natural de las enfermedades virales humanas
HQHOPXQGR$WUDYpVGHYDFXQDVH¿FDFHVVHORJUyHUUDGLFDUODYLUXHOD\FRQWURODURWUDVHQIHUPHGDGHVYLUDOHVWDOHVFRPRHOVDUDPSLyQ
la poliomielitis y la rubéola. Surgieron enfermedades virales oportunistas para el ser humano, como consecuencia del incremento de la
inmunosupresión por diversas causas. Emergieron nuevas enfermedades epidémicas ocasionadas por virus desconocidas hasta ese moPHQWRFRPRHOGHODLQPXQRGH¿FLHQFLDKXPDQDORVKDQWDYLUXVRORVDUHQDYLUXVTXHUHFLELHURQHOQRPEUHGHHQIHUPHGDGHVHPHUJHQWHV
)LQDOPHQWHDOJXQDVHQIHUPHGDGHVFRPRHOGHQJXHROD¿HEUHDPDULOODUHFUXGHFLHURQGHVSXpVGHKDEHUGLVPLQXLGRVLJQL¿FDWLYDPHQWH\
fueron llamadas enfermedades re-emergentes.
/DIUHFXHQWHDSDULFLyQ\ODUiSLGDGLVHPLQDFLyQGHDOJXQDVHQIHUPHGDGHVHPHUJHQWHVRUHHPHUJHQWHVVHSXHGHQDWULEXLUHQWUH
otras causas, a actividades humanas tales como la deforestación, la construcción de represas, las dislocaciones en la estructura social, el
LQFUHPHQWRGHORVYLDMHVTXHVHUHDOL]DQFDGDYH]FRQPD\RUUDSLGH]\OOHJDQDXQDPD\RUFDQWLGDGGHGHVWLQRV(OLQWHUFDPELRJOREDO\
creciente de personas, animales y productos de consumo, induce también a la globalización de las enfermedades infecciosas al favoreFHUXQPiVUiSLGR\H¿FLHQWHFRQWDFWRHQWUHHOVHUKXPDQR\ORVDJHQWHVSDWyJHQRVTXHSURGXFHQHQIHUPHGDGHV7DPELpQLQÀXHQFLDGR
SRUODVDFWLYLGDGHVGHOVHUKXPDQRHOFDPELRFOLPiWLFRFRQVXVFRQVHFXHQWHVVHTXtDVGHVKLHORVHLQXQGDFLRQHVHQWUHRWURVIDFWRUHVVH
incluye entre las causas que pueden originar la emergencia de nuevas enfermedades.
Los autores desarrollaron y entrelazaron en varios capítulos el tema de las enfermedades virales emergentes y reemergentes, las
cuales se convirtieron en uno de los mayores desafíos a enfrentar ahora y en el futuro inmediato.
6HGHVWDFDODUHOHYDQFLDGHODLQYHVWLJDFLyQFLHQWt¿FDSDUDHOFRQWUROGHHVWDVQXHYDVLQIHFFLRQHVYLUDOHV\VHHQIDWL]DTXHODUiSLGD
detección de la aparición de las enfermedades emergentes y de sus agentes etiológicos, así como de los aspectos clínicos y epidemiológicos son de vital importancia para el posterior desarrollo de herramientas de diagnóstico, prevención y tratamiento de las mismas. Esto
GHSHQGHUiWDQWRGHODH¿FDFLD\FHOHULGDGGHODVLQYHVWLJDFLRQHVFRPRGHODH¿FDFLD\FHOHULGDGFRQTXHHOVLVWHPDGHVDOXGXWLOLFHORV
resultados obtenidos.
Para resumir, la madre naturaleza, muchas veces ayudada por errores humanos, nos proporciona cíclicamente organismos patógeQRVSHOLJURVRVSHURWDPELpQQRVSURYHHGHFLHQWt¿FRVKDELOLWDGRVSDUDGHVFXEULUORV\FRQWURODUORV
&UHRTXHHOSURSyVLWRGHORVDXWRUHVDOSUR\HFWDU\HVFULELUHVWDHGLFLyQIXHHQWUHOD]DUORVDVSHFWRVEiVLFRV\PpGLFRVGHODYLURORJtD
humana que en primer lugar sea útil para estudiantes de medicina y de las ciencias relacionadas y que sea utilizado como libro de
referencia por graduados de las diferentes profesiones que integran el equipo de salud. Así, los médicos residentes, clínicos, infectólogos, sanitaristas y otras especialidades médicas, profesionales que realizan atención primaria de la salud y aquellos involucrados en el
GLDJQyVWLFRGHODERUDWRULRGHHQIHUPHGDGHVYLUDOHVDVtFRPRLQYHVWLJDGRUHVFLHQWt¿FRVSXHGHQVHUUHFHSWRUHVQDWXUDOHVGHHVWDREUD
7DPELpQSRGUtDVHUXWLOL]DGDFRPRFRPSOHPHQWRFLHQWt¿FRJOREDOSRUHOSHUVRQDOWpFQLFRHQVHFWRUHVHVSHFt¿FRVGHODPSOLRHVSHFWURGH
la virología médica.
(VWDPRVYLYLHQGRXQDPDUDYLOORVDHUDGHGHVDUUROORFLHQWt¿FR\WHFQROyJLFRLQLJXDODGR\GHXQFUHFLPLHQWRH[SRQHQFLDOHQHO
FRQRFLPLHQWREiVLFRGHORVYLUXVTXHFDXVDQHQIHUPHGDGHVKXPDQDV/DELRWHFQRORJtDDWUDYpVGHODELRORJtDPROHFXODUODLQJHQLHUtD
genética, la recombinación del DNA, incrementa día a día su relevancia en los arrolladores avances médicos en general y en virología
médica en especial. A través de la ingeniería genética se obtienen organismos vivos capaces de producir antígenos para la elaboración
de vacunas preventivas de diversas enfermedades virales, antígenos o anticuerpos para las pruebas de diagnóstico, así como agentes
WHUDSpXWLFRV(VGHFLUHOGHVDUUROORELRWHFQROyJLFRVHYHUWLyHQXQDPSOLRHVSHFWURGHLQQRYDFLRQHVSUiFWLFDVSDUDODSUHYHQFLyQHO
diagnóstico y el tratamiento de las enfermedades virales, lo cual ha sido incluido en forma muy representativa en los capítulos de la
SUHVHQWHHGLFLyQ/RVFRDXWRUHVGHORVPLVPRVVXSLHURQWUDGXFLUUHVXPLU\WUDQVPLWLUODLQIRUPDFLyQEDVDGDHQODHYLGHQFLDFLHQWt¿FD
necesaria para la compilación de la presente obra.
/DLQIRUPDFLyQPHWRGROyJLFDHVHQFLDOHQODSUiFWLFDPpGLFDSUHVHQWDGDGHPDQHUDFODUD\FLHQWt¿FDIDFLOLWDUiDOSURIHVLRQDOHO
diagnóstico de las enfermedades virales, especialmente en lo vinculado a las pruebas de laboratorio y a la interpretación clínica de las
mismas. Sabemos que el conocimiento etiológico de la enfermedad es el elemento clave para la consiguiente orientación terapéutica.
/DVWDEODV\¿JXUDVTXHDFRPSDxDQDOWH[WRHQFDVLWRGDVVXVSiJLQDV\TXHHYLGHQWHPHQWHIXHURQREMHWRGHXQDFXLGDGRVDHODERUDFLyQ\VHOHFFLyQIDFLOLWDUiQQRWDEOHPHQWHODFRPSUHQVLyQGHOFRQWHQLGR7RGRVORVFDStWXORVLQFOX\HQXQDVHOHFFLRQDGDELEOLRJUDItDFRQ
DUWtFXORVGHUHIHUHQFLDTXHSHUPLWLUiDOOHFWRUHVWXGLRVRDKRQGDUHQORVWHPDVGHVXLQWHUpV
Los coautores de los capítulos de esta nueva edición, son todos especialistas en el tema, profesores o investigadores que escribieron
HVWDREUDFRQDPSOLWXG\SURIXQGLGDG\GHPDQHUDFRQFLVD\GLGiFWLFDTXHVHFRUUHVSRQGHFRQVXDPSOLRFRQRFLPLHQWR\H[SHULHQFLD
FRWLGLDQDHQHOFDPSRGHODYLURORJtDPpGLFD\DVHDHQHOiPELWRDVLVWHQFLDOGRFHQWHRGHLQYHVWLJDFLyQ
Gracias al esfuerzo concertado y espíritu de cooperación de quienes participaron en esta cuarta edición se logró consolidar esta obra
TXHVHJXUDPHQWHFRQWULEXLUiDODFDSDFLWDFLyQ\IRUPDFLyQGHVXVGHVWLQDWDULRVSUHIHUHQFLDOHVHVWXGLDQWHV\SURIHVLRQDOHVTXHEXVTXHQ
XQDIXHQWHDVHTXLEOHGHLQIRUPDFLyQJHQHUDO\DEDUFDGRUDSHURDODYH]IRFDOL]DGDHQGHWDOOHVQHFHVDULRVSDUDXQDPiVSURIXQGDFRPSUHQVLyQGHDOJXQRVWHPDVHQHOGLYHUVR\FRPSOHMRPXQGRGHODVHQIHUPHGDGHVYLUDOHVKXPDQDV
/DVGLVWLQWDVHGLFLRQHVGHHVWHOLEURGHWH[WRWXYLHURQODYLUWXGGHFDSWDUDWUDYpVGHVXVDXWRUHVHOFRQRFLPLHQWRGHOWHPDHQXQSHUtRGRGHWHUPLQDGR(QXQiUHDFDPELDQWH\GHUiSLGDHYROXFLyQFRPRODYLURORJtDPpGLFDTXLHURDGYHUWLUSDUDSUHSDUDUDORVFRDXWRUHV
GHORVGLYHUVRVFDStWXORVTXHQRHVGLItFLOSUHGHFLUTXHVHYHUiQREOLJDGRVDDFWXDOL]DUHVWDREUDFRQQXHYDVHGLFLRQHVDLQWHUYDORVFDGD
YH]PiVFRUWRVHVFDVLGHFLUTXHVLQGHVFDQVRWHQGUtDQTXHLUGLVSRQLHQGRSHUPDQHQWHPHQWHSDUDODSUy[LPDHGLFLyQORVQXPHURVRV
FDPELRVFLHQWt¿FRV\WHFQROyJLFRVTXHVHSURGXFLUiQHQHOWHPD
A pesar de la persistencia por siglos de algunas virosis humanas y de la aparición de graves epidemias de enfermedades virales
HPHUJHQWHV\UHHPHUJHQWHVVHHVWiQHQFRQWUDQGRGLYHUVRVFDPLQRVKDFLDUHVSXHVWDVDGHFXDGDVSDUDHOFRQWUROWDQWRGHODVYLHMDVFRPR
GHODVQXHYDVHQIHUPHGDGHVYLUDOHVKXPDQDV(VWR\FRQYHQFLGDTXHHVWHOLEURHVXQODGULOORPiVTXHD\XGDDFRQVWUXLUHOFDPLQRKDFLD
esa respuesta.
Vaya al equipo de coautores de los capítulos de esta obra, coordinados por los profesores Guadalupe Carballal y José Raúl Oubiña,
mi profundo aprecio, admiración y respeto.
Prof. Dra. Mercedes Weissenbacher
Académica Titular, Academia Nacional de Medicina. Buenos Aires
PARTE 1
Iniciación a la Virología Médica:
Aspectos Generales
1
Introducción al estudio de la Virología humana
Guadalupe Carballal
1. EL
VIROLOGÍA
efectivas constituye uno de los mayores logros de la ciencia moGHUQD(QVHORJUyHUUDGLFDUODYLUXHODGHOSODQHWD7LHUUD
/DVHQIHUPHGDGHVYLUDOHVVRQXQDGHODVFDXVDVPiVIUHFXHQWHVGH JUDFLDVDORVHVIXHU]RVGHFRRSHUDFLyQPXQGLDODODLQH[LVWHQFLD
morbilidad en humanos. Los virus pueden afectar a todos los seres GHUHVHUYRULRVDQLPDOHV\DODUPDPiVYDOLRVDGHVDUUROODGDOD
vivos incluyendo animales, vegetales, hongos y bacterias. La Viro- vacunación anti-variólica. Asimismo, el control de la poliomieORJtDHVXQDFLHQFLDPiVMRYHQTXHOD%DFWHULRORJtDGHELGRDTXHORV litis fue logrado mediante la vacunación y la cloración del agua,
virus, a diferencia de las bacterias, poseen un pequeño tamaño que no aunque no pudo ser aún erradicada en algunos países en vías de
SHUPLWHREVHUYDUORVFRQHOPLFURVFRSLRySWLFR\DGHPiVQRSXHGHQ desarrollo.
VHUFXOWLYDGRVHQPHGLRVLQHUWHVFDUHQWHVGHFpOXODVYLYDV PHGLRV $SHVDUGHORVH[WUDRUGLQDULRVDYDQFHVHQHOFRQRFLPLHQWRGHPXFKDVHQIHUPHGDGHVYLUDOHVH[LVWHQRWUDVTXHD~QFRQWLQ~DQGHVD¿DQGR
D[pQLFRV FRPRORVTXHVHHPSOHDQSDUDFXOWLYDUDODVEDFWHULDV
El uso del microscopio electrónico para observar ultraestruc- ORVHVIXHU]RVGHORVFLHQWt¿FRVFRPRSRUHMHPSORODVpandemias de
turas cuyos tamaños oscilan en el orden de los nanómetros y el HIV, de hepatitis B y hepatitis C, y los brotes epidémicos de virosis
desarrollo de los cultivos celulares fueron dos hitos que ocurrieron emergentes o re-emergentes como los causados por los virus del denJXH:HVW1LOHLQÀXHQ]D\KDQWDYLUXVHQWUHPXFKDVRWUDV
recién a mediados del siglo XX.
En conclusión, la amenaza que representan los virus, ya sean
QXHYRV HPHUJHQWHV UHHPHUJHQWHVRSURGXFWRVGHOELRWHUURULVPR
1.1 IMPACTO DE LAS ENFERMEDADES VIRALES
continúa aún vigente en la actualidad.
EN LA HISTORIA HUMANA
DESARROLLO DE LA
COMO CIENCIA
El impacto de las enfermedades virales en la historia humana es 1.2 BREVE HISTORIA DE LA VIROLOGÍA
HQRUPH$XQTXHQRH[LVWHQUHJLVWURVGHODVepidemias producidas
por virus en las épocas antigua y medieval, muchas de estas enfer- (QHOKRODQGpV$YDQ/HXHZHQKRHNLQYHQWyHOPLFURVFRSLR
medades eran conocidas por las civilizaciones greco-latinas. Evi- óptico y así, por primera vez, pudieron observarse bacterias, protodencias arqueológicas en momias del Antiguo Egipto y en antiguos zoarios y algas. Pero fue recién a mediados del siglo XIX que la Bacgrabados muestran lesiones características de viruela y poliomieli- teriología emergió como una nueva disciplina. Las investigaciones de
tis. La rabia, la LQÀXHQ]D\ODpoliomielitis también fueron conoci- Louis Pasteur y Robert Koch demostraron que la vida no se origina
das por las antiguas civilizaciones, si bien el concepto de enferme- HVSRQWiQHDPHQWH teoría de la generación espontánea VLQRTXHVH
GDGLQIHFFLRVDQRH[LVWtD\HVWDVHQIHUPHGDGHVVHDWULEXtDQDHIHFWRV desarrolla a partir de gérmenes'XUDQWHVXVHVWXGLRVVREUHiQWUD[HQ
GHORVSODQHWDVRELHQDOHQRMRGHORVGLRVHVDQWHODVFRQGXFWDV el ganado, R. Koch fue el primero en demostrar que la enfermedad
humanas. Las epidemias de viruela durante la Edad Media en Eu- infecciosa resultaba de la infección con microorganismos, los que
URSDSUHVHQWDURQDOWDPRUWDOLGDG\SURGXMHURQFDPELRVHFRQyPLFRV SRGtDQVHUFXOWLYDGRVHQPHGLRVDUWL¿FLDOHV\OXHJRVHULQRFXODGRV
políticos y religiosos. La conquista de América por colonizadores en nuevos hospedadores en los que reproducían la enfermedad. Esta
HXURSHRVLQWURGXMRQXPHURVDVHQIHUPHGDGHVLQIHFFLRVDVHQWUHHOODV WHRUtDHVWiH[SXHVWDHQORVPostulados de Koch y constituye el fundaalgunas de origen viral como el sarampión, que diezmaron a los mento de la asignación etiológica de las enfermedades infecciosas.
nativos carentes de inmunidad frente a ese virus.
7DPELpQHQHOVLJOR;,;XQGLVFtSXORGH/3DVWHXU&KDUOHV
En el siglo XX ocurrieron tres pandemias por diferentes subti- &KDPEHUODLQGHVDUUROOyXQ¿OWURGHSRUFHODQDTXHSHUPLWtDUHWHQHU
SRVGHYLUXVLQÀXHQ]D$/DSULPHUD\PDVLPSRUWDQWHVHUHJLVWUy ODVEDFWHULDVSHURQRDRWURVDJHQWHVPiVSHTXHxRVTXHSRGtDQ
HQ\IXHSURGXFLGDSRUXQDFHSDGHOVXEWLSR+1(VWDHQ- DWUDYHVDUHVRV¿OWURV'HDOOtXQDGHODVSULPLWLYDVGHQRPLQDFLRQHV
fermedad, denominada gripe española, se diseminó a todo el planeta de los virus, llamados YLUXV¿OWUDEOHV
\SURGXMRDSUR[LPDGDPHQWHPLOORQHVGHPXHUWHV
(QXQPLFURELyORJRKRODQGpV0:%HLMHULQFNSUHVHQWy
$¿QHVGHOVLJOR;;ORVVLVWHPDVGHvigilancia epidemiológica a la Academia de Ciencias de Amsterdam sus investigaciones sobre
DOHUWDURQVREUHODDPHQD]DGHXQDQXHYDSDQGHPLDGHLQÀXHQ]D el agente del mosaico del tabacoHQIHUPHGDGTXHDIHFWDODVKRMDV
SUREDEOHPHQWHGHRULJHQDYLDULR subtipo +1 SURYHQLHQWHGH GHSODQWDVGHWDEDFR%HLMHULQFNGHVFULELyDODJHQWHFDXVDOFRPR
Asia. Contrariamente a esa hipótesis, la primer pandemia del siglo un FRQWDJLXPYLYXPÀXLGXP en contraposición a la teoría en boga
;;,FRPHQ]yHQDEULOGH\IXHFDXVDGDSRUODHPHUJHQFLDGH en la época que postulaba la naturaleza corpuscular como causa
XQDQXHYDFHSDGHLQÀXHQ]D$+1RULJLQDGDHQ$PpULFD\TXH de las enfermedades infecciosas. El fundamento de su fascinante
fue inicialmente mal denominada gripe porcina. El estudio genó- GHVFXEULPLHQWRIXHTXHHVHQXHYRDJHQWH XQYLUXV SRGUtDDWUDYHVDU
mico de este nuevo virus demostró que es un triple recombinante ORV¿OWURVGHSRUFHODQDGHVDUUROODGRVSRU&KDPEHUODLQ\TXHHVH
y que contiene dos genes de LQÀXHQ]DRULJHQSRUFLQRXQJHQGH FRQWDJLXPQYLYXPÀXLGXP era capaz de provocar enfermedad al ser
RULJHQDYLDULR\XQJHQGHLQÀXHQ]DKXPDQD(VWHYLUXVVHGLVHPL- inoculado en plantas de tabaco previamente sanas.
QyUiSLGDPHQWHDWRGRHOSODQHWD\OD2UJDQL]DFLyQ0XQGLDOGHOD %HLMHULQFNWDPELpQSRVWXOyTXHHOYLUXVVHFRQYHUWtDHQpar6DOXG 206 GHFODUyHOPi[LPRQLYHOGHDOHUWDGHSDQGHPLD )DVH te del metabolismo celular, que interaccionaba con éste y que
HOGHMXOLRGH/DSDQGHPLDSURGXMRXQDOWRimpacto a H[LVWtDXQDforma submicroscópica de vida que no podía ser obnivel mundial ya que se registraron en ese año millones de casos servada al microscopio óptico. Así, la palabra virus adquirió un
GHLQIHFFLyQUHVSLUDWRULDSRUHOQXHYRYLUXVGHORVFXDOHV QXHYRVLJQL¿FDGRTXHORGLIHUHQFLDEDGHORVPLFURELRVREVHUYDfueron fatales.
bles microscópicamente. Éste era un concepto totalmente nuevo
La disminución de la morbi-mortalidad de algunas enfer- en contraposición a las ideas en vigencia que postulaban que
medades virales mediante el desarrollo y aplicación de vacunas "todos los virus eran microbios".
36
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
3RUHOORODLGHQWL¿FDFLyQGHOYLUXVGHOPRVDLFRGHOWDEDFRVHUHFRnoce como la fundación de la Virología como una disciplina diferente
de la Bacteriología. Sin embargo, como estas nuevas ideas se contraponían con las teorías vigentes en esa época, transcurrieron muchos años
para que la Virología se estableciera como una ciencia separada.
El virus del mosaico del tabaco fue también el primer virus
que pudo ser observado al microscopio electrónico por W. Stanley
en EE. UU., hallazgo por el que le otorgaron el premio Nobel en
4XtPLFDHQ6WDQOH\SRVWXODEDTXHHVHDJHQWHHUDXQDSURWHtQD
autocatalítica y, aunque posteriormente se descubrió que este virus
no era un enzima, su hallazgo y la posterior caracterización del
YLUXVFRPRXQFRPSOHMRGHSURWHtQDV\iFLGRVQXFOHLFRVSRULQYHVtigadores ingleses constituyeron un hito fundamental en la comSUHQVLyQGHORVYLUXVFRPRYHUGDGHUDVHQWLGDGHV¿VLFRTXtPLFDV\
ulteriormente, como entidades genéticas.
El desarrollo de la PLFURVFRSLDHOHFWUyQLFDTXHFRPHQ]yHQ
contribuyó a eliminar el misterio de estos nuevos agentes que habían
HVWDGRRFXOWRVPiVDOOiGHODVIURQWHUDVGHOPLFURVFRSLRySWLFR
Debido a su pequeño tamaño y a su parasitismo intracelular
REOLJDGRTXHLPSLGHVXPXOWLSOLFDFLyQHQPHGLRVD[pQLFRV FDUHQWHVGHFpOXODVYLYDV ORVYLUXVSXGLHURQVHUHVWXGLDGRVUHFLpQ
en el siglo XX, cuando se desarrollaron los cultivos celulares y el
microscopio electrónico. El desarrollo de células vivas en cultivo
IXHSRVLEOHDSDUWLUGHODGpFDGDGHFXDQGRVHFRPHQ]DURQD
emplear los antibióticos, lo que permitió mantener a las células en
cultivo libres de contaminación bacteriana. Así comenzó la edad
PRGHUQDGHOD9LURORJtDFXDQGRHQ6HOOHU\(QGHUVORJUDURQ
por primera vez la replicación de un virus en cultivo.
/DKLVWRULDGHOD9LURORJtDLOXVWUDXQDYH]PiVFyPRORVFRQceptos en ciencia se desarrollan por ensayo y error. Los hallazgos
LQLFLDOHVHQ9LURORJtDMXQWRFRQHOPRGHORGHODGREOHKpOLFHGHO
iFLGRGHVR[LUULERQXFOHLFR '1$ SURSXHVWDSRU:DWVRQ\&ULFNHQ
VHQWDURQODVEDVHVIXQGDFLRQDOHVGHOD%LRORJtDPROHFXODU
'XUDQWHORVVLJORV;;\;;,VHGHVDUUROODURQH[TXLVLWDVWpFQLFDV
PROHFXODUHVSDUDLGHQWL¿FDUFORQDU\H[SUHVDUVHFXHQFLDVQXFOHRWtGLFDVORTXHSHUPLWLyH[WUDRUGLQDULRVDYDQFHVHQHOFRQRFLPLHQWRGHOD
SDWRJHQLDHQHOGHVDUUROORGHQXHYRV\H¿FDFHVPpWRGRVGLDJQyVWLFRV
SDUDODVHQIHUPHGDGHVYLUDOHV\D~QPiVKL]RSRVLEOHLGHQWL¿FDUPHdiante métodos moleculares a virus que no replican adecuadamente
en cultivos celulares, como el virus hepatitis C.
Micrón (μm)
10-6 metros
Milimicrón (mμ) o nanómetro (nm)
10-9 metros
Angstrom (Å)
10-10 metros
Límite de resolución de:
Microscopio óptico
250 nm
0LFURVFRSLRGHÀXRUHVFHQFLD
125 nm
Microscopio electrónico
0,5 a 0,05 nm
7DPDxRSURPHGLRGHORVYLUXV
20 a 300 nm
Tamaño promedio de las bacterias
0,7 a 10 μm
Linfocito
10 μm
Tabla 1.1. Unidades de medida y límites de resolución de los
microscopios utilizados en Microbiología.
/RVYLUXVPiVSHTXHxRVSRUHMHPSORORVGHODIDPLOLDPicornaviridae, que incluye el virus de la poliomielitis, miden alrededor de
QP\ORVPiVJUDQGHVFRPRORVGHODIDPLOLDPoxviridae, donde
VHHQFXHQWUDHOYLUXVGHODYLUXHODPLGHQQP )LJXUD 2.2 ESTRUCTURA, FUNCIONES Y PROPIEDADES
Los virus poseen habitualmente un solo WLSRGHiFLGRQXFOHLFR\D
VHD'1$R51$/RViFLGRVQXFOHLFRVFRQVWLWX\HQel nucleoide
y, asociado a proteínas se designa como core viral. En el core se
HQFXHQWUDWRGDODLQIRUPDFLyQJHQpWLFDVLHQGRORViFLGRVQXFOHLFRV
los responsables de la infectividad. El coreHVWiSURWHJLGRSRUXQD
cubierta proteica denominada cápside. En el virus hepatitis B el
core\ODFiSVLGHFRQVWLWX\HQODPLVPDHVWUXFWXUD
$GHPiVDOJXQDVIDPLOLDVGHYLUXVSRVHHQRWUDHVWUXFWXUDGH
composición lipoproteica, llamada envoltura )LJXUD /RVYLUXV
que presentan envoltura se denominan envueltos, en contraposición
a los que carecen de envoltura que se denominan desnudos.
La partícula viral completa con su capacidad infectante intacta
se denomina virión.
La cápsideHVWiIRUPDGDSRUVXEXQLGDGHVSURWHLFDVGHQRPLQDdas capsómeros o unidades morfológicas que se encuentran en la
VXSHU¿FLHGHODSDUWtFXODHQORVYLUXVGHVQXGRV/RVFDSVyPHURV
2. ¿QUÉ SON LOS VIRUS?
SXHGHQVHUGHIRUPDHVIHURLGDOKXHFD DGHQRYLUXV RHQIRUPDGH
Etimológicamente, virusVLJQL¿FDYHQHQRHQODWtQ3RGUtDPRVGH- SULVPDFRQXQD]RQDKXHFDFHQWUDO KHUSHVYLUXV )LJXUD Son funciones/propiedades de las proteínas de la cápside:
¿QLUDXQYLUXVFRPRXQSURJUDPDRXQFRPSOHMRLQIRUPDFLRQDO
D 3URWHFFLyQGHOiFLGRQXFOHLFRGHOPHGLRH[WHUQRGHODGHVHFDmacromolecular. Las características de los virus son:
ción y de las enzimas tisulares.
D SHTXHxRWDPDxRDQDQyPHWURV QP E 3UHVHQWDUHVWUXFWXUDVTXHSHUPLWHQODXQLyQGHOYLUXVDORVUHE VHUSDUiVLWRVJHQpWLFRVLQWUDFHOXODUHVREOLJDGRV
ceptores de membrana de la célula hospedadora.
F SRVHHU FDVLVLHPSUH XQVRORWLSRGHiFLGRQXFOHLFRHQODSDUtícula viral completa o virión, una estructura elemental y un F $FWXDUFRPRDQWtJHQRVTXHHVWLPXODUiQODUHVSXHVWDLQPXQHGHO
hospedador.
PHFDQLVPRFRPSOHMRGHUHSOLFDFLyQ
/RVYLUXVFDUHFHQGHORVVLVWHPDVHQ]LPiWLFRVSURGXFWRUHVGH G 5HSULPLUODH[SUHVLyQGHJHQHVYLUDOHVWHPSUDQRV
HQHUJtDQHFHVDULRVSDUDODVtQWHVLVGHiFLGRVQXFOHLFRV\GHSURWHtQDV H 3URYHHULQWHUDFFLRQHVHVSDFLDOHVFRQODVSROLPHUDVDVYLUDOHVHQ
ciertos casos.
indispensables para el crecimiento y multiplicación como los que
poseen las células procarióticas o eucarióticas. Por esta razón, deben
La envoltura es lipoproteica, de composición similar a la de la
necesariamente utilizar los sistemas de las células que parasitan y por
membrana de la célula infectada, ya que los virus la adquieren de
HOORVHGH¿QHQFRPRparásitos genéticos intracelulares obligados.
ésta. La presencia o no de envoltura determina la resistencia de los
YLUXVDOPHGLRH[WHUQR\HVWRHVGHIXQGDPHQWDOLPSRUWDQFLDHQOD
2.1 TAMAÑO
forma de transmisión de las enfermedades virales.
La mayoría de los virus poseen un tamaño muy inferior al de /DPD\RUtDGHORVYLUXVGHVQXGRVVRQUHVLVWHQWHVDOPHGLRH[las bacterias. El tamaño comparativo de algunas familias virales WHUQRDODGHVHFDFLyQ\DVROYHQWHVGHOtSLGRV pWHUFORURIRUPR
HQ UHODFLyQ D OD EDFWHULD HVWD¿ORFRFR VH PXHVWUD HQ OD )LJXUD VDOHVELOLDUHVGHWHUJHQWHVHWF 3RUHMHPSORORVSROLRYLUXV\HO
/DVEDFWHULDVVHPLGHQHQPLFURQHV PP ±PHWURV virus KHSDWLWLV$VHWUDVPLWHQH¿FLHQWHPHQWHSRUYtDIHFDORUDO\D
Para los virus se utiliza una medida inferior al micrón, llamada que conservan su infectividad en el agua y pueden resistir el pH
QDQyPHWUR QP RPLOLPLFUyQ PP TXHHTXLYDOHDO –9 metros. iFLGRGHOHVWyPDJR\ODDFFLyQGHODVVDOHVELOLDUHV )LJXUD (QOD7DEODVHPXHVWUDQODVXQLGDGHVGHPHGLGD\OtPLWHVGH 3RUHOFRQWUDULRORVYLUXVFRQHQYROWXUDVRQPX\OiELOHVDODGHresolución de los diferentes microscopios empleados en Micro- VHFDFLyQ\DORVVROYHQWHVGHOtSLGRVSRUHOORSDUDVXWUDQVPLVLyQVH
requiere un contacto directo de persona a persona o a través de fomites
biología.
Capítulo 1 / Introducción al estudio de la Virología humana
37
l
l
Poxvirus (viruela)
Polioma
50 nm
Clamidia
Adenovirus
80 nm
Glóbulo rojo = 7Mm 7.000 nm
l
l
Orthomyxovirus (Influenza)
100 nm
Figura 1.1. Tamaño comparativo de los virus con otros agentes infecciosos.
Cápside
Capsómeros
Espículas
Cápside
Nucleoide
Nucleoide
Envoltura
Fibra
Virión envuelto
Virión desnudo
Figura 1.2. Anatomía de un virión.
HOHPHQWRVLQHUWHVFRQWDPLQDGRV /DSUHVHQFLDGHHQYROWXUDGHWHUPLQD
la sensibilidad a los solventes de lípidos, lo que constituye uno de los
FULWHULRVGHODFODVL¿FDFLyQGHORVYLUXV
Las funciones/propiedades de la envoltura son similares a las
tres inicialmente mencionadas para la cápside. En la envoltura
VHHQFXHQWUDQODVHVWUXFWXUDVTXHSHUPLWLUiQODXQLyQDUHFHSWRUHV
de la célula hospedadora. Se trata de glicoproteínas ancladas en la
PHPEUDQDDPRGRGHHVStFXODVSRUHMHPSORODVKHPDJOXWLQLQDVGH
los virus LQÀXHQ]DRODJOLFRSURWHtQDJSGHOYLUXVHIV. Estas
JOLFRSURWHtQDVVRQSRWHQWHVDQWtJHQRVTXHHVWLPXODUiQODUHVSXHVWD
inmune del hospedador.
2.3 DIFERENCIAS CON EUBACTERIAS, CLAMIDIAS, MICOPLASMAS
(TABLA 1.3)
Y RICKETTSIAS
Los virus se diferencian de otros patógenos en su organización, comSRVLFLyQTXtPLFD\PHFDQLVPRVGHUHSOLFDFLyQ 7DEOD /RVYLUXV
poseen un solo WLSRGHiFLGRQXFOHLFR\DVHD'1$R51$FRQODV
DFWXDOHVH[FHSFLRQHVFRQRFLGDVGHGRVYLUXVHOcitomegalovirus humano y el virus herpes humano WLSR$PERVSHUWHQHFHQDODfamilia
Herpesviridae con genoma a DNA pero con transcriptos RNA en el
virión.
/RVYLUXVQRFUHFHQQLVHPXOWLSOLFDQSRU¿VLyQELQDULD\VX
UHSOLFDFLyQVLHPSUHSURGXFHPiVGHXQDFRSLD6HUHSOLFDQSRUVtQtesis y ensamble de los componentes recientemente formados en
HOLQWHULRUGHODFpOXODKRVSHGDGRUD3RUHVWDUD]yQVRQSDUiVLWRV
genéticos intracelulares obligados y no pueden replicar en medios
D[pQLFRVFRPRORKDFHQODVEDFWHULDV
/DUHSOLFDFLyQYLUDOVHGHWDOODHQHOFDStWXOR%UHYHPHQWHOD
XQLyQGHOYLUXVDODFpOXODTXHLQIHFWDUiQHVHOSDVRLQLFLDO\VHSURGXFHSRULQWHUDFFLyQGHODVHVWUXFWXUDVSUHVHQWHVHQODVXSHU¿FLHGHO
virión con receptores de la membrana de la célula hospedadora. Al
ingresar, el virus toma el comando de la célula y controla los mecanismos energéticos celulares para su replicación y la síntesis de sus
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
38
ESTRUCTURA
NUCLEOCÁPSIDE
1XFOHRLGH
FUNCIÓN / PROPIEDAD
DNA o RNA
Cápside
Proteínas
ENVOLTURA*
Lípidos y proteínas
- información genética
- infectividad
SURWHFFLyQGHOQXFOHRLGH
XQLyQDUHFHSWRUHVFHOXODUHV
- expresión de determinantes antigénicos
- represión de genes tempranos
- interacción espacial con ciertas polimerasas
SURWHFFLyQGHOQXFOHRLGH
XQLyQDUHFHSWRUHVFHOXODUHV
- expresión de determinantes antigénicos en glicoproteínas
Tabla 1.2. Estructura del virión. 6yORDOJXQRVYLUXV
ĺ
Viriones
Eliminación
al exterior
ĺ
Ciclo natural de los virus
5HSOLFDFLyQHQODVFpOXODVGHOKRVSHGDGRU
Ļ
'LVHPLQDFLyQLQWUDKRVSHGDGRUDRWURVWHMLGRV
Resultado
,QIHFFLyQVXEFOtQLFDRHQIHUPHGDG
5HFXSHUDFLyQ
0XHUWH
Figura 1.3. Diseminación de los virus.
propias proteínas. Este proceso puede o no destruir la célula medianWHGLIHUHQWHVPHFDQLVPRVTXHVHDQDOL]DUiQHQRWURVFDStWXORV/RV
YLULRQHVQHRIRUPDGRVVDOGUiQGHODFpOXODKRVSHGDGRUDHLQLFLDUiQ
QXHYRVFLFORVGHLQIHFFLyQHQQXHYDVFpOXODV )LJXUD 2.4 COMPOSICIÓN QUÍMICA DE LOS VIRUS
2.4.1 Ácidos nucleicos
/DLQIRUPDFLyQKHUHGLWDULDGHXQYLUXVHVWiFRGL¿FDGDHQODVHFXHQFLDGHQXFOHyWLGRVGHVX51$R'1$/RVYLUXVVHFODVL¿FDQHQ
dos grandes grupos de acuerdo al WLSRGHVXiFLGRQXFOHLFR6LpVWH
es DNA se denominan desoxirribovirus y, si es RNA, ribovirus.
Los ribovirus constituyen junto con los viroides, los únicos
organismos hasta ahora conocidos en la naturaleza donde el
RNA es el portador de toda la información genética.
/RViFLGRVQXFOHLFRVSXHGHQVHUPRQRFDWHQDULRVHVGHFLUSUHVHQWDUXQDVRODFDGHQDGHQXFOHyWLGRVRELFDWHQDULRV GREOHFDGHQD (QORVULERYLUXVHO51$HVKDELWXDOPHQWHPRQRFDWHQDULR WRJDYLUXVPL[RYLUXVSLFRUQDYLUXV VLHQGRODH[FHSFLyQORVUHRYLUXV
que poseen RNA bicatenario.
(OiFLGRQXFOHLFRGHWRGRVORVYLUXVD'1$HVELFDWHQDULR adenoYLUXVSR[YLUXV\KHUSHVYLUXV FRQODVH[FHSFLRQHVGHORVSDUYRYLUXV
y circovirus que poseen DNA monocatenario.
/RVSHVRVPROHFXODUHVGHOiFLGRQXFOHLFR\SRUHQGHVXORQJLWXGGHSHQGHQGHODFRPSOHMLGDGGHOYLUXV\SXHGHQYDULDUGHVGH
DPLOORQHVGHGDOWRQV/RViFLGRVQXFOHLFRVSXHGHQVHU
moléculas continuas lineales o circulares, o bien segmentados. Un
JHQRPDVHJPHQWDGRH[KLEHPD\RUHVSRVLELOLGDGHVGHreasociación
cuando dos virus infectan una misma célula. Ello tiene importancia
SURWDJyQLFDSRUHMHPSORHQODHPHUJHQFLDGHQXHYDVFHSDVGHLQÀXHQ]DRHQODSURGXFFLyQGHQXHYDVvacunas para rotavirus.
Las moléculas circulares pueden a su vez ser planas o hiperenrolladas.
&RPRVHYHUiHQHO&DStWXORXQSDVRHVHQFLDOGHODUHSOLFDFLyQYLUDOFRQVLVWHHQODSURGXFFLyQGH51$PHQVDMHUR 51$P /RVYLUXVVHFODVL¿FDQHQYLUXVGHSRODULGDGSRVLWLYDRQHJDWLYD
VHJ~QWHQJDQRQRSRODULGDGGHPHQVDMHUR$OJXQRVULERYLUXVPRQRFDWHQDULRVSUHVHQWDQ51$GHFDGHQDSRVLWLYD SRODULGDGGHPHQ-
VDMHUR RWURVSRVHHQFDGHQDQHJDWLYD SRODULGDGGHDQWLPHQVDMHUR 7DPELpQH[LVWHQYLUXVD51$FRQSRODULGDGPL[WDRDPELVHQWLGR
también denominada ambisense DUHQDYLUXV /RVretrovirus poseen
dos cadenas cuasi idénticas, lo que se denomina dímero.
/RVGHVR[LUULERYLUXVPRQRFDWHQDULRVWLHQHQFDGHQDSRVLWLYDy
QHJDWLYDORVELFDWHQDULRVSRVHHQXQDFDGHQDSRVLWLYD\RWUDQHJDWLva. La cantidad de información genética contenida en el genoma
YDUtDGHDFXHUGRDVXWDPDxR/DVFpOXODVKXPDQDVSRVHHQPiVGH
JHQHVODEDFWHULDEscherichia coliSRVHHJHQHVORVYLUXVPiVSHTXHxRVSXHGHQWHQHUGHDJHQHV\ORVPD\RUHVYDULRV
FHQWHQDUHV$PD\RUWDPDxRGHOJHQRPDPD\RUVHUiODLQIRUPDFLyQ
SDUDJHQHUDUJUDQGLYHUVLGDGGHSURWHtQDVHVSHFt¿FDV(QJHQHUDO
ORVYLUXVD51$WLHQHQJHQRPDVGHPHQRUWDPDxR\FRGL¿FDQPHnos proteínas que los virus a DNA. Los genomas se miden por el
Q~PHURGHEDVHV QXFOHyWLGRV 6HH[SUHVDQHQNLOREDVHV NE 3DUD
los genomas de cadena simple se emplean kb, mientras que para los
GHGREOHFDGHQDVHXWLOL]DQSDUHVGHNLOREDVHV NES 3RUHMHPSORHO
genoma de cadena simple del virus VDUDPSLyQHVGHEDVHV
NE \HOJHQRPDGHFDGHQDGREOHGHORVDGHQRYLUXVHVGH
SDUHVGHEDVHV NES Las composición de bases es variable. La proporción de guanina-citosina varía de acuerdo a la familia viral. En los virus de
PD\RUWDPDxR KHUSHV HVWDSURSRUFLyQGL¿HUHHQPD\RUJUDGRFRQ
respecto al de la célula hospedadora que en aquellos virus de menor
WDPDxRHQORVTXHHVPiVSDUHFLGDDO'1$FHOXODU
Los ácidos nucleicos constituyen la base de la infectividad
del virus(VWDVPROpFXODVVRQHQJHQHUDOIUiJLOHV\SLHUGHQVX
DFWLYLGDGUiSLGDPHQWHVLQRHVWiQSURWHJLGDVSRUODFiSVLGH\R
la envoltura. Sin embargo, los poliovirus poseen un RNA con
SRODULGDGGHPHQVDMHURHVGHFLUHO51$SXURVHSDUDGRGHODV
FXELHUWDVGHOYLULyQHLQWURGXFLGRDUWL¿FLDOPHQWHHQcultivos celulares, es capaz de infectar y dar lugar a la formación de nuevos
viriones. Esto se denomina ácido nucleico infeccioso. Utilizando
secuencias previamente publicadas, ya se ha logrado la síntesis
química in vitroGHO51$ LQIHFFLRVR GHOSROLRYLUXV\SRUHQGH
de dicho agente.
3RUHOFRQWUDULRHQODPD\RUtDGHORVYLUXVHOiFLGRQXFOHLFR
puro separado del virión no es capaz de dar origen a progenie ya
39
Capítulo 1 / Introducción al estudio de la Virología humana
Característica
Virus
Rickettsias
Clamidias
Micoplasmas
Eubacterias
Tamaño
20-250 nm
1 μm
300 nm
250 nm
0,7 a 10 μm
ÈFLGRQXFOHLFR
DNA o RNA
ambos
ambos
ambos
ambos
Fisión binaria
no
+
+
+
+
Enzimas del metabolimo energético
no
+
no
+
+
Ribosomas
no*
+
+
+
+
Replicación en medios axénicos
no
no
no
+
+
Tabla 1.3. Diferencias entre virus, eubacterias, micoplasmas, clamidias y rickettsias. / /RVDUHQDYLUXVFRQVWLWX\HQXQDH[FHSFLyQ\DTXH
SRVHHQULERVRPDVGHRULJHQFHOXODUFX\DIXQFLyQHQHOYLULyQHVSUHVFLQGLEOHSDUDODLQIHFWLYLGDGYLUDO
que les resulta imprescindible la actividad de las polimerasas que
HVWiQSUHVHQWHVHQHOYLULyQVLQODVFXDOHVODUHSOLFDFLyQQRSXHGH
LQLFLDUVH véase el Capítulo 2.4.2 Proteínas
/DVSURWHtQDVFRQVWLWX\HQODPD\RUSDUWHGHOYLULyQ D 6HJ~QHOWDPDxR\FRPSOHMLGDGGHOYLULyQpVWHSXHGHFRQWHQHUGHVGH
DSROLSpSWLGRVHVWUXFWXUDOHVGLIHUHQWHVLas proteínas del virión
SXHGHQFODVL¿FDUVHHQHVWUXFWXUDOHVRQRHVWUXFWXUDOHV.
Proteínas estructurales
6HGH¿QHFRPRproteína estructuralDTXHOODTXHHVWiSUHVHQWH
en el virión en proporción importante y mantiene la estructura
del mismo. Pueden ser GHVXSHU¿FLH o internas. Las proteínas de
VXSHU¿FLHFRQVWLWX\HQORVFDSVyPHURV\ODVSUR\HFFLRQHVGHOD
HQYROWXUDGHQRPLQDGDVSHSOyPHURV GHOJULHJRpeplos W~QLFD
meros SDUWH (QORVYLUXVFRQVLPHWUtDLFRVDpGULFDORVFDSVyPHURVHVWiQIRUPDGRVSRUSROLSpSWLGRV DPROpFXODV GHOD
PLVPDFODVH KRPRSROtPHURV RGHFODVHGLIHUHQWH KHWHURSROtPHURV /DFiSVLGHFRQVWLWX\HXQUHFLSLHQWHSURWHFWRUIRUPDGR
por los capsómeros.
(Q ORV YLUXV FRQ VLPHWUtD KHOLFRLGDO ORV FDSVyPHURV HVWiQ
constituidos por un único tipo de proteína y se denominan proWiPHURV/DVFiSVLGHVDVtFRQVWLWXLGDVVRQPX\UHVLVWHQWHVDOD
GLJHVWLyQSRUHQ]LPDVSURWHROtWLFDV\DOPHGLRH[WHUQR
/DVSURWHtQDVGHODHQYROWXUD SHSOyPHURV VRQJOLFRSURWHtQDV
que tienen funciones biológicas muy importantes tales como actividad de hemaglutinina, o de QHXUDPLQLGDVDSRUHMHPSORHQORV
virus LQÀXHQ]D(VIXQGDPHQWDOVXLQWHUYHQFLyQHQODDGVRUFLyQD
los receptores de la célula hospedadora, paso inicial en la replicación viral. Las hemaglutininas virales se unen a receptores mucoproteicos presentes en ciertas células del tracto respiratorio y otras,
permitiendo así la adsorción.
La enzima QHXUDPLQLGDVDHQHOYLUXVLQÀXHQ]DSXHGHFOLYDUHVD
unión permitiendo la liberación del virus y la diseminación de los
QXHYRVYLULRQHV &DStWXORVGHYLUXVUHVSLUDWRULRV /DVIXQFLRQHVSURSLHGDGHVGHODVSURWHtQDVGHVXSHU¿FLH son:
D 3URWHFFLyQGHOJHQRPDFRQWUDHOPHGLRH[WHUQRODGHVHFDFLyQ
y la acción de proteasas tisulares.
E $¿QLGDGSRUORVUHFHSWRUHVFHOXODUHVSDUDLQLFLDUODDGVRUFLyQ\
SHQHWUDFLyQDODFpOXODKRVSHGDGRUD(VWDD¿QLGDGVHOHFWLYDVHUi
XQRGHORVIDFWRUHVPiVLPSRUWDQWHVSDUDGHWHUPLQDUHOWURSLVPR
del virus por determinadas estirpes celulares.
F &DSDFLGDGDQWLJpQLFD\DTXHODVSURWHtQDVH[WHUQDVVRQSRWHQWHV
LQPXQyJHQRVTXHLQGXFLUiQHQXQKRVSHGDGRULQPXQRFRPSHtente una respuesta inmune, mediada fundamentalmente por
anticuerpos neutralizantes responsables de la protección del
KRVSHGHUR\SRUFpOXODVFLWRWy[LFDVTXHUHFRQRFHUiQDODVFpOXODVTXHH[SUHVHQHStWRSHVYLUDOHVHQpVWDV
Las proteínas internas del virión pueden ser proteínas estructurales o no estructurales. Pueden ubicarse en la cara interna de la
HQYROWXUD SURWHtQD0GHORVSDUDPL[RYLUXV HQWUHFDSDVGHFDS-
VyPHURVGHEDMRGHODFiSVLGH FiSVLGHLQWHUQD \HQHOFHQWURGHO
virión, asociadas al corepVWDV~OWLPDVVXHOHQVHUKLVWRQDV
Proteínas no estructurales
8QHMHPSORORFRQVWLWX\HQODVHQ]LPDVUHTXHULGDVSDUDODUHSOLFDFLyQ
que se sintetizan en fases muy tempranas de ésta y pueden detectarse
en las células infectadas, pero que luego no se incorporan al virión, por
HMHPSORODVSROLPHUDVDVGHORVSROLRYLUXV(QRWURVFDVRVHVDVHQ]LPDV
son proteínas que se asocian a la estructura viral, pero que no forman
FXDOLWDWLYDPHQWHSDUWHLPSRUWDQWHGHHOOD3RUHMHPSORODSROLPHUDVD
51$GHSHQGLHQWHGHOYLUXVLQÀXHQ]DTXHVtVHLQFRUSRUDDOYLULyQ
La enorme diversidad de proteínas que presentan los virus permite
distinguir entre virus de diferentes grupos y, aun dentro de un mismo
JUXSRLGHQWL¿FDUGLIHUHQWHVVHURWLSRV WLSRVDQWLJpQLFRV (VWRFRQVWLWX\HXQDGHODVEDVHVGHODFODVL¿FDFLyQYLUDOFRPRVHYHUiPiVDGHODQWH
2.4.3 Glúcidos y Lípidos
Los virus con envoltura contienen escasas cantidades de lípidos o
JOXFROtSLGRVTXHHVWiQDVRFLDGRVDODVJOLFRSURWHtQDVSUHVHQWHVHQ
ODPLVPD PL[RYLUXV\SDUDPL[RYLUXV (VWRVOtSLGRVVRQGHRULJHQ
celular, ya que esos virus adquieren su envoltura por brotación en
las membranas de la célula hospedera.
2.5 CONCEPTO DE SIMETRÍA: HELICOIDAL, ICOSAÉDRICA,
COMPLEJA Y BINARIA (TABLA 1.5)
La simetría es la forma que adopta un cuerpo en el espacio. La siPHWUtDGHORVYLUXVHVWiGDGDSRUODHVWUXFWXUDGHVXQXFOHRFiSVLGH\
SXHGHVHUGHFXDWURWLSRVD KHOLFRLGDOE F~ELFDRWDPELpQOODPDGD
LFRVDpGULFDF FRPSOHMD\G ELQDULD
Virus a
RNA
cadena
única
cadena
doble
Simetría
Desnudo /
envuelto
Familia
icosaédrica
GHVQXGR
HQYXHOWR
Picornaviridae
Togaviridae
KHOLFRLGDO
HQYXHOWR
Orthomyxoviridae
KHOLFRLGDO
HQYXHOWR
Arenaviridae
icosaédrica
GHVQXGR
Reoviridae
icosaédrica
GHVQXGR
HQYXHOWR
Adenoviridae
Herpesviridae
FRPSOHMD
HQYXHOWR
Poxviridae
icosaédrica
GHVQXGR
Parvoviridae
Virus a
DNA
cadena
doble
cadena
única
Tabla 1.5. Simetría de algunas familias de virus.
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
40
Capsómeros
Espículas
RNA
Nucleocápside
Envoltura
B
A
Figura 1.4. Simetría helicoidal: $GHVQXGDYLUXVGHOPRVDLFRGHOWDEDFR%HQYXHOWDRUWRPL[RYLUXV LQÀXHQ]D Hexón
{
Pentón (vértice)
Envoltura
con proyecciones
(espículas)
Capsómeros
esferoidales
Capsómeros
hexagonales
Fibra
DNA
A
B
Figura 1.5. Simetría icosaédrica: $GHVQXGDDGHQRYLUXV%HQYXHOWDKHUSHVYLUXV
DNA
Cabeza
DNA
Cuello
Vaina
Fibras
Cuerpos
laterales
B- Poxvirus - Formas de ladrillo
A- Bacteriófago T2
Figura 1.6. A, Simetría binaria; B, Simetría compleja.
/DVLPHWUtDKHOLFRLGDOVHDVHPHMDDXQDHVFDOHUDHQFDUDFRO/RV
YLUXVFRQHVWDVLPHWUtDSXHGHQSUHVHQWDUXQDQXFOHRFiSVLGHFLOtQGULFDH[WHQGLGD YLUXVGHOPRVDLFRGHOWDEDFREDFWHULyIDJR0
DPERVVRQYLUXVGHVQXGRV RELHQODQXFOHRFiSVLGHHVWiDUUROODGD
VREUHVtPLVPD\UHFXELHUWDSRUXQDHQYROWXUD YLUXVLQÀXHQ]D )LJXUD Los virus con simetría cúbica o icosaédrica son poliedros reguODUHVFRQFDUDVWULDQJXODUHVDULVWDV\YpUWLFHV3XHGHQVHU
GHVQXGRV SROLRYLUXVRDGHQRYLUXV RHVWDUUHFXELHUWRVGHHQYROWXUD
KHUSHVYLUXVRWRJDYLUXV )LJXUD 6HGHQRPLQDQYLUXVGHVLPHWUtDFRPSOHMDDDTXHOORVTXH
QRVRQQLKHOLFRLGDOHVQLLFRVDpGULFRV&RPRHMHPSORSRGHmos mencionar a los SR[YLUXV YLUXHOD TXHSRVHHQIRUPDGH
ladrillo. Algunos autores denominan de simetría binaria o combinada a la observada en algunos bacteriófagos que poseen
una cabeza con simetría icosaédrica y una cola con simetría
KHOLFRLGDO )LJXUD 3. ¿CÓMO
SE REPLICAN LOS VIRUS?
Al carecer de las enzimas biosintéticas necesarias para su replicación
los virus no crecen, no aumentan de tamaño ni su división es por
¿VLyQELQDULD1RSXHGHQUHSOLFDUVHHQPHGLRVGHFXOWLYRD[pQLFRV
sino que necesitan de células vivas. La replicación productiva sólo
se puede realizar en el interior de células vivas y permisivas. En los
comienzos de la Virología, se utilizaron como fuente de células vivas
HPEULRQHVGHSROORRGHSDWR\RDQLPDOHVGHH[SHULPHQWDFLyQ UDWRQHVFRED\RVRFRQHMRV 3RVWHULRUPHQWHFRQHODGYHQLPLHQWRGHORV
antibióticos que permitieron el desarrollo de técnicas para mantener
vivas células in vitroVHGHVDUUROODURQLQ¿QLGDGGHcultivos celulares,
aptos para la replicación de la mayoría de los virus.
(QODDFWXDOLGDGHODLVODPLHQWRGHORVYLUXVKXPDQRVFRQ¿QHV
diagnósticos, así como también la producción de vacunas se realiza
FDVLH[FOXVLYDPHQWHHQFXOWLYRVFHOXODUHV FDStWXORVGHDiagnóstico
Virológico y de 9DFXQDV Capítulo 1 / Introducción al estudio de la Virología humana
/DUHSOLFDFLyQYLUDOVHGHVFULEHHQHO&DStWXOR(QEUHYHHO
paso inicial de la replicación es la unión a un receptor celular en
una célula susceptible. Luego, la replicación se lleva a cabo sólo en
aquellas células permisivas, utilizando los mecanismos biosintéticos
GHODFpOXODGLULJLGRVSRUODLQIRUPDFLyQFRQWHQLGDHQHOiFLGRQXFOHLFRYLUDOSDUDODVtQWHVLVGHORViFLGRVQXFOHLFRV\SURWHtQDVYLUDOHV
De esta forma, la célula parasitada por un virus obedece las órdenes
FRGL¿FDGDVHQHOJHQRPDYLUDOSDUDVLQWHWL]DUSURGXFWRVYLUDOHVTXH
OXHJRGHVXHQVDPEOHGDUiQOXJDUDODIRUPDFLyQGHnuevos viriones,
o viriones progenie. Éstos VDOGUiQGHODFpOXODGRQGHUHSOLFDURQSDUD
iniciar nuevos ciclos de replicación en otras células permisivas.
La replicación viral se divide en las siguientes etapas:
$GVRUFLyQLQWHUDFFLyQGHSURWHtQDVGHVXSHU¿FLHGHOYLUXVFRQ
UHFHSWRUHVFHOXODUHVHVSHFt¿FRV
3HQHWUDFLyQDWUDYpVGHODPHPEUDQDSODVPiWLFDGHODFpOXOD
SRUSDVDMHGLUHFWR DGHQRYLUXV\SLFRUQDYLUXV SRUIXVLyQGH
ODPHPEUDQDFHOXODUFRQODHQYROWXUDYLUDO SDUDPL[RYLUXV
KHUSHV RSRUXQPHFDQLVPRGHHQGRFLWRVLVPHGLDGDSRUreFHSWRU YLURSH[LV TXHHVHOPiVIUHFXHQWH\HVVLPLODUDOD
fagocitosis.
'HFDSVLGDFLyQOLEHUDFLyQGHOQXFOHLFRYLUDOGHODQXFOHRFiSVLGH
(FOLSVHHWDSDHQODTXHQRVHREVHUYDQYLULRQHVHQHOLQWHrior de la célula ni se recupera virus infeccioso.
/DWHQFLDSHUtRGRTXHLQFOX\HDOHFOLSVH\TXHVHH[WLHQGHGHVGH
que se pierde la infectividad inicial hasta que se la recupera
debido a la aparición de los nuevos viriones neoformados. Durante las fases de eclipse y latencia ocurre la biosíntesis de los
iFLGRVQXFOHLFRV\GHODVSURWHtQDVYLUDOHV
0DGXUDFLyQHQVDPEOHGHORViFLGRVQXFOHLFRVQHRIRUPDGRV
FRQODVSURWHtQDVGHODFiSVLGH
/LEHUDFLyQORVYLULRQHVSURJHQLHSXHGHQVDOLUGHODFpOXODSRUOLVLV
SROLRYLUXV RSRUEURWDFLyQDWUDYpVGHODPHPEUDQDFHOXODU SDUDPL[RYLUXVDUHQDYLUXV GHODPHPEUDQDQXFOHDU KHUSHVYLUXV R
GHOUHWtFXORHQGRSOiVPLFR WRJDYLUXVKHSDGQDYLUXV 3.1 INTERACCIÓN DE LOS VIRUS CON SUS HOSPEDADORES
Si bien todos los seres vivos pueden ser infectados por virus, la reODFLyQYLUXVKRVSHGHURHVFODUDPHQWHHVSHFt¿FD&DGDYLUXVDIHFWD
VRODPHQWHDXQJUXSRELHQGH¿QLGRGHHVSHFLHVELROyJLFDV KRPEUH
DQLPDOHVYHJHWDOHVEDFWHULDVHWF \GHQWURGHHOODVVRODPHQWHD
DOJXQDVFpOXODV(VWRVHGHEHDODHVSHFL¿FLGDGGHODXQLyQGHOYLUXV
DUHFHSWRUHVGHODPHPEUDQDFHOXODUFX\DSUHVHQFLDHVWiGHWHUPLQDGD
SRUIDFWRUHVJHQpWLFRV\¿VLROyJLFRV3RUHOORD~QDQWHVGHTXHVH
FRQRFLHUDODHVWUXFWXUD\UHSOLFDFLyQGHORVYLUXVVHORVFODVL¿FDED
WHQLHQGRHQFXHQWDORVWHMLGRVTXHLQIHFWDEDQHQvirus dermotropos,
neumotropos, hepatotropos, neurotropos y pantropos.
$FWXDOPHQWH VH UHFRQRFH TXH HVWD FODVL¿FDFLyQ HV DUWL¿FLDO
\DTXHPXFKRVYLUXVSXHGHQDIHFWDUDGLYHUVRVWHMLGRVDXQTXHODV
PDQLIHVWDFLRQHVGHODLQIHFFLyQVHDQPiVHYLGHQWHVHQXQGHWHUPLQDGRWHMLGRXyUJDQR3RUHMHPSORHOYLUXVGHOsarampión produce
manifestaciones en piel y mucosas, pero puede infectar también el
pulmón o el cerebro.
Los virus que afectan animales y plantas no infectan en general al hombre, dado que éste carece genéticamente de los receptoUHVQHFHVDULRV&RQVWLWX\HQXQDH[FHSFLyQDTXHOORVYLUXVTXHVRQ
productores de antropozoonosis HQIHUPHGDGFRP~QDOKRPEUH\
DQLPDOHV (VWRVYLUXVSXHGHQUHSOLFDUWDQWRHQHOKRPEUHFRPRHQ
animales reservorios y en artrópodos YHFWRUHV&RPRHMHPSORVGH
antropozoonosis podemos mencionar a la rabia, las enfermedades
SURGXFLGDVSRUDUERYLUXV ¿HEUHDPDULOODencefalitis equinas, denJXH SRUDUHQDYLUXV ¿HEUHKHPRUUiJLFDDUJHQWLQD¿HEUHGH/DVVD o por KDQWDYLUXV\PiVUHFLHQWHPHQWHODLQÀXHQ]DDYLDU +1 3.2 NOCIONES DE BACTERIÓFAGOS
Los virus que infectan a las bacterias se denominan bacteriófagos.
No infectan directamente al ser humano pero poseen gran importan-
41
cia en patología humana ya que pueden poseer información genéWLFDTXHFRGL¿FDSDUDODSURGXFFLyQGHFLHUWDVWR[LQDVEDFWHULDQDV
3RUHMHPSORODWR[LQDGLIWpULFDHVXQDSURWHtQDFRGL¿FDGDSRUXQ
bacteriófago que parasita al Corynebacterium difteriae. En forma
DQiORJDODVWR[LQDVEDFWHULDQDVGHOS. pyogenes y de V. choleare son
FRGL¿FDGDVSRUEDFWHULyIDJRVORTXHSHUPLWHDGLFKDVEDFWHULDVOD
producción de la escarlatina y el cólera, respectivamente.
Otros bacteriófagos pueden transmitir resistencia a antibióticos
por diferentes mecanismos, lo que posee una enorme trascendencia
PpGLFD$GHPiVGDGDODIDFLOLGDGGHVXFXOWLYRHQEDFWHULDVVHKDQ
utilizado los bacteriófagos en el estudio de los mecanismos moleculares de interacción virus-bacteria.
3.3 LOS VIRUS: ¿SON SERES VIVOS?
6LODYLGDVHGH¿QHFRPRXQDVHULHFRPSOHMDGHSURFHVRVFDSDFHVGH
SODVPDUODLQIRUPDFLyQFRGL¿FDGDHQHOJHQRPDORVYLUXVSRGUtDQ
considerarse seres vivos sólo cuando invaden una célula hospedadora
y pueden replicarse. Ello implica que carecen de vida independiente.
Desde este punto de vista, no serían seres vivos cuando cristalizan
RFXDQGRVHORVFRQVHUYDHQFRQJHODGRUDVDž&RHQQLWUyJHQR
OtTXLGRDž&(QHVWDVFLUFXQVWDQFLDVHVGHFLUIXHUDGHXQDFpOXla, son metabólicamente inertes, si bien conservan su potencialidad
GHLQIHFFLyQ(QOFXDQGR6WDQOH\SXGRFULVWDOL]DUSRUSULPHUD
vez un virus, el del mosaico del tabaco, se suscitaron discusiones
¿ORVy¿FDVVREUHVLORVYLUXVHUDQRQRVHUHVYLYRV$OUHVSHFWRSRGUtD
aplicarse la frase del Evangelio: "Los conoceréis por sus obras". Es
decir, por sus efectos sobre los hospedadores que infectan.
4. INTRODUCCIÓN
A LA PATOGÉNESIS VIRAL
4.1 INTERACCIÓN DE LOS VIRUS CON LA CÉLULA HOSPEDERA
Las consecuencias de la infección viral sobre las células dependen
tanto de las características del virus como de la sensibilidad de las
células. Al igual que sucede con los bacteriófagos, los virus animaOHVVHFODVL¿FDQHQcitocídicos o no citocídicos.
Se denominan virus citocídicos a aquellos que producen la lisis
de la célula en que replican, lo cual se puede observar histológicaPHQWH3RUHMHPSORHOYLUXVGHODpoliomielitis, si afecta la médula
HVSLQDOOHVLRQDUiHQIRUPDLUUHYHUVLEOHODVPRWRQHXURQDVGHODVWD
DQWHULRURFDVLRQDQGRDVtXQDSDUiOLVLVSHUPDQHQWHGHORVP~VFXORV
inervados por dichas neuronas.
En los cultivos celulares, las alteraciones producidas por virus
pueden observarse al microscopio óptico y se denominan acción
citopática (ACP) o efecto citopatogénico (ECP &DStWXOR Por el contrario, otros virus se denominan no citocídicos porTXHSXHGHQUHSOLFDUVLQGHVWUXLUDODFpOXODKRVSHGDGRUD DUHQDYLUXV 'HQWURGHORVYLUXVno citocídicos se encuentran también
DTXHOORVFDSDFHVGHLQWHJUDUVHDOJHQRPDFHOXODU UHWURYLUXV SXGLHQGRSHUPDQHFHUHQHVHHVWDGRSRUWLHPSRLQGH¿QLGRFRQRVLQ
producción viral.
Se denomina infección productiva a aquella que da origen a
nuevos viriones como consecuencia de la replicación. Las infecciones productivas son las que se producen habitualmente cuando
un virus infecta células permisivas. Por el contrario, cuando un virus infecta células no totalmente permisivas o bien cuando el virus
presenta defectos en su replicación, se producen infecciones abortivas, es decir, sin producción de nuevos viriones. Las infecciones
abortivas pueden detectarse mediante la búsqueda de antígenos o
genomas virales en las células infectadas.
Durante la replicación pueden producirse otro tipo de partículas
que se denominan partículas defectivas porque son defectuosas en
cuanto a su potencial de replicación. Por ello, no pueden dar lugar a
nuevos viriones pero sí pueden interferir con la replicación normal,
esto se denomina fenómeno de autointerferencia.
2WURWHUPLQRDGH¿QLUHVprovirus. Se denomina provirus al
JHQRPDYLUDOLQWHJUDGRDOJHQRPDFHOXODU(OHMHPSORWtSLFRVHHQcuentra en la familia Retroviridae (HIV, HTLV). El provirus puede
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
42
Genoma
(tamaño)
Segmentos
Cápside
(simetría)
Envoltura
Virión
(tamaño en nm)
Familia
DNA de cadena doble
130-370 kpb
1
FRPSOHMD
sí
250
Poxviridae
120-220 kpb
1
icosaédrica
sí
100
Herpesviridae
28-48 kpb
1
icosaédrica
no
80
Adenoviridae
5 kpb
1
icosaédrica
no
50
Poliomaviridae
7-8 kpb
1
icosaédrica
no
50
Papillomaviridae
1
icosaédrica
no
20
40
Parvoviridae
Circoviridae HQHVWXGLR
10-12
icosaédrica
no
70
Reoviridae
DNA de cadena única
4-6 kb
RNA de cadena doble
20-30 kpb
RNA de cadena única (+)
28-33 kb
1
KHOLFRLGDO
sí
100
Coronaviridae
10-13 kb
1
icosaédrica
sí
60
Togaviridae
10-12 kb
1
icosaédrica
sí
50
Flaviviridae
7-8 kb
1
icosaédrica
no
27
Picornaviridae
7-8 kb
1
icosaédrica
no
30
Astroviridae
8 kb
1
icosaédrica
no
37
Caliciviridae
7 kb
1
icosaédrica
no
40
Hepeviridae
15-16 kb
1
KHOLFRLGDO
sí
200
Paramyxoviridae
19 kb
1
KHOLFRLGDO
sí
80-900
Filoviridae
10-16 kb
1
KHOLFRLGDO
sí
70-200
Rhabdoviridae
1
KHOLFRLGDO
sí
80-100
Bornaviridae
10-15 kb
8
KHOLFRLGDO
sí
100
Orthomyxoviridae
12-23 kb
3
KHOLFRLGDO
sí
090
Bunyaviridae
11 kb
2
KHOLFRLGDO
sí
50-200
Arenaviridae
icosaédrica
sí
090
Retroviridae
icosaédrica
sí
042
Hepadnaviridae
RNA de cadena única (-)
6 kb
RNA de cadena única - Transcriptasa inversa
7-10 kb
dímero
DNA de cadena doble - Transcriptasa inversa
3 kpb
1
Tabla 1.5. &ODVL¿FDFLyQGHORVYLUXVGHLPSRUWDQFLDPpGLFD
permanecer en estado latente durante años en el núcleo celular, o
ELHQWUDQVFULELUVHOXHJRGHODLQGXFFLyQHVSRQWiQHDRFRPRFRQsecuencia de diversos estímulos a nivel celular, que no se conocen
FRQH[DFWLWXG &DStWXORPatogenia de las infecciones virales y
&DStWXORRetrovirus 5. FUNDAMENTOS
DE LA CLASIFICACIÓN
Y NOMENCLATURA DE LOS VIRUS
7RGRVORVVHUHVYLYLHQWHVSXHGHQVHUSDUDVLWDGRVSRUYLUXVLos
YLUXVSXHGHQFODVL¿FDUVHGHDFXHUGRDVXVKRVSHGDGRUHVformas de transmisión, estructura, presencia o no de envoltura,
VLPHWUtDSURSLHGDGHV¿VLFRTXtPLFDVtipo y características de
4.2 INTERACCIÓN DE LOS VIRUS CON EL ORGANISMO IMNUNOCOMPETENTE
sus genomas, y lugar de replicación7DPELpQVHFRQVLGHUDHOWURA diferencia de lo que sucede en la interacción de un virus y células en SLVPRSRUGHWHUPLQDGRVWHMLGRV\DTXHODDFFLyQSDWyJHQDYLUDO
cultivo, en el hospedador entero inmunocompetente, los virus deben GHSHQGHUiGHVXWURSLVPR\VHJ~QHOODVHRULHQWDUiODFRQ¿UPDFLyQ
enfrentarse a todos los mecanismos de la inmunidad innata y a los etiológica dentro de un espectro limitado de virus causantes de una
FRPSOHMRVPHFDQLVPRVKXPRUDOHV\FHOXODUHVHVSHFt¿FRVTXHVHGHVHQ- patología determinada.
FDGHQDUiQOXHJRGHODLQIHFFLyQ/DDFFLyQGLUHFWDGHOYLUXV\RORVPH- 'HDFXHUGRDVXVKRVSHGDGRUHVORVYLUXVSXHGHQVHUFODVL¿FDGRV
canismos inmunológicos que producen enfermedad son denominados como virus de vertebrados, de insectos, de plantas, de bacterias, etc.
mecanismos patogénicos. En esta batalla, los virus pueden perder y ,QLFLDOPHQWHORVYLUXVVHFODVL¿FDURQSRUODHVSHFL¿FLGDGGHOKRVSHGDser eliminados del organismo, lo que ocurre en la mayoría de los casos dor, las enfermedades producidas o bien a su tropismo tisular. Muchos
RSRUHOFRQWUDULRDOJXQRVYLUXVSXHGHQSHUVLVWLUFRPRSRUHMHPSORHQ QRPEUHVGHYLUXVGHULYDQGHVXWURSLVPR3RUHMHPSORORVDUERYLUXV
ODVLQIHFFLRQHVODWHQWHVSDUDSRGHUUHDFWLYDUVHFRQSRVWHULRULGDG &DSt- replican en un artrópodo vector, los poliovirus producen poliomielitis,
WXORPatogenia de las infecciones virales y Capítulo 7, Mecanismos los adenovirus se aislaron de adenoides, etc. Otros nombres de familias
HVWiQEDVDGRVFRQDFUyQLPRVWDOHVFRPRSLFRUQDYLUXV pico = pequeño,
de defensa del hospedador frente a las infecciones virales Capítulo 1 / Introducción al estudio de la Virología humana
RNA iFLGRULERQXFOHLFR (QRWURVFDVRVHOQRPEUHSURYLHQHGHDOJXQDFDUDFWHUtVWLFDHVWUXFWXUDOGHOYLULyQSRUHMHPSORORVcoronavirus
presentan una corona de espículas, o bien el nombre proviene del lugar
GHVXSULPHUDLVODPLHQWR &R[VDFNLH0DUEXUJ:HVW1LOHJunín, AnGHVHWF /RVYLUXVSXHGHQWUDQVPLWLUVHSRUYtDUHVSLUDWRULDGLJHVWLYDFXWineo-mucosa o ingresar directamente a la sangre a través de picaduras
de artrópodos o bien por transfusiones de sangre o materiales contaPLQDGRVFRQVDQJUH DJXMDVFRQWDPLQDGDVFRQORVYLUXVKHSDWLWLV%
hepatitis C, +,9HWF
Los virus entéricos son aquellos que penetran y replican primariamente en el tracto gastrointestinal. Este grupo incluye numerosos
YLUXVGHVQXGRV\SRUHOORUHVLVWHQWHVDOiFLGRHVWRPDFDO\DODVVDOHV
biliares, como los HQWHURYLUXV SROLRYLUXV&R[VDFNLHYLUXVKHSDWLWLV
$ \RWURVFRPRURWDYLUXVFDOLFLYLUXVDGHQRYLUXVHQWpULFRVHWF
Los virus respiratorios penetran a través de la mucosa respiratoria, por inhalación, auto-inoculación o por contacto con fomites
FRQWDPLQDGRV\SURGXFHQSDWRORJtDORFDOL]DGDH[FOXVLYDPHQWHHQ
HODSDUDWRUHVSLUDWRULR ortomixovirus, muchos paramixovirus, coronavirus, rinovirus, y DGHQRYLUXV 2WURVYLUXVVLELHQSHQHWUDQ
por vía respiratoria se diseminan a otros órganos a través de virePLD SUHVHQFLDGHYLUXVHQVDQJUH FRPRORVYLUXVTXHSURGXFHQHO
sarampión, paperas, UXEpROD\YLUXHOD DFWXDOPHQWHHUUDGLFDGD El término arbovirus se aplica a aquellos virus que se transmiten por medio de artrópodos hematófagos cuando éstos ingieren
sangre de un vertebrado virémico. Este proceso no consiste en la
VLPSOHWUDQVPLVLyQPHFiQLFDVLQRHQODUHSOLFDFLyQYLUDODFWLYDHQ
ORVWHMLGRVGHORVDUWUySRGRV PRVTXLWRVJDUUDSDWDVFXOLFtGHRV (O
nombre proviene del inglés arthropod-borne viruses. Los arbovirus
se incluyen en las familias Togaviridae, Flaviviridae, Bunyaviridae
y Reoviridae.
([LVWHXQ&RPLWp,QWHUQDFLRQDOGH7D[RQRPtDTXHFODVL¿FDD
los virus e incluye a los nuevos que se descubren, en la familia que
les corresponde. Los virus se agrupan en familias, subfamilias y
JpQHURV/RVFULWHULRVSDUDGH¿QLUXQDIDPLOLDVRQ WLSRGHiFLGR
nucleico, estructura del genoma, mecanismos y lugar de replicaFLyQ WDPDxRGHOYLULyQ\VLPHWUtDGHODFiSVLGH Q~PHURGH
FDSVyPHURVHQORVYLUXVGHVQXGRVRGLiPHWURGHODKpOLFHHQORV
YLUXVKHOLFRLGDOHV SUHVHQFLDRQRGHHQYROWXUD OXJDUGHHQVDPEOHGHODVSDUWtFXODVYLUDOHV Q~FOHRRFLWRSODVPD IRUPDGH
salida de la célula hospedadora.
La nomenclatura de los órdenes, familias, subfamilias y géneros
YLUDOHVVHHVFULEHFRQPD\~VFXODV Picornaviridae, Adenoviridae En aquellas familias que se dividen en subfamilias se emplea el
VX¿MRvirinae Lentivirinae (QHODxRVHJ~QFRPXQLFDFLyQGHO&RPLWp,QWHUQDFLRQDOGH7D[RQRPtD9LUDOVHFRQRFtDQYLUXVyUGHQHV
IDPLOLDVVXEIDPLOLDVJpQHURV\HVSHFLHVGHYLUXV\
viroides que afectan a todos los seres vivos. Los virus que causan
SDWRORJtDKXPDQDVHUHVXPHQHQOD7DEOD y la )LJXUD.
La subdivisión de las familias en géneros depende de criterios
diferentes según las familias. Cada género puede tener cientos de
HVSHFLHVGLVWLQWDVODVTXHVHLGHQWL¿FDQSRUGLIHUHQFLDVDQWLJpQLFDV
([LVWHQYLUXVTXHWLHQHQXQ~QLFRserotipo sarampión, rubéoOD RWURVSUHVHQWDQVHURWLSRV SROLRYLUXV PLHQWUDVTXHRWURVSRVHHQPiVGHVHURWLSRVGLIHUHQWHV ULQRYLUXV (VWRWLHQHJUDQ
LPSRUWDQFLDSDUDVHOHFFLRQDUODVFHSDVTXHGHEHUiQLQFOXLUVHHQODV
vacunas.
A su vez, dentro de un mismo serotipo pueden albergarse uno
o múltiples tipos genómicos o genotipos3RUHMHPSORHQHOYLUXV
hepatitis B un único serotipo incluye al menos ocho genotipos diferentes.
/DVGLYHUJHQFLDVJHQyPLFDVTXHSHUPLWHQODH[SUHVLyQGHGLIHrentes serotipos son mayores que las que acaecen entre los diversos
JHQRWLSRV(OSRUFHQWDMHGHKRPRORJtDQXFOHRWtGLFD VLPLOLWXGQXFOHRWtGLFD TXHGH¿QHXQJHQRWLSRFRPRGLIHUHQWHGHRWURHVYDULDEOHVHJ~QHOYLUXVHQFXHVWLyQSRUORFXDOXQPLVPRSRUFHQWDMHGH
KRPRORJtDSXHGHGH¿QLUSDUDXQYLUXVXQJHQRWLSR\SDUDRWURXQ
subtipo.
43
Se denominan cuasiespecies virales a genomas viables sometidos a un proceso de evolución y selección cuyas secuencias nuFOHRWtGLFDVHVWiQtQWLPDPHQWHUHODFLRQDGDVHQWUHVt GLIHUHQFLDGDV
por pocas PXWDFLRQHV ODVTXHYDUtDQDOUHGHGRUGHXQDVHFXHQFLD
master.
5HFLHQWHPHQWHVHKDDJUXSDGRDORVYLUXVHQyUGHQHVRWD[RQHV3RUHMHPSORORVYLUXVLQFOXLGRVHQHORUGHQMononegavirales
presentan todos un genoma de cadena única, son no segmentados
y de polaridad negativa. Este orden incluye tres familias: Paramyxoviridae, Rhabdoviridae y Flaviviridae.
6. LOS
VIRUS NO SON LOS
AGENTES PATÓGENOS MÁS PEQUEÑOS:
¿QUÉ
SON LOS VIRIONES, LOS VIROIDES Y LOS PRIONES?
Recordemos que se denomina virión a la partícula viral completa
e infectante. Es decir, a la partícula que posee tanto sus características estructurales como su infectividad intactas.
([LVWHQRWURVDJHQWHVGHPHQRUWDPDxR\FRPSOHMLGDGTXHORV
virus, denominados viroides. Los viroides fueron descubiertos por
'LHQQHUHQ\SURGXFHQHQIHUPHGDGHVHQSODQWDV SHSLQRFULVDQWHPRFtWULFRVHWF ORTXHRFDVLRQDSpUGLGDVHFRQyPLFDVHQODV
plantaciones de vegetales. Se caracterizan por presentar un único
WLSRGHiFLGRQXFOHLFR 51$ 6HGLIHUHQFLDQGHORVYLUXVYHUGDGHURVHQTXHFDUHFHQGHFiSVLGH\GHHQYROWXUDQRSRVHHQLQIRUPDFLyQSDUDODVtQWHVLVSURWHLFDVRQPX\UHVLVWHQWHVDOFDORU\VXiFLGR
nucleico es siempre infeccioso en condiciones naturales.
)LQDOPHQWHH[LVWHQRWURVSDWyJHQRVGHQRPLQDGRVagentes virales no convencionales que comparten algunas propiedades con
ORVYLUXVSHURVHGLIHUHQFLDQHQVXHVWUXFWXUD\HQVXH[WUDRUGLQDULD
resistencia a los agentes inactivantes de virus. Estos agentes no convencionales presentan características asombrosas:
D FDUHFHQGHFiSVLGHRHQYROWXUD\SRUHOORQRSRVHHQFDSDFLdad antigénica, por lo que son incapaces de desencadenar respuesta
LQPXQHDOJXQDHQHOKRVSHGDGRUE QRVHFRQRFHVXiFLGRQXFOHLFR
SRUORTXHVRQORVSULPHURVDJHQWHVLQIHFFLRVRVVLQiFLGRQXFOHLFR
GHWHFWDEOHVKDVWDHOPRPHQWRHQODQDWXUDOH]DHQHVWHSODQHWD\F son resistentes a los agentes inactivantes de virus incluyendo calor,
luz ultravioleta, formol, glutaraldehído, etc.
Producen enfermedades lentas del sistema nervioso central que
DIHFWDQDOKRPEUH kuru RDWD[LDGHJHQHUDWLYDHQGpPLFDHQIHUPHGDGGH&UHXW]IHOGW-DFRERGHPHQFLDSUHVHQLO RDOJDQDGRRYLQR
scrapie \ERYLQR HQFHIDORSDWtDHVSRQJLIRUPHERYLQDRenfermedad de la vaca loca $SDUWLUGHODVXVWDQFLDDPLORLGHGHORVHQfermos se pudieron aislar unas glucoproteínas capaces de trasmitir
la enfermedad a ratones. Su descubridor, S. Prusiner, las denominó
priones proteinaceus infective particle y por este descubrimiento
recibió el premio Nobel.
$OPLFURVFRSLRHOHFWUyQLFRORVSULRQHVVHREVHUYDQFRPR¿EULOODVGHQP1RVHFRQRFHVXPHFDQLVPRGHUHSOLFDFLyQ
pero se postula que, dado que no poseen la información genética
QHFHVDULDSDUDVXVtQWHVLVpVWDHVWDUtDFRGL¿FDGDHQHOJHQRPDGH
la célula hospedadora. Normalmente, esa información estaría reprimida y la infección con priones produciría su des-represión y
permitiría la replicación del prión y el posterior desarrollo lento
de la enfermedad, muchos años después de ocurrida la infección
&DStWXOR(QFHIDORSDWtDVHVSRQJLIRUPHVWUDQVPLVLEOHV 7. ¿CÓMO PUEDEN INACTIVARSE LOS VIRUS?
EFECTO DE LOS AGENTES FÍSICO-QUÍMICOS
'LYHUVRV DJHQWHV ItVLFRTXtPLFRV WHPSHUDWXUD OX] XOWUDYLROHWD
S+PHGLRLyQLFR\VROYHQWHVOLStGLFRV SXHGHQDFWXDUVREUHORV
constituyentes del virión produciendo su inactivación. El conocimiento de la sensibilidad o resistencia de los virus a estos agentes
HVLPSRUWDQWHSDUD GHWHUPLQDUVXVIRUPDVGHWUDQVPLVLyQ emplear métodos de inactivación viral adecuada para materiales
FRQWDPLQDGRVTXHQHFHVLWDQGHVLQIHFFLyQ HIHFWXDUHOtratamiento
FRUUHFWRGHODJXDSRWDEOHHWF FRQRFHUODYLDELOLGDGGHPXHVWUDV
44
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
VIRUS CON DNA
Poxviridae
Herpesviridae
Papillomaviridae
Adenoviridae
Hepadnaviridae
Parvoviridae
VIRUS CON RNA
Orthomyxoviridae
Paramyxoviridae
Coronaviridae
Togaviridae
Retroviridae
Caliciviridae
Figura 1.7. Principales familias de virus patógenos para el hombre.
Bunyaviridae
Reoviridae
Arenaviridae
Rhabdoviridae
Picornaviridae
Capítulo 1 / Introducción al estudio de la Virología humana
clínicas para GLDJQyVWLFRYLUROyJLFR FRQVHUYDUDGHFXDGDPHQWH
las vacunas virales, en especial aquellas a virus vivo y atenuado.
7.1.1 Temperatura
/DPD\RUtDGHORVYLUXVVRQOiELOHVDOFDORU(VVX¿FLHQWHXQD
KRUDDž&SDUDLQDFWLYDUODPD\RUtDGHORVYLUXVSRUGHVQDWXUDOL]DFLyQGHODVSURWHtQDVGHODFiSVLGH&RQVWLWX\HQH[cepciones a esta regla el virus hepatitis B, los adenoasociados y
viroides, que resisten esa temperatura.
Como regla general, la vida media de la mayoría de los viriones libres puede ser medida en segundos a 60º C, en minutos
a 37º C, en horas a 4º C, en días a -20º C, en meses a -70º C y en
años a -196º C.
/DHVWHULOL]DFLyQSRUFDORUVHFRHQHVWXID òKRUDDž& R
SRUFDORUK~PHGRHQDXWRFODYH DPLQXWRVDž&\Dò
DWPyVIHUDVGHSUHVLyQSRUHQFLPDGHODSUHVLyQDWPRVIpULFD GHVWUX\H
WRGRVORVYLUXVLQFOX\HQGRDORVPiVUHVLVWHQWHVFRPRHOGHhepatitis
B. Por esta razón, la estufa o el autoclave son instrumentos usados
para esterilización de diversos materiales de uso médico.
La temperatura ambiente inactiva muchos virus, aunque el tiempo
requerido depende de las características de la familia. El virus hepatitis
B y los SR[YLUXV YLUXHOD SXHGHQFRQVHUYDUVXLQIHFWLYLGDGDWHPSHUDtura ambiente durante meses, lo que facilita la transmisión por medio
de fomites, aun en ausencia de contacto directo con el enfermo. Por el
FRQWUDULRORVRUWRPL[RYLUXV LQÀXHQ]D ORVSDUDPL[RYLUXV sarampión,
VLQFLFLDOUHVSLUDWRULRHWF RORVKHUSHVYLUXVVHLQDFWLYDQUiSLGDPHQWH
en pocas horas a temperatura ambiente. En estos casos, se requiere un
contacto directo con el enfermo o fomites contaminados para lograr su
efectiva transmisión a un nuevo hospedador.
En relación al diagnóstico virológico, la conservación adecuada de las muestras provenientes de pacientes para el aislamiento
YLUDOHVIXQGDPHQWDO(VWDVPXHVWUDVGHEHQVHUFRQVHUYDGDVDž
&\HQYLDGDVUiSLGDPHQWHDOODERUDWRULRHQKLHORJUDQL]DGRRFRQ
enfriadores de uso doméstico. Es importante evitar la congelación
ya que muchos virus, en especial aquellos con envoltura como el
virus sincicial respiratorio, o citomegalovirus son muy sensibles a
la congelación y descongelación.
En el laboratorio, habitualmente se preparan y conservan cepas
virales denominadas semillas, stocks o lotes, los que se emplean
en algunos métodos diagnósticos y en pruebas de control de calidad en el diagnóstico. Luego de la replicación del virus en células
permisivas se logra un lote viral, el que se titula y fracciona en
alícuotas con el agregado de medios protectores conteniendo suero
RGLPHWLOVXOIy[LGRSDUDSUHVHUYDUVXLQIHFWLYLGDG/RVORWHVYLUDOHV
VHFRQVHUYDQHQFRQJHODGRUDVDž&RHQWDQTXHVGHQLWUyJHQR
OtTXLGRDž&GXUDQWHPHVHVRDxRV
Otro procedimiento empleado para preservar la infectividad es
ODOLR¿OL]DFLyQ GHVHFDFLyQHQIUtRXVDQGRFiPDUDVGHYDFtR (VWH
método se utiliza en la conservación de vacunas ya que facilita su
WUDVODGRDž&\DXQDWHPSHUDWXUDDPELHQWH(OKHFKRGHTXHOD
YDFXQDDQWLYDULyOLFDOLR¿OL]DGDSXGLHUDVHUFRQVHUYDGDGXUDQWHPHVHVHQHVDVFRQGLFLRQHVIXHXQIDFWRUIXQGDPHQWDOHQODH¿FDFLDGH
las campañas de vacunación que permitieron lograr la erradicación
GHODYLUXHODGHOSODQHWD &DStWXOR9DFXQDV9LUDOHV 7.1.2 pH y medio iónico
/RVYLUXVVHFRQVHUYDQPHMRUHQPHGLRVLVRWyQLFRV\DS+¿VLRlógico, aunque algunos pueden soportar un amplio rango de pH y
IXHU]DVLyQLFDV3RUHMHPSORORVHQWHURYLUXVUHVLVWHQHOS+iFLGR
del estómago y por esa razón pueden penetrar por vía digestiva.
En aquellos casos en que es imprescindible preservar la infecWLYLGDGFRPRSRUHMHPSORHQODSUHSDUDFLyQGHvacunas a virus
vivo y atenuado, se adicionan sales de MgCl² ya que aumentan la
resistencia de los virus a la inactivación térmica.
7.1.3 Radiaciones
/DUDGLDFLyQXOWUDYLROHWD\ODVUDGLDFLRQHVLRQL]DQWHV UD\RV;RUDGLDFLRQHVJDPPD SURGXFHQDOWHUDFLRQHVLUUHYHUVLEOHVHQHOJHQRPD
y por ello pueden inactivar a los virus, en especial a aquellos con
45
iFLGRVQXFOHLFRVPRQRFDWHQDULRV6HKDXWLOL]DGRODOX]XOWUDYLROHWD
para inactivar YDFXQDVFRPRODDQWLUiELFDTXHIXHXVDGDHQQXHVWUR
SDtV YDFXQD)XHQ]DOLGD3DODFLRV $VLPLVPRSXHGHXVDUVHOX]XOWUDYLROHWDSDUDGHVLQIHFWDUiUHDV
GHWUDEDMRHQHOODERUDWRULR ÀXMRVODPLQDUHVPHVDGDVHWF /D
fuente emisora es un tubo germicida y la radiación emitida actúa
formando dímeros entre las cadenas adyacentes de pirimidinas.
Dado que la luz ultravioleta posee escaso nivel de penetración, sólo
SXHGHHPSOHDUVHHQODGHVLQIHFFLyQGHiUHDVTXHUHFLEDQGLUHFWDmente la luz emitida.
/DVUDGLDFLRQHVLRQL]DQWHV &REDOWR VHXWLOL]DQSDUDHVWHULOL]DUPDWHULDOHVSOiVWLFRVGHXVRPpGLFR VRQGDVFDWpWHUHVMHULQJDV
HWF RGHODERUDWRULR ERWHOODVWXERV\SROLFXEHWDVSDUDcultivos
FHOXODUHV (QODDFWXDOLGDGODPD\RUSDUWHGHOPDWHULDOGHVFDUWDEOH
se esteriliza por este método.
7.1.3 Solventes de lípidos
La presencia o no de envoltura determina la sensibilidad de los
virus a los solventes lipídicos. Los virus con envoltura se inactivan
IiFLOPHQWHFRQHVWRVVROYHQWHV pWHUFORURIRUPRVDOHVELOLDUHVR
FRQGHWHUJHQWHVDQLyQLFRV 3RUHOFRQWUDULRORVYLUXVGHVQXGRVVRQ
resistentes a estos agentes y por ello pueden ser infectivos por vía
GLJHVWLYD\DTXHUHVLVWHQODDFFLyQGHODVVDOHVELOLDUHV Picornavius:
poliovirus, &R[VDFNLHHWF /DVHQVLELOLGDGDORVVROYHQWHVGHOtSLGRVHVHPSOHDGDHQODFODVL¿FDFLyQSUHOLPLQDUGHORVYLUXVDLVODGRV
de muestras clínicas.
7.1.4 Nociones de Vacunas a virus inactivados
Las YDFXQDVDYLUXVLQDFWLYDGRVHVWiQFRQVWLWXLGDVSRUVXVSHQVLRQHV
de virus en las que se inactiva la infectividad pero se conserva la
DQWLJHQLFLGDG(OIRUPDOGHKtGRHVXQLQDFWLYDQWHFOiVLFR\IXHXVDGR
por Jonas Salk para preparar la primera vacuna antipoliomielítica.
El formaldehído reacciona con los grupos amino de las proteínas y
FRQORViFLGRVQXFOHLFRV2WURVLQDFWLYDQWHVXWLOL]DGRVSDUDvacunas
VRQODOX]XOWUDYLROHWD\ODEHWDSURSLRODFWRQD &DStWXORVacunas
9LUDOHV 8. NOCIONES
DE ESTERILIZACIÓN Y DESINFECCIÓN
(VWHWHPDVHWUDWDUiHQHOFDStWXORGH%LRVHJXULGDGSHURGH¿QLUHPRV
aquí algunas nociones esenciales ya que para prevenir las infeccioQHVQRVRFRPLDOHV LQWUDKRVSLWDODULDV HVIXQGDPHQWDOODXWLOL]DFLyQ
de procedimientos de esterilización y desinfección.
6HGH¿QHDODesterilización como aquel procedimiento que
logra la ausencia total de microorganismos viables, mientras que
la desinfección es la destrucción de la infectividad potencial de un
material determinado. Para lograr la esterilización pueden utilizarse
PpWRGRVItVLFRVFRPRODWHPSHUDWXUD HQHVWXIDGHHVWHULOL]DFLyQR
HQDXWRFODYH ODVUDGLDFLRQHVRELHQORVDJHQWHVPHFiQLFRVFRPROD
¿OWUDFLyQDWUDYpVGH¿OWURVFRQSRURVGHPLFURQHVTXHSXHGHQ
retener las bacterias y hongos.
La esterilización adecuada se logra sólo cuando se obtiene
ODH[SRVLFLyQUHTXHULGDHQFXDQWRDWHPSHUDWXUD \HYHQWXDOSUHVLyQ \WLHPSR(QXQDHVWXIDGHHVWHULOL]DFLyQODVFRQGLFLRQHV
DGHFXDGDVVRQž&GXUDQWHKRUDyž&GXUDQWHòKRUD
yž&GXUDQWHKRUDV(QHODXWRFODYHODVFRQGLFLRQHVGH
HVWHULOL]DFLyQVRQž&GXUDQWHDPLQXWRVDòDWPyVfera de presión por encima de la presión atmosférica. El método
a elegir depende del material a esterilizar. Para ropas, material
de goma y soluciones tamponadas sin proteínas debe utilizarse el
autoclave, ya que esos elementos no resistirían el calor seco de
ODHVWXID3DUDDTXHOORVPDWHULDOHVTXHUHVLVWHQHOFDORU YLGULR
LQVWUXPHQWDOTXLU~UJLFRPHWiOLFR SXHGHHPSOHDUVHODHVWXIDGH
HVWHULOL]DFLyQ(QPDWHULDOHVTXHQRUHVLVWHQHOFDORU SOiVWLFRV
VRQGDVHQGRVFRSLRVHWF VHXWLOL]DHOy[LGRGHHWLOHQRRODUDdiación ionizante.
/D¿OWUDFLyQDWUDYpVGHPHPEUDQDVFRQSRURVGHPLFURQHV
se emplea para esterilizar medios de cultivo de células, los que contienen soluciones tamponadas, sueros animales, vitaminas, enzimas,
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
46
etc. Estas sustancias no resisten el calentamiento que destruye sus
FRQVWLWX\HQWHVHVHQFLDOHVSRUORTXHVHGHEHHPSOHDUOD¿OWUDFLyQ
3DUDGHVLQIHFFLyQGHVXSHU¿FLHVHQHOPHGLRKRVSLWDODULRHQHOODboratorio, así como también para material de laboratorio contaminado,
VHXWLOL]DKLSRFORULWRGHVRGLRDO DJXDODYDQGLQDGHXVRGRPpVWLFR yGHFORURDFWLYR(VLPSRUWDQWHUHFRUGDUTXHODVVROXFLRQHV
de hipoclorito de sodio deben prepararse diariamente a la concentración adecuada, ya que se evapora disminuyendo así la concentración de
FORURDFWLYR\SRUORWDQWRVXHIHFWLYLGDGFRPRGHVLQIHFWDQWH7DPELpQ
SXHGHHPSOHDUVHJOXWDUDOGHKtGRDORiFLGRSHUDFpWLFRSDUDORVHOHmentos que no resisten la acción del hipoclorito.
Para la antisepsia de piel no es posible utilizar los productos reFLpQPHQFLRQDGRVSRUVHUWy[LFRV(QHVWHFDVRGHEHUiQXWLOL]DUVH
DOFRKROLRGDGRDOFORURKH[LPLGDDORELHQHWDQRODO
9. NOMENCLATURA
DE LOS VIRUS
Los virus se designan según normas establecidas por el Comité InWHUQDFLRQDOGH7D[RQRPtD9LUDO International Committee for Taxonomy of viruses±,&79± $OLJXDOTXHDFRQWHFHFRQRWURVDJHQWHV
biológicos, los órdenes, familias, subfamilias y géneros se deben
FRQVLJQDUHQLWiOLFD\FRQODSULPHUDOHWUDPD\~VFXOD
(QDJRVWRGHHO,&79SURSXVR &DStWXORVREUHODV5HJODV
de &ODVL¿FDFLyQ\1RPHQFODWXUDGHYLUXV UHHPSOD]DUVXSUHYLDGHQRPLQDFLyQWD[RQyPLFD VHORVFRQVLJQDEDFRQOHWUDPLQ~VFXOD SRU
VXGHVLJQDFLyQHQOHWUDLWiOLFD\PD\~VFXODHQODOHWUDLQLFLDOGHOD
primera palabra. Otras palabras inherentes a la denominación de un
virus, sólo se consignan con mayúscula si corresponden a un nombre
propio o a partes de un nombre propio.
Los nombres de las enfermedades producidas por virus deben
escribirse con minúscula. Asimismo, cuando se emplea el nombre
GHXQDIDPLOLDHQIRUPDJHQpULFD SRUHMHPSORORVSROLRYLUXVRORV
KHUSHVYLUXV WDPELpQGHEHXWLOL]DUVHODOHWUDPLQ~VFXOD
6LQHPEDUJRHO,&79LQGLFDWH[WXDOPHQWHTXHQRHVQHFHVDULD
ODHVFULWXUDHQLWiOLFD\OHWUDLQLFLDOPD\~VFXODFXDQGRVHUH¿HUHDXQD
HQWLGDGGRQGHHOYLUXVDGMHWLYDRWURFRPSRQHQWH SRUHMHPSOROD
SROLPHUDVDGHOYLUXVGHOPRVDLFRGHOWDEDFR RVHUH¿HUHDHQWLGDGHV
ItVLFDVTXHKDFHQUHIHUHQFLDDYLULRQHV SRUHMHPSOR—JGHYLUXV
GHOPRVDLFRGHOWDEDFR 1RREVWDQWHORPHQFLRQDGRHOOHFWRUSRGUiFRPSUREDUTXHDXQODV
SXEOLFDFLRQHVFLHQWt¿FDVLQWHUQDFLRQDOHVPiVUHOHYDQWHVHQHOiPELWR
de la Virología, estas reglas no siempre se aplican uniformemente.
3RUORH[SXHVWRHQHVWDREUDSRGUiREVHUYDUVHTXHORVYLUXVVRQ
mencionados con mayúscula o minúscula.
Bibliografía
‡
‡
‡
‡
‡
‡
&ROOLHU / 2[IRUG - Human Virology 6HFRQG (GLWLRQ 2[IRUG
2[IRUG8QLYHUVLW\3UHVV
&RPLWp ,QWHUQDFLRQDO GH 7D[RQRPtD GH 9LUXV R ,&79 KWWS
LFWYRQOLQHRUJYLUXV7D[RQRP\DVS"YHUVLRQ 'DYLG 0 .QLSH '0 +RZOH\ 30 *ULI¿Q '( /DPE 5$
Martin MA, Roizman B, Straus SE. Fields Virologyth Edition.
3KLODGHOSKLD/LSSLQFRWW:LOOLDPV :LONLQV /:: ,&797KH,QWHUQDWLRQDOFRGHRIYLUXVFODVVL¿FDWLRQDQGQRPHQFODWXUH
$XJXVWKWWSLFWYRQOLQHRUJFRGH2I9LUXV&ODVVL¿FDWLRQB
asp.
,QIRUPHVHPDQDHSLGHPLROyJLFD GLFLHPEUH 1HXPDQ * 1RGD 7 .DZDRND < (PHUJHQFH DQG SDQGHPLF
SRWHQFLDORIVZLQHRULJLQ+1,QÀXHQ]D9LUXVNature
‡
‡
‡
‡
‡
‡
Novel Swine-Origin ,QÀXHQ]D$ +1 9LUXV,QYHVWLJDWLRQ7HDP
Emergence of a novel swine origin ,QÀXHQ]D$ +1 YLUXVLQ
humans. N Engl J Med
Organización Panamericana de la Salud Actualización semanal
SDQGHPLD+1
6WRUFK*$Essentials of Diagnostic Virology1HZ<RUN&KXUFKLO
/LYLQVWRQH(GLWRU
6WUDXVV-+6WUDXVV(*Viruses and Human Disease. San Diego,
&DOLIRUQLD$FDGHPLF3UHVV(OVHYLHU
9DQ5HJHQPRUWHO0DUF+90DK\%ULDQ:-(PHUJLQJ,VVXHVLQ
9LUXV7D[RQRP\Emerg Infect Dis
:DJQHU(.0DUWLQH]-+Basic Virology. Massachusetts, USA,
%ODFNZHOO6FLHQFH,QF
2
Replicación viral
Viviana Castilla - Elsa B. Damonte
1. INTRODUCCIÓN
Una característica fundamental de los virus es su dependencia de la
maquinaria biosintética y energética de la célula que infectan, siendo
LQFDSDFHVGHUHSOLFDUHQHOPHGLRH[WUDFHOXODU3RUORWDQWRHQPXFKRV
DVSHFWRVHOHVWXGLRGHODUHSOLFDFLyQYLUDOFRPSUHQGHHODQiOLVLVGHODV
interacciones entre el virus y la célula hospedera. La replicación viral
puede, en algunos casos, producir daño o muerte celular siendo estos
procesos una de las causas de las enfermedades producidas por virus,
por lo que el conocimiento de los mecanismos de patogénesis viral se
basa en parte en el estudio de la replicación intracelular. Asimismo, el
desarrollo de compuestos con actividad antiviral requiere del conocimiento de las características del ciclo de multiplicación de un virus a
¿QGHGHWHUPLQDUDTXHOORVHYHQWRVGHODUHSOLFDFLyQTXHLQYROXFUHQ
SURFHVRVRFRPSRQHQWHVHVSHFt¿FDPHQWHYLUDOHV
/DVLQIHFFLRQHVYLUDOHVSXHGHQVHUFODVL¿FDGDVHQSURGXFWLvas y no productivas. Las infecciones productivas son aquellas
que tienen como consecuencia la producción de nuevas partícuODVYLUDOHVLQIHFFLRVDV SURJHQLHYLUDO 'HQWURGHHVWHtipo de
infecciones, algunas llevan a la muerte y lisis de la célula infectada mientras que en otros casos la célula sobrevive y continúa
SURGXFLHQGRYLUXVDYHFHVDEDMRVQLYHOHV LQIHFFLRQHVFUyQLFDV DXQTXHHQDOJXQRVFDVRVORVQLYHOHVSXHGHQVHUÀXFWXDQWHVR
SHUVLVWHQWHPHQWHHOHYDGRV HMHPSORODKHSDWLWLV&FUyQLFD (Q
el caso de las infecciones no productivas, la replicación viral se
encuentra bloqueada y la célula infectada puede o no sobrevivir.
'LIHUHQWHVPROpFXODVSUHVHQWHVHQODVXSHU¿FLHGHODFpOXODFRPR
proteínas, glicoproteínas o carbohidratos que normalmente cumplen
XQSDSHOLPSRUWDQWHHQOD¿VLRORJtDFHOXODUSXHGHQVHUXWLOL]DGDV
como receptores virales. Las moléculas receptoras utilizadas por alJXQRVYLUXVVRQSURWHtQDVTXHVHH[SUHVDQ~QLFDPHQWHHQODVXSHU¿FLH
GHFpOXODVGLIHUHQFLDGDVSRUORTXHHVWRVYLUXVH[KLEHQXQWURSLVPR
WLVXODUUHVWULQJLGRSRUHMHPSORHOYLUXVhepatitis B que replica en
KHSDWRFLWRVRHOYLUXVGHODLQPXQRGH¿FLHQFLDKXPDQDWLSR HIV TXHPXOWLSOLFDHQOLQIRFLWRV7CD4+ y macrófagos. Los miembros
de algunas familias de virus, como picornavirus y retrovirus, han
evolucionado hacia la utilización de distintos receptores. A pesar de
ODH[LVWHQFLDGHHVWDheterogeneidad, también ocurre que virus no
relacionados comparten un mismo receptor.
Si bien la interacción de virus como poliovirus, rhinovirus o el
virus LQÀXHQ]DFRQXQ~QLFRUHFHSWRUHVVX¿FLHQWHSDUDSHUPLWLUOD
posterior penetración del virus a la célula, los virus +,9DGHQRvirus y alfaherpesvirus requieren de la interacción con un receptor
SULPDULRTXHIDFLOLWDODXQLyQDODVXSHU¿FLHFHOXODU\FRQXQFRrreceptor necesario para la entrada del virus a la célula. En el caso
GHDGHQRYLUXVSRUHMHPSORHOLQLFLRGHODLQIHFFLyQLPSOLFDXQD
primera interacción de la partícula viral con un tipo de molécula
UHFHSWRUD PROpFXODGHOFRPSOHMRPD\RUGHKLVWRFRPSDWLELOLGDG
clase I o una proteína de la superfamilia de las inmunoglobulinas
GHQRPLQDGD&$5 \XQDVHJXQGDLQWHUDFFLyQFRQSURWHtQDVGHOD
familia de las integrinas, indispensable para la internalización del
virus a la célula.
2. CICLO
2.2 PENETRACIÓN
DE REPLICACIÓN VIRAL
(OFLFORGHUHSOLFDFLyQGHXQYLUXVFRQMXQWRGHHYHQWRVTXHFRQGXcen a una infección viral productiva, comienza con la unión de las
SDUWtFXODVYLUDOHVFRQUHFHSWRUHVHVSHFt¿FRVSUHVHQWHVHQODVXSHU¿FLH
celular, proceso denominado adsorción. Esta interacción inicial es
seguida por la etapa de penetración que permite la incorporación del
material genético viral en la célula. A continuación, mediante estraWHJLDVTXHGL¿HUHQGHDFXHUGRDODQDWXUDOH]DGHOPDWHULDOJHQpWLFR
VHSURGXFHODH[SUHVLyQ\UHSOLFDFLyQGHOJHQRPDYLUDO)LQDOPHQWH
los componentes virales sintetizados se ensamblan de manera de conIRUPDUSDUWtFXODVYLUDOHVPDGXUDV YLULRQHV TXHVRQOLEHUDGDVGHOD
célula infectada. Consideraremos ahora los aspectos sobresalientes de
cada una de las etapas del ciclo de replicación de un virus.
2.1 ADSORCIÓN
Para iniciar la replicación en una célula los virus deben adherirse a
ODPHPEUDQDSODVPiWLFD\GLFKDLQWHUDFFLyQLPSOLFDODXQLyQGHXQD
SURWHtQDGHODFXELHUWDYLUDO FiSVLGHRHQYROWXUD GHQRPLQDGDDQWL
receptor o proteína de unión, con una molécula presente en la super¿FLHFHOXODURreceptor/DSUHVHQFLDGHUHFHSWRUHVHVSHFt¿FRVHVOR
que determina la susceptibilidad de un tipo celular a determinado
virus, por lo tanto esta interacción inicial entre el virus y la célula
es de suma importancia en la patogénesis viral. Sin embargo, debe
tenerse en cuenta que la sola presencia de receptores adecuados
QRQHFHVDULDPHQWHFRQGXFHDOGHVDUUROORH[LWRVRGHXQDLQIHFFLyQ
SURGXFWLYD\DTXHpVWDUHTXLHUHDGHPiVGHRWURVIDFWRUHVLQWUDFHlulares cuya presencia determina la permisividad celular respecto
a un virus dado. La capacidad de un virus de invadir y replicar en
un tipo celular particular se denomina tropismo celular o tisular.
Luego de la unión al receptor, el virus debe atravesar la membraQDSODVPiWLFDSDUDLQLFLDUVXUHSOLFDFLyQ(QHOFDVRGHORVYLUXV
envueltos, la penetración viral puede ocurrir por fusión a nivel de
ODPHPEUDQDSODVPiWLFDRSRUHQGRFLWRVLVPHGLDGDSRUreceptor y
ambos mecanismos involucran un proceso de fusión de membranas.
En el caso de los virus que entran por fusión a nivel de la memEUDQDSODVPiWLFDODXQLyQDOreceptor provoca cambios conformacionales en las espículas glicoproteicas virales que conducen a la
IXVLyQGHODHQYROWXUDYLUDOFRQODPHPEUDQDSODVPiWLFD'LFKD
fusión es mediada por una glicoproteína denominada proteína de
fusión que puede ser o bien la misma glicoproteína viral que actúa
como anti-receptor o bien otra glicoproteína integral de la envoltuUD(VWHSURFHVRGHIXVLyQGHPHPEUDQDVXWLOL]DGRSRUHMHPSORSRU
los SDUDP\[RYLUXVORVKHUSHVYLUXV\DOJXQRVretrovirus como HIV,
HVLQGHSHQGLHQWHGHOS+\FRQGXFHDODOLEHUDFLyQGHODQXFOHRFiSVLGHRGHODFiSVLGHYLUDOHQHOLQWHULRUGHOFLWRSODVPD
2WURVYLUXVHQYXHOWRVFRPRUKDEGRYLUXVLQÀXHQ]DYLUXV\DUHQDYLUXVTXHSUHVHQWDQXQDDFWLYLGDGGHIXVLyQGHSHQGLHQWHGHS+iFLGR
luego de la unión al receptor son incorporados a la célula a través de un
PHFDQLVPRGHHQGRFLWRVLV )LJXUD 'LIHUHQWHVYLUXVSXHGHQXWLOLzar distintas vías endocíticas, ya sea endocitosis mediada por clatrina,
SRUFDYHRODRPDFURSLQRFLWRVLV(QODUXWDHQGRFtWLFDTXHKDVLGRPiV
estudiada hasta el momento, las partículas virales son internalizadas
en vesículas recubiertas por la proteína clatrina y luego transportadas
DORVHQGRVRPDV(OS+iFLGRHQHOLQWHULRUGHORVHQGRVRPDVLQGXFH
cambios en la conformación de las espículas glicoproteicas de la envolWXUDYLUDOH[SRQLpQGRVHUHJLRQHVKLGURIyELFDVGHODSURWHtQDGHIXVLyQ
TXHVHUiODUHVSRQVDEOHGHPHGLDUODIXVLyQHQWUHODHQYROWXUDYLUDO\OD
membrana endosomal que lleva a la pérdida de la envoltura viral.
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
48
Adsorción
Penetración
Replicación del
genoma viral
Desnudamiento
Transcripción
Núcleo
Traducción
Ensamblaje
Liberación
Figura 2.1. Aspectos generales del ciclo de replicación de un virus tomando como modelo un virus envuelto con genoma RNA
cuya replicación transcurre en el citoplasma celular.
Con respecto a los virus desnudos, en la mayoría de los casos la incorporación de las partículas virales ocurriría mediante
un mecanismo de endocitosis mediada por receptor. Sin embargo,
SDUDSROLRYLUXVH[LVWHQHYLGHQFLDVTXHLQGLFDQTXHODLQWHUDFFLyQ
de este virus con su receptor PVr, una proteína de la superfamilia
de las inmunoglobulinas, lleva a rearreglos en la conformación de
ODSDUWtFXODYLUDO\DXQDXPHQWRGHVXKLGURIRELFLGDG\D¿QLGDG
SRUODVPHPEUDQDV(VWDVDOWHUDFLRQHVFRQGXFLUtDQ¿QDOPHQWHDOD
IRUPDFLyQGHSRURVHQODPHPEUDQDSODVPiWLFDSHUPLWLHQGRODLQcorporación del RNA viral al citoplasma de la célula.
2.3 DESNUDAMIENTO
/DSpUGLGDGHODFXELHUWDH[WHUQDYLUDO HQYROWXUDRFiSVLGH VHFRnoce como proceso de desnudamiento y es imprescindible para la
SRVWHULRUH[SUHVLyQGHORVJHQHVYLUDOHV$H[FHSFLyQGHORVYLUXV
con genoma RNA simple cadena de polaridad positiva, el desnuGDPLHQWRQRLPSOLFDODOLEHUDFLyQGHOiFLGRQXFOHLFRGHVQXGRHQ
el interior de la célula sino que el mismo permanece íntimamente
DVRFLDGRDDOJXQDVSURWHtQDVYLUDOHVFRQIRUPDQGRFRPSOHMRVQXcleoproteicos.
El desnudamiento puede ocurrir durante la penetración a nivel
GHODPHPEUDQDSODVPiWLFD SROLRYLUXVRYLUXVHQYXHOWRVFRPRpaUDP\[RYLUXV\+,9 RDQLYHOGHYHVtFXODVHQGRVRPDOHVHVGHFLU
VXEVHFXHQWHPHQWHDODLQWHUQDOL]DFLyQGHODSDUWtFXODYLUDO )LJXUD
(VWH~OWLPRFDVRHVHOGHYLUXVHQYXHOWRVFRPRUKDEGRYLUXV
LQÀXHQ]DYLUXVRDUHQDYLUXV\YLUXVGHVQXGRVTXHDQWHODH[SRVLFLyQ
DOS+iFLGRGHHVWDVYHVtFXODVLQWUDFHOXODUHVVXIUHQDOWHUDFLRQHVHQOD
FRQIRUPDFLyQGHODVSURWHtQDVGHFiSVLGHTXHSURYRFDUtDQODOLVLVR
permeabilización de la membrana endosomal, permitiendo la traslocación del material genético al citoplasma.
Una mención aparte merecen los virus cuyo desnudamiento ocurre a nivel de los poros de la membrana nuclear como herpesvirus y
adenovirus. Luego de la pérdida de envoltura durante la penetración
SRUIXVLyQDQLYHOGHODPHPEUDQDSODVPiWLFDHQHOFDVRGHKHUSHVvirus, o de la liberación de partículas virales parcialmente desensamEODGDVDSDUWLUGHORVHQGRVRPDVHQHOFDVRGHDGHQRYLUXVODFiSVLGH
YLUDOOLEHUDGDHQHOFLWRSODVPDHVWUDQVSRUWDGDKDFLDHOFRPSOHMRGHO
poro nuclear a través del que se produciría el ingreso del genoma
viral al núcleo de la célula.
2.4 EXPRESIÓN Y REPLICACIÓN DEL GENOMA
Los procesos de biosíntesis intracelular de macromoléculas virales
comprenden:
ODexpresión del genoma a través de la síntesis de las proteínas
virales, para lo que previamente deben generarse los corresponGLHQWHV51$PHQVDMHURV 51$P ODreplicación del genoma viral a través de la síntesis de moléFXODVSURJHQLHGHOiFLGRQXFOHLFRYLUDO
En general, las variaciones que se observan en los mecanismos
para desarrollar estos procesos biosintéticos dependen fundamentalmente de las características del genoma viral, y en base a ello,
VHSXHGHQDJUXSDUWRGRVORVYLUXVHQWUHVJUDQGHVFDWHJRUtDV YLUXVFRQJHQRPDD'1$ YLUXVFRQJHQRPDD51$ YLUXV
con transcripción inversa. En todos los casos, los mecanismos para
llevar a cabo la biosíntesis han debido respetar las restricciones
que la célula impone para la utilización de su maquinaria en dos
DVSHFWRVEiVLFRV3RUXQODGRORVYLUXVGHEHQH[SUHVDU51$PTXH
sean traducibles a proteínas por el sistema celular, es decir, RNAm
PRQRFLVWUyQLFRV$GHPiVGHDFXHUGRDODPD\RURPHQRUXWLOL]Dción de las diferentes enzimas celulares por parte de los virus, los
SURFHVRVGHWUDQVFULSFLyQ\UHSOLFDFLyQGHOJHQRPDYLUDOWHQGUiQ
lugar en el núcleo o el citoplasma.
2.4.1 Virus con genoma a DNA
Dado que el DNA es el material genético de la célula eucariótica, no es
sorprendente que la mayoría de los virus con genoma a DNA usen en
JUDQPHGLGDODPDTXLQDULDHQ]LPiWLFDFHOXODUSDUDH[SUHVDU\UHSOLFDU
su genoma y que los mecanismos con que ocurren estos eventos sean
en muchos casos réplicas de los que normalmente realiza la célula.
Asimismo, hay una amplia mayoría de virus con DNA de cadena doble
'1$FG \VyORXQDVSRFDVHVSHFLHVGHYLUXVFRQJHQRPD'1$GH
FDGHQDVLPSOH '1$FV Para los virus que portan un genoma a DNA cd, como herpesvirus,
adenovirus, papillomavirus y polyomavirus, siempre el primer paso es
la transcripción, es decir la síntesis de RNAm subgenómicos, a partir de
FDGDXQRGHORVFXDOHVVHYDDVLQWHWL]DUXQDSURWHtQDYLUDO )LJXUD
*UXSR, (QODPD\RUtDGHORVFDVRVODWUDQVFULSFLyQQRHVVLPXOWiQHD
SDUDWRGRVORVJHQHVVLQRTXHRFXUUHVHFXHQFLDOPHQWHSULPHURVHWUDQV-
Capítulo 2 / Replicación viral
FULEHQORVJHQHVOODPDGRVWHPSUDQRVTXHFRGL¿FDQSDUDSURWHtQDVQR
estructurales, generalmente enzimas requeridas luego para la replicación
del DNA y otras proteínas que pueden inducir diferentes fenómenos en
la célula hospedera. La transcripción tardía abarca a los genes que corresponden a las proteínas estructurales, es decir, las que conforman la
FiSVLGH\HQYROWXUDYLUDO(QWUHDPEDVURQGDVGHWUDQVFULSFLyQVXHOH
ocurrir la replicación del DNA viral. En general, la síntesis de RNAm
virales es catalizada por la RNA polimerasa II celular, mientras que la
UHSOLFDFLyQGHO'1$YLUDOHVWiDFDUJRGHXQD'1$SROLPHUDVDSURSLD
del virus. Dada la localización nuclear de la RNA polimerasa II, ambos
procesos transcurren en el núcleo, hacia donde debe migrar el genoma viUDOOXHJRTXHHVOLEHUDGRHQHOFLWRSODVPD8QDH[FHSFLyQODFRQVWLWX\HQ
los SR[YLUXVTXHUHDOL]DQWRGRVXSURFHVRGHELRVtQWHVLVHQHOFLWRSODVPD
por lo que deben aportar no sólo su propia DNA polimerasa sino también
una RNA polimerasa para sintetizar los RNAm.
Los virus con genoma a DNA cs, que incluyen parvovirus y
circovirus, primero pasan a DNA cd sintetizando la cadena complementaria y luego, a partir de este DNA cd, sintetizan sus RNAm,
SDUDH[SUHVDUODVSURWHtQDVFRUUHVSRQGLHQWHVFRPRDVtWDPELpQODV
FDGHQDVGH'1$JHQyPLFR )LJXUD*UXSR,, (VWRVYLUXVWLHQHQXQJHQRPDPX\SHTXHxRGRQGHVyORVHH[SUHVDQJHQHV
no presentan regulación temporal de la transcripción, y, al igual que
los virus a DNA cd de menor tamaño genómico, son altamente dependientes de la célula hospedera pues en general sólo multiplican
en células en proceso de división activa. Por el contrario, los virus
D'1$JUDQGHVTXHSRVHHQDOUHGHGRUGHJHQHVSXHGHQ
UHSOLFDUHQFpOXODVTXHQRHVWiQHQGLYLVLyQSXHVDSRUWDQXQDDPSOLDYDULHGDGGHHQ]LPDVSDUDJHQHUDUORVSUHFXUVRUHVGHVXViFLGRV
nucleicos.
49
ambisentido, los arenavirus y los bunyavirus, que tienen un genoma
con una región de polaridad positiva y una región de polaridad negativa. Sin embargo, estos virus son considerados dentro del grupo de
virus RNA de polaridad negativa, porque su estrategia es similar a
los RNA -, ya que el primer evento de biosíntesis es la transcripción
de RNAm.
Los virus con genoma RNA cd también tienen asociada al genoma la RNA polimerasa RNA dependiente, que transcribe RNAm
DSDUWLUGHXQDGHODVKHEUDVGHOJHQRPD )LJXUD*UXSR9
HMHPSORUHRYLUXV (VWH51$POXHJRGHVHUWUDGXFLGRHVWDPELpQ
utilizado como templado para originar las moléculas de RNA cd
genómicas.
Dado que los virus con genoma de RNA no utilizan las enzimas celulares para transcripción y/o replicación de sus genomas,
realizan su ciclo de multiplicación íntegramente en el citoplasma
celular. Los virus de LQÀXHQ]DVRQODH[FHSFLyQDHVWDVLWXDFLyQ\D
que los RNA virales son transportados al núcleo porque requieren
de la maquinaria de transcripción y procesamiento de la célula para
sintetizar sus RNAm.
2.4.3 Virus con transcripción inversa
Dentro de los virus con capacidad de infectar células animales hay
dos familias en las que hay una etapa de transcripción inversa es
decir la síntesis de una cadena de DNA a partir de un templado
de RNA catalizada por la enzima transcriptasa inversa viral. Estas
familias son Retroviridae y Hepadnaviridae y a pesar de tener un
JHQRPDGH51$\'1$UHVSHFWLYDPHQWHVHODVFODVL¿FDHQIRUPD
VHSDUDGDGHORVJUXSRVDQWHULRUHV )LJXUD*UXSRV9,\9,, El genoma de los retrovirus es diploide, formado por dos hebras idénticas de RNA de polaridad positiva, pero este RNA no se
H[SUHVDGLUHFWDPHQWHFRPR51$P(OYLULyQSRUWDODtranscrip2.4.2 Virus con genoma a RNA
Dentro del grupo de los virus con genoma a RNA se da la situación tasa inversa que sintetiza una cadena de DNA complementaria al
inversa a la descrita para los virus con DNA: los virus con RNA de 51$JHQyPLFRSURFHVRLQYHUVRMXVWDPHQWHDOGHODWUDQVFULSFLyQ
FDGHQDVLPSOH 51$FV VRQPD\RULWDULRVIUHQWHDORVGH51$FDGHQD celular. El RNA genómico del híbrido RNA-DNA es luego deGREOH 51$FG 7DQWRODWUDQVFULSFLyQFRPRODUHSOLFDFLyQGHHVWRV gradado por una ribonucleasa viral, y se sintetiza la hebra comgenomas implican la síntesis de una hebra de RNA sobre un templado plementaria de DNA. Así se genera una molécula de DNA doble
de RNA, la enzima para catalizar este proceso es una RNA polimerasa cadena que se dirige al núcleo celular y mediante una integrasa
51$GHSHQGLHQWHTXHQRH[LVWHHQODFpOXODHXFDULyWLFDSRUORTXH aportada por el virus se integra al cromosoma celular, donde se
mantiene en una forma estable denominada provirus. El provirus
VLHPSUHGHEHVHUREOLJDWRULDPHQWHFRGL¿FDGDSRUHOYLUXV
/RVYLUXVFRQJHQRPD51$FVKDQVLGRFODVL¿FDGRVGHDFXHUGR HVH[SUHVDGRFRPRXQJHQFHOXODUSRUODRNA polimerasa II de
DODUHODFLyQTXHH[LVWHHQWUHODFDGHQDGH51$JHQyPLFR\ODFDGH- la célula y así se originan nuevas moléculas de RNA viral, que
na de RNAm, propuesta efectuada por Baltimore hace casi cuatro VLUYHQFRPR51$PSDUDH[SUHVDUODVSURWHtQDVYLUDOHV\FRPR
décadas y que aún se mantiene vigente. Hay dos posibilidades: que genomas para formar los nuevos viriones.
Por el contrario, los hepadnavirus, entre los que se destaca el
el RNA genómico tenga la secuencia del RNAm o que, por el contrario, que el RNA genómico tenga la secuencia complementaria virus hepatitis B, tienen un genoma formado por dos cadenas de
DO51$P7RPDQGRODFRQYHQFLyQGHDVLJQDUSRODULGDGSRVLWLYD '1$GHGLVWLQWDORQJLWXGXQDPD\RU OD/GHOLQJOpVlarge \RWUD
al RNAm, aquellos virus cuyo genoma es directamente el RNAm GHPHQRUWDPDxR 6GHOLQJOpVsmall ODVTXHDODSDUHDUVHHQODV
VHGHQRPLQDQYLUXV51$GHSRODULGDGSRVLWLYD RNA+ \ORVTXH regiones complementarias originan una estructura cadena doble parposeen la secuencia complementaria al RNAm son virus RNA de FLDO '1$FGS (OFLFORGHUHSOLFDFLyQLQWUDFHOXODUFRPLHQ]DFRQ
la reparación de las dos cadenas incompletas de manera tal que se
SRODULGDGQHJDWLYD RNA – /RVYLUXV51$ HMHPSORVSLFRUQDYLUXVÀDYLYLUXVWRJDYLUXV RULJLQDXQDFDGHQDGREOHGH'1$FRPSOHWD '1$FGF)LJXUD
y FRURQDYLUXV GLUHFWDPHQWHVLQWHWL]DQWRWDORSDUFLDOPHQWHVXV *UXSR9,, (VWH'1$FGFPLJUDDOQ~FOHRGRQGHDGLIHUHQFLDGH
SURWHtQDVFRPRSULPHUDHWDSDGHELRVtQWHVLVLQWUDFHOXODU )LJXUD los retrovirus no se integra al cromosoma celular, sino que en forma
*UXSR,,, (QWUHHVWDVSURWHtQDVVHKDOODODRNA polimerasa de episoma libre es transcripto por la RNA polimerasa II celular
que va a catalizar la replicación del genoma, pasando primero a la a RNAm, y a partir del RNAm de mayor tamaño la transcriptasa
hebra complementaria, negativa, y luego a partir de ésta se copia inversa del virus sintetiza moléculas de DNA cdp, réplicas del gela cadena de RNA genómico. Esta síntesis de RNA siempre ocurre noma viral.
HQXQDHVWUXFWXUDTXHVHGHQRPLQDLQWHUPHGLDULRUHSOLFDWLYR ,5 HQODTXHVREUHXQDFDGHQDGH51$VHYDQFRSLDQGRVLPXOWiQHD- 2.5 ENSAMBLAJE Y LIBERACIÓN
mente varias cadenas de RNA complementarias.
/RVYLUXV51$ )LJXUD*UXSR,9HMHPSORVUKDEGRYLUXV 8QDYH]TXHVHKDVLQWHWL]DGRGHQWURGHODFpOXODVX¿FLHQWHFDQWLGDG
P\[RYLUXV\SDUDP\[RYLUXV GHEHQSULPHURVLQWHWL]DU51$PSDUD GHSURWHtQDV\JHQRPDVYLUDOHVVHSDVDDODVHWDSDV¿QDOHVGHOFLFOR
SRGHUH[SUHVDUVHSRUORWDQWRODRNA polimerasa es siempre una de multiplicación, que consisten en el ensamblaje de los distintos
SURWHtQDFRQVWLWXWLYDGHOYLULyQTXHHVWiDVRFLDGDDOJHQRPD\FDWD- componentes para formar nuevas partículas virales y su posterior
liza la síntesis de los RNAm que son luego traducidos. A continua- liberación o salida a partir de la célula infectada.
ción ocurre a partir del RNA infectante la replicación del genoma,
La forma en que transcurren estos procesos va a depender de
por síntesis sucesiva de las dos cadenas complementarias, primero las FDUDFWHUtVWLFDVGHODFiSVLGH\GHODSUHVHQFLDRQRGHHQYROWXUD
la positiva y luego la negativa, en IR, al igual que en los virus RNA /DVFiSVLGHVLFRVDpGULFDVVHHQVDPEODQSRULQWHUDFFLyQHQWUHODV
+. Cabe acotar que hay dos familias de virus RNA cs denominadas distintas subunidades con total independencia de la síntesis del ge-
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
50
Grupo I
'1$FGĺ51$PĺSURWHtQDV
Ļ
DNA cd
Grupo II
'1$FVĺ'1$FGĺ51$PĺSURWHtQDV
Ļ
DNA cs
Grupo III
51$ĺSURWHtQDV
Ļ
RNA – (IR)
Ļ
RNA +
Grupo IV
51$±ĺ51$PĺSURWHtQDV
Ļ
RNA + (IR)
Ļ
RNA –
Grupo V
51$FGĺ51$PĺSURWHtQDV
Ļ
RNA cd
Grupo VI
51$ĺ'1$FG LQWHJUDFLyQ ĺ51$PĺSURWHtQDV
Ļ
RNA +
Grupo VII
'1$FGSĺ'1$FGFĺ51$PĺSURWHtQDV
Ļ
DNA cdp
Figura 2.2. Esquemas de los procesos de expresión y replicación genómica para los distintos grupos de virus. RNAm: RNA
PHQVDMHUR51$51$GHSRODULGDGSRVLWLYD51$51$GHSRODULGDGQHJDWLYDFGFDGHQDGREOHFVFDGHQDVLPSOH,5LQWHUPHGLDULR
UHSOLFDWLYRFGSFDGHQDGREOHSDUFLDOFGFFDGHQDGREOHFRPSOHWD
QRPD\HVDVtTXHSXHGHQGHWHFWDUVHHQODFpOXODLQIHFWDGDFiSVLGHV
YDFtDVTXHFDUHFHQGHiFLGRQXFOHLFRHQVXLQWHULRU(OJHQRPDVH
LQWURGXFHHQODFiSVLGHSUHDUPDGDDWUDYpVGHOUHFRQRFLPLHQWRHQWUHVHFXHQFLDVHVSHFt¿FDVGHOJHQRPDGHQRPLQDGDVVHFXHQFLDVGH
empaquetamiento, y algún dominio particular de una proteína de
ODFiSVLGH3RUHOFRQWUDULRHQORVYLUXVFRQFiSVLGHKHOLFRLGDOOD
FiSVLGHVHYDHVWUXFWXUDQGRSRUDJUHJDGRGHVXEXQLGDGHVSURWHLFDV
DOUHGHGRUGHOiFLGRQXFOHLFRYLUDODPHGLGDTXHpVWHVHYDVLQWHWLzando.
Por último, los virus envueltos adquieren su envoltura a través
de un proceso de brotación a partir de la membrana celular. La bicapa lipídica de la envoltura deriva totalmente de la membrana ceOXODUHQODTXHVHKDQLQVHUWDGRODVJOLFRSURWHtQDVFRGL¿FDGDVSRUHO
YLUXVIRUPDQGRODVHVStFXODVTXHVHSUR\HFWDQKDFLDHOH[WHULRU/D
membrana celular se regenera luego de la gemación de la partícula
viral, y de este modo la liberación de nuevos viriones se produce sin
causar daño a la célula. En general, los virus envueltos son los que
SXHGHQRULJLQDULQIHFFLRQHVSHUVLVWHQWHVMXVWDPHQWHSRUTXHWLHQHQ
esta capacidad de salir de la célula sin dañarla. Por el contrario, los
virus desnudos sólo pueden liberarse de la célula produciendo la
lisis de la misma.
2.6 CURVA DE CRECIMIENTO DE UN SOLO CICLO
La mayoría de los estudios de replicación de virus animales se han
realizado utilizando líneas celulares crecidas en monocapa o en suspensión. Para conocer las características de las distintas etapas de
la multiplicación de un virus se debería estudiar el desarrollo de la
Log Unidades infecciosas/ml
Capítulo 2 / Replicación viral
10000
1000
Virus
intracelular
100
10
Virus
extracelular
1
0,1
0
5
10
15
Horas pos-infección
eclipse
fase log
liberación
Adsorción
y penetración
latencia
Figura 2.3. Curva de un sólo ciclo de un virus desnudo.
infección producida por la infección de una única partícula viral en
una sola célula hospedera. Dado que el estudio de células infectadas
DLVODGDVHVSUiFWLFDPHQWHLPSRVLEOHVHUHFXUUHDODQiOLVLVGHODVFXUvas de crecimiento llamadas curvas de un solo ciclo. Estas curvas
se obtienen infectando al cultivo celular con una alta relación entre
el número de partículas virales infecciosas y el número de células
GHOFXOWLYRFRQHOREMHWRGHORJUDUXQDLQIHFFLyQVLQFUyQLFDHV
decir, que todas las células del cultivo sean infectadas de forma
51
VLPXOWiQHD\DVtHYLWDUODVLQIHFFLRQHVVHFXQGDULDVHVGHFLULQIHFciones de células con la progenie viral resultante del primer ciclo de
UHSOLFDFLyQ$GLVWLQWRVWLHPSRVSRVLQIHFFLyQVHFXDQWL¿FDODLQIHFWLYLGDG Q~PHURGHXQLGDGHVLQIHFFLRVDVPO DVRFLDGDDODVFpOXODV
GHOFXOWLYR YLUXVDVRFLDGRDFpOXODVRLQWUDFHOXODU \ODLQIHFWLYLGDG
SUHVHQWHHQHOPHGLRGHFXOWLYR YLUXVH[WUDFHOXODU El tipo de curva que generalmente se obtiene en el caso de un
YLUXVGHVQXGRVHPXHVWUDHQOD)LJXUD\UHVXOWDGHJUD¿FDUHO
WtWXORLQIHFFLRVRHQHVFDODORJDUtWPLFD ORJXQLGDGHVLQIHFFLRVDV
PO HQIXQFLyQGHOWLHPSR KRUDVSRVLQIHFFLyQ ,QPHGLDWDPHQWH
después de la infección, la infectividad inicialmente inoculada va
disminuyendo a medida que se suceden la penetración y el desnudamiento de las partículas virales. Llega un momento en que
no es posible detectar partículas virales infecciosas ni siquiera intracelularmente. Este período en que no es posible detectar virus
infeccioso se denomina eclipse\WLHQHVX¿QFXDQGRHPSLH]DDHYLdenciarse un incremento de la infectividad intracelular o asociada a
células. Los virus no envueltos maduran en el interior de la célula
donde la progenie viral se acumula, obteniéndose un incremento
H[SRQHQFLDOGHODLQIHFWLYLGDGLQWUDFHOXODU SHUtRGRGHFUHFLPLHQWR
H[SRQHQFLDORIDVHORJ $PHGLGDTXHHPSLH]DDSURGXFLUVHODOLVLV
de las células infectadas la progenie viral comienza a liberarse al
PHGLRH[WUDFHOXODU6HGHQRPLQDSHUtRGRGHlatencia al tiempo que
WDUGDHQGHWHFWDUVHLQIHFWLYLGDGH[WUDFHOXODU(QHVWRVtipos de virus,
TXHVHIRUPDQUiSLGDPHQWHSHURSHUPDQHFHQGXUDQWHODUJRWLHPSR
en el interior de la célula, el período de eclipse es mucho menor que
el de latencia.
Los virus que se liberan de la célula por brotación, a partir de la
PHPEUDQDSODVPiWLFDVRQLQIHFFLRVRVVyORGHVSXpVGHKDEHUDGTXLrido la envoltura y por lo general permanecen poco tiempo asociados
a las células como partículas infecciosas. Por lo tanto, la recuperación de la infectividad es mayor en el sobrenadante y los períodos
de eclipse y de latencia son similares. Otros virus envueltos que maduran en el interior de la célula, adquiriendo su envoltura a partir de
membranas intracelulares, presentan períodos de eclipse menores a
los de latencia, y en algunos casos suelen permanecer retenidos en
el interior de la célula, por lo que éstas deben ser rotas para lograr la
liberación completa de las partículas virales.
Bibliografía
‡
‡
&DQQ$-Principles of Molecular Virology. London: Academic Press,
)OLQW6-(QTXLVW/:.UXJ505DFDQLHOOR956NDOND$0Principles
of Virology:DVKLQJWRQ$603UHVV
‡
‡
.QLSH'0+RZOH\30Fundamental Virology)LODGHO¿D/LSSLQFRWW
:LOOLDPV :LONLQV
:DJQHU(.Basic Virology:LOOLQVWRQ%ODFNZHOO3XEOLVKLQJ
3
¿Cómo se estudian los virus?
Susana Mersich - Nélida Candurra
Los virus pueden estudiarse por SURFHGLPLHQWRV¿VLFRTXtPLFRVR
por aquellos que demuestren su interacción con las células vivas,
es decir, su capacidad infecciosa.
Los SURFHGLPLHQWRV ¿VLFRTXtPLFRV pueden detectar a los
YLUXVD FRPRSDUWtFXODVYLUDOHVSRUPLFURVFRSLDHOHFWUyQLFDE FRPRXQLGDGHVKHPDJOXWLQDQWHVSRUKHPDJOXWLQDFLyQF FRPRDQWtJHQRPHGLDQWHWpFQLFDVLQPXQRKLVWRTXtPLFDV\G FRPRiFLGRV
QXFOHLFRVPHGLDQWHWpFQLFDVPROHFXODUHV KLEULGDFLyQDPSOL¿FDFLyQJHQyPLFDRVHFXHQFLDFLyQ7DEOD Muchas de estas técnicas se emplean habitualmente para el diagnóstico virológico.
Las FDUDFWHUtVWLFDVGHODVSURWHtQDVYLUDOHV SHVRPROHFXODUSXQWR
LVRHOpFWULFRFRPSRVLFLyQFRQWHQLGRJOXFRVtGLFRHWF \GHORViFLGRV
QXFOHLFRVYLUDOHV SHVRPROHFXODUORQJLWXGSRODULGDGFRQWHQLGRHQ
JXDQLQDFLWRVLQD\VHFXHQFLDQXFOHRWtGLFD VHHVWXGLDQHQORVODERUDWRULRVGH9LURORJtDEiVLFD
Los estudios de infectividad son fundamentales tanto en ViURORJtDEiVLFDFRPRFOtQLFD(QHOSULPHUFDVRODFXDQWL¿FDFLyQGH
partículas infectivas en un inóculo es útil para controlar un proceso
GHSXUL¿FDFLyQ\DEVROXWDPHQWHQHFHVDULDFXDQGRVHHVWXGLDODUHplicación viral o las propiedades de un agente virucida. En el se- Figura 3.1. Microscopia electrónica. Tinción negativa de rotavigundo caso se utilizan los estudios de infectividad para determinar rus en materia fecal (80 000 X).
la presencia del virus viable en las muestras clínicas.
3URFHGLPLHQWRV¿VLFRTXtPLFRV
Detección de: - partículas virales
- antígenos virales
- ácidos nucleicos
Procedimientos para detección de infectividad:
Replicación en: - cultivos celulares
- animales de experimentación
- huevos embrionados
Tabla 3.1. Procedimientos para el estudio de los virus.
1. PROCEDIMIENTOS
FISICOQUÍMICOS
1.1 MICROSCOPIA ELECTRÓNICA: VISUALIZACIÓN Y ENUMERACIÓN DE
PARTÍCULAS VIRALES
El microscopio electrónico permite observar la morfología de las
partículas virales y se utiliza ampliamente en investigación, siendo
restringida su aplicación al GLDJQyVWLFR([LVWHQGRVWpFQLFDVEiVLcas: la microscopia de transmisión y la tinción negativa.
3DUDHOHVWXGLRGHSDUWtFXODVYLUDOHVHQWHMLGRV\FpOXODVLQIHFWDGDV
se emplea la microscopia electrónica de transmisión. Su poder de resolución permite observar estructuras moleculares como proteínas y
iFLGRVQXFOHLFRV6LQHPEDUJRORVKDFHVGHHOHFWURQHVTXHIRUPDQODV
LPiJHQHVGHODPXHVWUDWLHQHQHVFDVRSRGHUGHSHQHWUDFLyQ\QRSHUPLten la visualización directa de células aisladas ya que resulta demasiado
JUXHVD3RUHVHPRWLYRVHGHEHQ¿MDUORVWHMLGRVHQHVWXGLRPHGLDQWH
su inmersión en resinas epoxi\OXHJRHIHFWXDUFRUWHVXOWUD¿QRVFRQ
micrótomo. Después, las preparaciones se tiñen con sustancias que
SRVHHQiWRPRVSHVDGRVFDSDFHVGHGHVYLDUORVHOHFWURQHV\DXPHQWDU
HOFRQWUDVWH iFLGRyVPLFRVDOHVGHXUDQLRODQWDQRRSORPR Esta técnica permite el estudio de las etapas de la replicación
viral en las diferentes estructuras celulares y, asimismo, permite
observar las partículas virales que no demuestran una estructura
ELHQGH¿QLGDSRUODWpFQLFDGHWLQFLyQQHJDWLYD
1.1.1 Tinción negativa
(QDOJXQRVFDVRVSDUDHVWXGLDUODHVWUXFWXUDH[WHUQDGHORVYLUXVQR
HVQHFHVDULRSUHSDUDUODVPXHVWUDVFRPRVHLQGLFyHQHOSiUUDIRDQterior, pudiéndose observar a las partículas virales de modo directo
\UiSLGRFRPELQDQGRODmicroscopia electrónica de transmisión con
la técnica denominada tinción negativa. La misma consiste en mezclar la suspensión viral con un colorante de alta densidad electrónica
iFLGRIRVIRW~QJVWLFRRDFHWDWRGHXUDQLOR /DVSDUWtFXODVYLUDOHVQR
GLVSHUVDQHOKD]GHHOHFWURQHVSRUORTXHVHYHUiQFODUDVVREUHXQ
IRQGRRVFXURTXHGHOLQHDVXHVWUXFWXUD )LJXUD (OSURFHGLPLHQWR
HVUiSLGRSHURQHFHVLWDGHXQREVHUYDGRUH[SHULPHQWDGR\XQDFDQWLGDGGHSDUWtFXODVYLUDOHVPD\RUD por ml. Esta técnica permite
YLVXDOL]DUIiFLOPHQWHDORVYLUXVHQYXHOWRVTXHSXHGHQWHQHUHQYROWXUD
lisa o con espículas y a los virus icosaédricos que presentan estructuras FDUDFWHUtVWLFDV SRUHMHPSORURWDYLUXVIRUPDGHUXHGDDGHQRYLUXVLFRVDpGULFRGHVQXGR (QFDPELRORVYLUXVGHWDPDxRPHGLR
SDSLORPDYLUXV \ORVSHTXHxRV FDOLFLYLUXV VHYLVXDOL]DQSHURQRVH
LGHQWL¿FDQFODUDPHQWH$TXHOORVGHWDPDxRPX\SHTXHxR SLFRUQDYLUXV\SDUYRYLUXV VHREVHUYDQFRPRSDUWtFXODVERUURVDV
Las aplicaciones de la tinción negativa para el diagnóstico
UiSLGRVRQD GLIHUHQFLDUHQPXHVWUDVFOtQLFDVDORVKHUSHVYLUXV
KHUSHV VLPSOH[ YDULFHOD GH ORV SR[YLUXV YLUXHOD YDFFLQLD debido a las características morfológicas diferenciales de ambas
IDPLOLDV\E HVWXGLDUODVGLDUUHDVYLUDOHV\DTXHHQPXHVWUDV
GHPDWHULDIHFDOSXHGHQLGHQWL¿FDUVHIiFLOPHQWHORVURWDYLUXV
adenovirus, calicivirus, etc.
1.1.2 Inmunomicroscopia electrónica
El empleo de un inmunosuero con DQWLFXHUSRVHVSHFt¿FRVFRQWUD
DQWtJHQRVVXSHU¿FLDOHVGHXQYLUXVSRUHMHPSORHODQWtJHQRGHVXSHU¿FLHGHOYLUXVKHSDWLWLV% +%V$J SHUPLWHDJOXWLQDUODVSDUWtculas virales. Esta técnica, que combina una reacción inmune con
54
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
la microscopia electrónica se denomina inmunomicroscopia electrónica. Para realizarla, se incuba la suspensión viral con el inmunosuero, se realiza la tinción negativa y se observan al microscopio
electrónico las partículas virales agregadas.
En otros casos, se concentra previamente la muestra sobre la
grilla utilizando DQWLFXHUSRVGHFDSWXUDRSURWHtQD$OXHJRVHLQFXEDFRQXQLQPXQRVXHURHVSHFt¿FR\SRU~OWLPRVHUHDOL]DODWLQFLyQ
negativa.
1.1.3 Recuento de partículas
/DVSDUWtFXODVYLUDOHVSXHGHQLGHQWL¿FDUVHFRQHOPLFURVFRSLRHOHFtrónico, aunque no es posible distinguir entre partículas infecciosas
\QRLQIHFFLRVDV3DUDFXDQWL¿FDUHOQ~PHURGHSDUWtFXODVODWpFQLFD
PiVHPSOHDGDHVPH]FODUODVXVSHQVLyQYLUDOFRQXQDFRQFHQWUDFLyQ
FRQRFLGDGHSDUWtFXODVGHOiWH[/XHJRVHFXHQWDQFRQHOPLFURVFRSLRHOHFWUyQLFRODVSDUWtFXODVYLUDOHV\ODVGHOiWH[\VHGHWHUPLQD
PHGLDQWHXQVLPSOHFiOFXORHOWtWXORGHYLUXVHQXQLGDGHVGHSDUWtculas virales por mililitro.
Otra técnica consiste en ultra-centrifugar sobre una grilla un
volumen conocido de la suspensión viral y luego contar todas las
partículas sedimentadas sobre la grilla.
1.2 DETECCIÓN DE PARTÍCULAS VIRALES POR HEMAGLUTINACIÓN
Algunas familias de virus poseen la capacidad de aglutinar glóbulos
URMRVGHGLYHUVDVHVSHFLHVDQLPDOHV(VWDSURSLHGDGGHVFXELHUWD
HQSRU+LUVW0F&OHOODQG\+DUFSDUDHOYLUXVLQÀXHQ]D Orthomyxoviridae HVXWLOL]DGDSDUDFXDQWL¿FDUYLUXV
Muchos virus de las familias Orthomyxoviridae y ParamyxoviridaeSRVHHQJOLFRSURWHtQDVHQODVHVStFXODVGHVXHQYROWXUD hemaglutininas) TXHSXHGHQDJOXWLQDUHULWURFLWRVORVYLUXVGHODIDPLOLDAdenoviridae DJOXWLQDQHULWURFLWRVPHGLDQWHORVFRQVWLWX\HQWHVGHVXFiSVLGH
Aunque las condiciones en que se produce la hemaglutinación
YDUtDQSDUDORVGLVWLQWRVYLUXVHOIHQyPHQREiVLFRHVODXQLyQGHODV
moléculas de hemaglutinina viral a receptores mucoproteicos presenWHVHQORVJOyEXORVURMRV )LJXUD 6LODFRQFHQWUDFLyQGHYLUXVHV
VX¿FLHQWHVHIRUPDUiQP~OWLSOHVSXHQWHVHQWUHHOORV\ORVHULWURFLWRV
\ORVDJUHJDGRVGHJOyEXORVVHGHSRVLWDUiQHQIRUPDGHUHWtFXORTXH
puede visualizarse en el fondo del tubo. El borde de este depósito
tiene una forma de sierra característica. En cambio, los eritrocitos
TXHQRIXHURQDJOXWLQDGRVVHGHSRVLWDUiQHQIRUPDGHERWyQ )LJXUD
+DELWXDOPHQWHVHUHDOL]DQGLOXFLRQHVDOPHGLRGHODVXVSHQVLyQ
viral, la que se mezcla con cantidad conocida de eritrocitos. El título
hemaglutinante es la inversa de la última dilución que presenta hemaglutinación completa.
/RVUHFHSWRUHVSUHVHQWHVHQORVJOyEXORVURMRV\DTXHOORVTXH
se encuentran en las células del tracto respiratorio, permitiendo la
DGVRUFLyQGHORVPL[RYLUXV\SDUDPL[RYLUXVVRQPXFRSURWHtQDVTXH
FRQWLHQHQiFLGR1DFHWLOQHXUDPtQLFR 1$1$ (VWRVUHFHSWRUHVVRQ
LQDFWLYDGRVHQIRUPDHVSHFt¿FDSRUODHQ]LPDneuraminidasa que
cliva el NANA y, por lo tanto, separa los viriones del eritrocito. Este
IHQyPHQRVHGHQRPLQDHOXFLyQ\RFXUUHDž&3RUHOFRQWUDULRD
ž&ODHQ]LPDQRDFW~D\ODXQLyQGHOYLULyQDORVJOyEXORVURMRVHV
estable. Los virus eluidos pueden volver a aglutinar otros eritrocitos
pero los eritrocitos eluidos no pueden volver a ser aglutinados ya que
su receptor ha sido destruido por la neuraminidasa. Por esta razón,
esta enzima se llama enzima destructora de receptores.
(Q PXFKRV OtTXLGRV ELROyJLFRV VXHUR RULQD VDOLYD HVWiQ
presentes mucoproteínas con residuos terminales de NANA que
pueden unirse a las hemaglutininas virales inhibiendo competitivamente la hemaglutinación. Por ello, es importante el tratamiento
de las muestras de suero antes de la realización de esta técnica para
GHVWUXLUDORVLQKLELGRUHVLQHVSHFt¿FRVGHODXQLyQYLUXVHULWURFLWR
El tratamiento se realiza incubando con neuraminidasa o bien con
SHU\RGDWRGHVRGLRTXHR[LGDORVJUXSRVJOLFROHVGHOD]~FDU
1.2.1 Reacción de inhibición de la hemaglutinación
Si se hace reaccionar un virus con capacidad hemaglutinante
FRQVXDQWLFXHUSRHVSHFt¿FRpVWHDQXODUiVXFDSDFLGDGGHKH-
Figura 3.2. Esquema de hemaglutinación viral. GR: JOyEXORURMR
9YLULyQGHRUWKRP\[RYLUXV+$KHPDJOXWLQLQDYLUDO1$QHXUDPLQLGDVD
maglutinación por bloqueo de las hemaglutininas presentes en
la envoltura del virión. Este fenómeno se denomina inhibición
de la hemaglutinación\HVXWLOL]DGRWDQWRSDUDLGHQWL¿FDU\WLSL¿FDUYLUXVFRPRSDUDGHWHUPLQDUODSUHVHQFLDGHanticuerpos
HVSHFt¿FRVLQKLELGRUHVGHODKHPDJOXWLQDFLyQHQORVVXHURVGH
los pacientes.
1.3 PROTEÍNAS VIRALES
/DVSURWHtQDVSUHVHQWHVHQORVYLULRQHVSXUL¿FDGRVVHGHQRPLQDQ
HVWUXFWXUDOHVPLHQWUDVTXHDTXHOODVTXHVRQFRGL¿FDGDVSRUHOYLUXV
\HVWiQSUHVHQWHVVyORGXUDQWHHOFLFORGHUHSOLFDFLyQVHGHQRPLQDQ
SURWHtQDVQRHVWUXFWXUDOHV$GHPiVORVYLUXVHQYXHOWRVFRQWLHQHQHQ
su envoltura proteínas provenientes de la célula donde replicaron.
Es importante la caracterización de ambos tipos de proteínas, estructurales y no estructurales, cuando se quieren preparar reactivos
inmunológicos tales como anticuerpos monoclonales, estudiar algunas enzimas como posibles blancos DQWLYLUDOHVPRGL¿FDURDGDSWDU
una proteína para ser usada en biotecnología, etc.
La caracterización de las proteínas virales requiere una previa
concentración del virus por alguna técnica, como la de precipitación. Asimismo, cuando se quiere aislar y caracterizar una proteína
estructural, es importante disponer de partículas virales separadas
de los componentes celulares, lo que se consigue a través del uso
de gradientes de densidad en sacarosa y ultracentrifugación. Los viriones pueden romperse con detergente, de manera que sus componentes se solubilicen en el medio acuoso. El agregado de nucleasas,
TXHGLJLHUHQHOiFLGRQXFOHLFRSHUPLWHHVWXGLDUODVSURWHtQDVTXHVH
DQDOL]DQPHGLDQWHHOHFWURIRUHVLV/DFDUDFWHUL]DFLyQ¿VLFRTXtPLFD
GHODVSURWHtQDVLQFOX\HODGHWHUPLQDFLyQGHVXSHVRPROHFXODU SRU
HOHFWURIRUHVLV¿OWUDFLyQSRUJHORXOWUDFHQWULIXJDFLyQ DVtFRPRVX
carga y tamaño.
La difracción de rayos X de cristales de proteínas da detalle de
su conformación tridimensional y de la interacción tanto de péptidos como de hidratos de carbono, si estos últimos estuvieran presentes.
3RUHMHPSORSDUDDQDOL]DUODVSURWHtQDVGHODFiSVLGHGHOYLUXV
SROLRORVYLULRQHVSXUL¿FDGRVVHVROXELOL]DQHQXQDVROXFLyQWDPponada y se separan con dodecilsulfato de sodio. Cada proteína
PLJUDUiHQXQJHOGHSROLDFULODPLGDGHDFXHUGRDVXWDPDxRSXdiéndose determinar la masa de cada banda con respecto al total
GHODVPLVPDV$VtVHREVHUYDTXHODVFXDWURSURWHtQDV9393
93\93HVWiQHQFDQWLGDGHVHTXLPROHFXODUHV
La técnica de Western Blot se usa para estudiar antígenos virales
presentes en suspensiones virales o en células infectadas, así como
también para detectar DQWLFXHUSRVHVSHFt¿FRVSUHVHQWHVHQHOVXHUR
del paciente.
Capítulo 3 / ¿Cómo se estudian los virus?
55
Figura 3.3. Lectura de una reacción de hemaglutinación./DOHFWXUDHVYLVXDO\ODLQYHUVDGHOD~OWLPDGLOXFLyQTXHSUHVHQWDKHPDJOXWLQDFLyQFRPSOHWDFRUUHVSRQGHDOWtWXORKHPDJOXWLQDQWH
La eventual detección de DNA o RNA puede también hacerse
VLQIUDFFLRQDPLHQWRHOHFWURIRUpWLFRGHQRPLQiQGRVHVHJ~QHOtipo
GHLPDJHQREWHQLGD UHÀHMRGHODVLHPEUDUHVSHFWLYDGHiFLGRVQXcleicos según el WLSRGHDSDUDWRXWLOL]DGR OXHJRGHODhibridación,
un Dot blot PDQFKDFRQDVSHFWRGHXQSXQWR RSlot blot PDQFKD
FRQDVSHFWRGHXQDUDQXUDUHFWDQJXODU Las técnicas mencionadas son de detección cualitativa o –como
SRUHMHPSORHQHOFDVRGHOSlot blot– pueden también ser semiFXDQWLWDWLYDV(QHVWH~OWLPRFDVRVHSXHGHH[SUHVDUODSUHVHQFLD
GHiFLGRVQXFOHLFRVHQQJRSJGH'1$R51$SRUPOGHPXHVWUD
R—JGHWHMLGR
/DVWpFQLFDVGHDPSOL¿FDFLyQGHiFLGRVQXFOHLFRVFRPSUHQGHQ
ODVGHQRPLQDGDVWpFQLFDVGHDPSOL¿FDFLyQGHODVHFXHQFLDEODQFR
como la 3&5 HQLQJOpVPolymerase Chain ReactionUHDFFLyQHQ
FDGHQDGHODSROLPHUDVD HO1$6%$ nucleic acid sequence based
DPSOL¿FDWLRQDPSOL¿FDFLyQEDVDGDHQVHFXHQFLDVGHiFLGRQXFOHLFR u otras menos utilizadas.
La PCR acoplada previamente a una reacción de transcripción
inversa se utiliza para detectar RNA. La reacción de 3&5 ROD
de 573&5 QRVyORHVDOWDPHQWHHVSHFt¿FDVLQRTXHH[KLEHXQD
H[WUDRUGLQDULDVHQVLELOLGDG3RUHVWHGHVFXEULPLHQWRGH.DU\
0XOOLVUHFLELyHOSUHPLR1REHOGH4XtPLFDDxRVPiVWDUGH0iV
recientemente, se han incorporado múltiples variantes a dicha reacción que pueden ser aplicadas para incrementar la sensibilidad
GREOHPCR con cebadores internos, como la PCR anidada o Nested
3&5 7DPELpQHVIDFWLEOHODFXDQWL¿FDFLyQJHQyPLFDPHGLDQWHOD
utilización de una 3&5 R573&5 FRPSHWLWLYDFRQXWLOL]DFLyQ
de secuencias de DNA templado usadas como controles internos
SUHYLDPHQWHFXDQWL¿FDGRV
En los últimos años, se ha añadido una nueva tecnología conocida con la denominación de PCR en tiempo real, la que es utili1.4 LOS ÁCIDOS NUCLEICOS: TÉCNICAS DE HIBRIDACIÓN,
]DGDWDQWRSDUDODFXDQWL¿FDFLyQGHOPDWHULDOJHQpWLFRFRPRSDUD
PCR Y SECUENCIAMIENTO NUCLEOTÍDICO
ODHYHQWXDOGHWHFFLyQGHSROLPRU¿VPRVHQSRVLFLRQHVJHQyPLFDV
/DGHWHFFLyQGHiFLGRVQXFOHLFRVHQPXHVWUDVFOtQLFDVSXHGHUHDOL- previamente determinadas para su investigación mediante sondas
zarse mediante diversas técnicas, que pueden ser cualitativas, semi- complementarias a determinadas secuencias nucleotídicas. Esta
cuantitativas o cuantitativas. A su vez, las mismas pueden realizarse técnica de PCR se denomina en tiempo real, ya que el producto
SUHYLDH[WUDFFLyQGHORViFLGRVQXFOHLFRVDSDUWLUGHXQÀXLGRR sintetizado en cada ciclo es monitoreado mediante registros que son
WHMLGRRELHQin situ(VWD~OWLPDDOWHUQDWLYDSHUPLWHLGHQWL¿FDUODV FDSWXUDGRVFRQSURJUDPDVLQIRUPiWLFRVDGHFXDGRV
FpOXODVTXHH[KLEHQHOiFLGRQXFOHLFRHQFXHVWLyQORTXHHVGHHV- /RViFLGRVQXFOHLFRVDVXYH]SXHGHQVHUFDUDFWHUL]DGRVPHdiante técnicas especialmente diseñadas a tal efecto. Entre ellas mepecial relevancia en estudios de patogénesis molecular.
$VtODVWpFQLFDVGH%LRORJtD0ROHFXODUDSOLFDGDVDORViFLGRVQX- rece mencionarse una técnica también descubierta por Southern,
FOHLFRVLQYROXFUDQEiVLFDPHQWHGRVWLSRVD WpFQLFDVGHhibridación la 5)/3 HQLQJOpVRestriction Fragment Length Polymorphism, o
SROLPRU¿VPRGHODORQJLWXGGHORVIUDJPHQWRVGHUHVWULFFLyQ FDSD]
VLQDPSOL¿FDFLyQ\E WpFQLFDVGHDPSOL¿FDFLyQ
Entre las primeras deben mencionarse las que se emplean para la de detectar mediante enzimas de restricción de tipo II secuencias
detección de DNA previo fraccionamiento electroforético, seguido JHQyPLFDVGH'1$EODQFRORTXHVHUHÀHMDHQIUDJPHQWRVGH'1$
de transferencia a un soporte sólido de nitrocelulosa o nylon, e hi- de diferente tamaño que migran diferencialmente en una corrida
EULGDFLyQFRQXQDVRQGDPDUFDGD FRQPDWHULDOUDGLDFWLYRRQRWDOHV HOHFWURIRUpWLFD2WUDWpFQLFDHVOD66&3 HQLQJOpVSingle Strand
FRPRODELRWLQDODGLJR[LJHQLQDODVVXOIRQDVRODÀXRUHVFHtQD (VWD Conformational PolymorphismSROLPRU¿VPRFRQIRUPDFLRQDOGH
técnica recibe el nombre de manchas de Southern o Southern blot en FDGHQD~QLFD SDUDGHWHFWDUHYHQWXDOHVmutaciones reconocidas por
la migración diferencial en geles de poliacrilamida no desnaturaliKRPHQDMHDVXLQYHQWRUHO3URIHVRU6LU(ZLQ6RXWKHUQ
Cuando el procedimiento se aplica a la detección de RNA en un zantes, luego de la previa desnaturalización del DNA.
Las técnicas de secuenciamiento nucleotídico tales como la de
soporte sólido, luego del fraccionamiento electroforético y la trans6DQJHURODGH0D[DP\*LOEHUWVLJQL¿FDURQDYDQFHVH[WUDRUGLQDIHUHQFLDUHVSHFWLYDVHGHQRPLQD±SRUH[WHQVLyQ±Northern blot.
La técnica se inicia con el fraccionamiento electroforético de
ODVVXVSHQVLRQHVGHSURWHtQDVYLUDOHVHQJHOHVGHSROLDFULODPLGD
ODVEDQGDVIRUPDGDVHQORVJHOHVVHWUDQV¿HUHQD¿OWURVGHQLWURFHlulosa o nylon mediante la aplicación de una adecuada intensidad
de corriente eléctrica o por capilaridad. Dichas bandas conservan
HQHO¿OWURODPLVPDSRVLFLyQTXHWHQtDQHQORVJHOHV\VHSXHGHQ
REVHUYDUFRORUHDGDVGHVSXpVGHLQFXEDUHO¿OWURFRQanticuerpos
HVSHFt¿FRVGLULJLGRVFRQWUDODVSURWHtQDVYLUDOHV\OXHJRFRQXQ
suero anti-inmunoglobulinas de la especie del suero anterior conMXJDGDVFRQSHUR[LGDVD(OWestern BlotVHXVDSDUDWLSL¿FDUSURWHtnas de numerosos virus. 6XVHOHYDGDVHVSHFL¿FLGDG\VHQVLELOLGDG
KDQSURPRYLGRVXXVRFRPRWpFQLFDFRQ¿UPDWRULDGHODSUHVHQFLD
de anticuerpos para HIV en el suero de pacientes con serología
SRVLWLYDGHWHUPLQDGDSRUWpFQLFDVGHWDPL]DMH YpDVHHOFDStWXOR
Diagnóstico virológico El procedimiento se denomina inmunoblot cuando se emplean
SURWHtQDVYLUDOHVUHFRPELQDQWHVRSpSWLGRVVLQWpWLFRV SURGXFLGRV
HQODERUDWRULRVGHELRWHFQRORJtD ODVTXHVHVLHPEUDQGLUHFWDPHQWH
VREUH¿OWURVVLQQHFHVLGDGGHIUDFFLRQDPLHQWRHOHFWURIRUpWLFRSUHYLR
Estas proteínas se pueden utilizar como sustrato para detectar antiFXHUSRVHVSHFt¿FRVHQHOVXHURGHORVSDFLHQWHV3DUDHOORVHLQFXED
HOVXHURFRQODVSURWHtQDVXELFDGDVHQORV¿OWURV\OXHJRGHXQODYDGR
se realiza una segunda incubación con anticuerpos anti-inmunoglobuOLQDVKXPDQDVFRQMXJDGDVFRQSHUR[LGDVDRIRVIDWDVDDOFDOLQD(VWD
técnica se denomina 5,%$ recombinant immunoblotting assay \
/,$ Line immunoassay VHJ~QVHHPSOHHQSURWHtQDVUHFRPELQDQWHV
o péptidos sintéticos, respectivamente.
Estas técnicas se usan habitualmente como pruebas suplementarias para el diagnóstico de hepatitis C.
56
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
In vitro
In vivo
Huevos embrionados
Cultivos celulares
Animales
Vía intraalantoidea
Vía intraamniótica
Vía corioalantoidea
Vía i.p.
Acción citopatogénica
Ratones adultos
Vía i.p.
Vía i.c.
Embrión de pollo
o pato
Plaqueo bajo agarosa
Ratones lactantes
Figura 3.4. Procedimientos para aislamiento de virus in vivo e in vitro.
ULRVSDUDHOFRQRFLPLHQWRGHWDOODGRGHORViFLGRVQXFOHLFRV$PEDV
técnicas contribuyeron en tal grado al avance de todas las ciencias
biológicas que ameritaron también el otorgamiento del Premio Nobel
GH4XtPLFDGHD)UHGHULFN6DQJHU\D:DOWHU*LOEHUW MXQWRD
3DXO%HUJSRUODFRQVWUXFFLyQGHJHQRPDVTXLPpULFRV (QHOFDVRGH
Sanger, constituyó el segundo reconocimiento otorgado por el Comité
Nobel a su persona, habiendo recibido anteriormente su primer Nobel
por la invención de un procedimiento para secuenciar proteínas.
/DVDSOLFDFLRQHVGHODQiOLVLVGHVHFXHQFLDVGH'1$SHUPLWHOD
LGHQWL¿FDFLyQGHORVYLUXVVXVFHSDV\fenotipos, en diversos ensa\RVFRPRSRUHMHPSORODVXVFHSWLELOLGDGDGURJDVantivirales, la
FDUDFWHUL]DFLyQGHDLVODPLHQWRVYLUDOHVFRQHO¿QGHGHWHUPLQDUVXV
UHODFLRQHVODLGHQWL¿FDFLyQGHFHSDVYLUDOHVTXHKDQPRGL¿FDGRVX
virulencia y la epidemiología molecular de los virus.
En este sucinto historial, se han mencionado algunas de las
WpFQLFDVTXHVHUiQDERUGDGDVFRQPD\RUGHWDOOHHQHOFDStWXORGH
diagnóstico virológico.
2. PROCEDIMIENTO
DE DETECCIÓN DE INFECTIVIDAD:
AISLAMIENTO VIRAL
El aislamiento de un virus es un requisito esencial para su estudio.
La replicación y propagación de virus requiere células vivas ya sean
SURYHQLHQWHVGHDQLPDOHVGHH[SHULPHQWDFLyQKXHYRVHPEULRQDGRV
o bien de células cultivadas in vitro. Luego del aislamiento debe
UHDOL]DUVHODLGHQWL¿FDFLyQ3RVWHULRUPHQWHSXHGHQUHDOL]DUVHOD
FXDQWL¿FDFLyQ\ODGHWHUPLQDFLyQGHVXVSURSLHGDGHVELROyJLFDV
ELRTXtPLFDV\VHUROyJLFDV )LJXUD 2.1 REQUERIMIENTOS PARA UN LABORATORIO DE CULTIVOS
El laboratorio que realiza aislamiento de virus debe implementar
adecuadas barreras de bioseguridad para disminuir el riesgo de infección en los operadores y en el medio ambiente, así como para
evitar la contaminación del agente en estudio. Para ello, es imporWDQWHWHQHUHQFXHQWDTXHORVYLUXVVHFODVL¿FDQHQQLYHOHVGHULHVJR
relacionados con su patogenicidad para el ser humano y su diseminación en la comunidad.
Las barreras de protección incluyen la del operador con guanWHVEDUELMRVDQWHRMRV\URSDVHVSHFLDOHVVLVHWUDEDMDFRQDJHQWHV
de alto riesgo, así como la inmunización con las vacunas virales
disponibles.
Las medidas para no contaminar al agente viral incluyen el traEDMRFRQEXHQDVSUiFWLFDVPLFURELROyJLFDV\HOXVRGHFDELQDVGH
seguridad biológica denominadas ÀXMRVODPLQDUHV. Dichas cabinas
SRVHHQ¿OWURVFRQWDPDxRVGHSRURDGHFXDGRVTXHLPSLGHQHOSDVDMH
GHPLFURRUJDQLVPRV\DGHPiVJHQHUDQXQÀXMRGHDLUHHVWpULOTXH
protege al operador, al medio ambiente y evitan también la contaminación del material en estudio.
En cuanto a la protección del medio ambiente o la comunidad,
el diseño del laboratorio de Virología debe contar con un adecuado
ÀXMRGHDLUH\HODFFHVRUHVWULQJLGRGHOiUHDFRQHQWUDGDSHUPLWLGD
sólo al personal entrenado para evaluar el riesgo del material con
HOTXHVHWUDEDMD YpDVHHOFDStWXORBioseguridad en la práctica
biomédica y en el laboratorio 2.2 AISLAMIENTO DE VIRUS
Las muestras para aislamiento de virus deben tratarse previamente
FRQDQWLELyWLFRVDQWLPLFyWLFRV\FHQWULIXJDFLyQSDUDHOLPLQDUODÀRUD
bacteriana que puede estar presente en muestras tales como secrecioQHVUHVSLUDWRULDVRULQDPXHVWUDVPXFRFXWiQHDVHWF(VWHSURFHVRVH
denomina descontaminación.
2.2.1 Animales de experimentación
/DLQRFXODFLyQGHDQLPDOHVHVHOSURFHGLPLHQWRPiVDQWLJXRSDUD
aislar y conservar los virus y puede producir desde una enfermedad
con lesiones típicas hasta la muerte.
Los animales utilizados en el laboratorio son ratones lactantes
RDGXOWRVFRED\RVFRQHMRV\HQDOJXQRVFDVRVSULPDWHV1XPHURVRVYLUXVSXHGHQDLVODUVHHQDQLPDOHV3RUHMHPSORORVPL[RYLUXV
SRULQVWLODFLyQQDVDOHQKXURQHVORVWRJDYLUXV\ORVDUHQDYLUXVSRU
inoculación intracerebral en ratones lactantes, etc. En la actualidad,
ORVDQLPDOHVGHH[SHULPHQWDFLyQVHXWLOL]DQFDGDYH]PHQRVHQORVHVWXGLRV
GHLQIHFWLYLGDGGHELGRDODOWRFRVWRGHVXPDQWHQLPLHQWRDODFRPSOHMLGDG
GHODVLQVWDODFLRQHVQHFHVDULDV ELRWHULRV DOULHVJRGHODPDQLSXODFLyQGH
animales infectados, y a la presencia de virus latentes en los mismos. Sólo
VHVLJXHQHPSOHDQGRUDWRQHVHQHODLVODPLHQWRGHYLUXVUiELFRÀDYLYLUXV
arenavirus y algunos virus &R[VDFNLH6LQHPEDUJRORVDQLPDOHVUHsultan indispensables tanto en estudios de investigación referidos
a patogenia, oncogenicidad e inmunidad a virus, así como en los
HQVD\RVGHH¿FDFLDHLQRFXLGDGGHODVvacunas en desarrollo y en la
SUHSDUDFLyQGHDQWLVXHURVSDUD¿QHVGLDJQyVWLFRV
2.2.2 Huevos embrionados
Los virus pueden inocularse en diferentes estructuras de huevos de
SROORRGHSDWRFRQWHQLHQGRHPEULRQHVGHGtDV/RVPL[RYLUXV
VHLQRFXODQHQFDYLGDGDPPLyWLFDORVSDUDPL[RYLUXV\PL[RYLUXV
en cavidad alandoidea y los herpesvirus y SR[YLUXVHQPHPEUDQD
FRULRDODQWRLGHD )LJXUD 3DUDODLQRFXODFLyQVHSUDFWLFDXQ
SHTXHxRRUL¿FLRHQODFiVFDUDSUHYLDDQWLVHSVLD\VHLQ\HFWDHO
LQyFXORYLUDO/XHJRVHWDSDHORUL¿FLRFRQWHODDGKHVLYD\VHLQFXEDQORVHPEULRQHVDž&/DUHSOLFDFLyQYLUDOSXHGHSURGXFLUOD
PXHUWHGHOHPEULyQ KHUSHVSDURWLGLWLVDOJXQRV2UWKRP\[RYLUXV o no inducir lesiones aparentes aunque pueden detectarse antígenos
YLUDOHV KHPDJOXWLQLQDV /RVSR[YLUXV\KHUSHVYLUXVSURGXFHQHQ
la membrana corioalantoidea, lesiones focalizadas que se denomiQDQS~VWXODV pocks 57
Capítulo 3 / ¿Cómo se estudian los virus?
/RVKXHYRVHPEULRQDGRVSUHVHQWDQODYHQWDMDGHVHUEDFWHULRlógicamente estériles, de poseer escasos virus latentes, de carecer
GHUHVSXHVWDLQPXQH\GHVHUGHIiFLOPDQLSXODFLyQ$FWXDOPHQWH
VXXVRHVWiUHVWULQJLGRDODSURGXFFLyQGHvacunas para LQÀXHQ]D\
SDUDHODLVODPLHQWRGHRUWKRP\[RYLUXVRSR[YLUXV.
2.2.3 Cultivos de células
Durante la primera mitad del siglo XX comenzó el desarrollo de
los cultivos de células in vitro SHURVXXVRVHVLPSOL¿FyDPHdiados de ese siglo con el descubrimiento de los antibióticos, la
WULSVLQD\HODYDQFHGHELGRD(DJOHGHORVPHGLRVGH¿QLGRVGH
FXOWLYR(Q(QGHUVORJUyFXOWLYDUHOYLUXVpolio en células
no nerviosas y, a partir de ese momento, los cultivos celulares
constituyeron el sustrato de elección para la replicación de la mayoría de los virus.
En los cultivos celulares las células se mantienen viables en boWHOODVRWXERVGHYLGULRRSOiVWLFRHQFRQGLFLRQHVGHHVWHULOLGDGFRQ
medios nutritivos enriquecidos con sueros, vitaminas y antibióticos,
JHQHUDOPHQWHDž&HQHVWXIDVGHFXOWLYR/RVPHGLRVGHFXOWLYR
TXHDSRUWDQQXWULHQWHVDGLFKDVFpOXODVGHEHQUHQRYDUVHyYHFHV
por semana.
([LVWHQGRVWLSRVEiVLFRVGHcultivos celulares: los cultivos primarios y las líneas celulares. Cultivo primario es el primer cultivo
in vitro de células obtenidas directamente de un organismo, mientras que la línea celular se obtiene a partir de muchos subcultivos
GHOFXOWLYRSULPDULR )LJXUD7DEOD Cultivos primarios
Los cultivos primarios se obtienen por tratamiento con tripsina
GHSHTXHxRVWUR]RVGHWHMLGRVGHOKRPEUHRDQLPDOHV/DVFpOXODV
GLVJUHJDGDVVHODYDQVHFXHQWDQHQFiPDUDVFXHQWDJOyEXORV tipo
1HXEDXHU \VHVLHPEUDQHQWXERVERWHOODVRSROLFXEHWDVGHYLGULR
RGHSOiVWLFRHQHVWULFWDVFRQGLFLRQHVGHHVWHULOLGDG6HDxDGHXQ
medio nutritivo con antibióticos y antimicóticos y las células se
LQFXEDQHQHVWXIDDž&/XHJRGHSRFDVKRUDVODVFpOXODVVHDGKLHUHQDODVXSHU¿FLHGHOUHFLSLHQWH\SRVWHULRUPHQWHHQODPD\RUtD
de los casos, se dividen. Con el paso del tiempo se cubre toda la
VXSHU¿FLHGHOHQYDVHIRUPiQGRVHXQDPRQRFDSDFRQDVSHFWRGH
FpOXODVHSLWHOLDOHVR¿EUREOiVWLFDV(QHVHPRPHQWRVHLQKLEHHO
crecimiento, fenómeno que se denomina inhibición por contacto.
Los cultivos primarios poseen un número normal de cromosomas.
El mayor inconveniente de los cultivos primarios es que al
FDERGHDOJXQRVSRFRVSDVDMHV FXOWLYRVVHFXQGDULRV ODVFpOXODV
mueren y es necesario obtener un nuevo cultivo primario a partir
GHOWHMLGRRULJLQDOORTXHLPSOLFDXQDOWRFRVWR
/RVFXOWLYRVSULPDULRVPiVXWLOL]DGRVVRQ¿EUREODVWRVGHULxyQ
GHSULPDWHVFpOXODVHPEULRQDULDVGHGLVWLQWRRULJHQ\¿EUREODVWRV
de prepucio humano. Estos cultivos poseen un amplio espectro de
sensibilidad a los virus por lo que son sumamente útiles en el diagnóstico virológico.
Líneas celulares continuas
/RVFXOWLYRVSULPDULRVSUROLIHUDQHQIRUPDH[SRQHQFLDOSRUXQQ~PHUREDMRGHVXEFXOWLYRVOXHJRHQWUDQHQXQDFRQGLFLyQHVWDFLRQDULD\¿QDOPHQWHPXHUHQ(QDOJXQRVFDVRVOXHJRGHYDULRVSDVDMHV
puede ocurrir una transformación y pueden aparecer variantes celulares que dan origen a las llamadas líneas celulares continuas.
Estas líneas son de crecimiento ilimitado in vitro, es decir, pueden
replicarse en el laboratorio un número ilimitado de veces, por ello
se las denomina líneas inmortales. Su número de cromosomas es
YDULDEOH DQHXSORLGtD HVWRVLJQL¿FDTXHSXHGHQWHQHUXQQ~PHUR
mayor o menor de cromosomas que el número normal de la especie
que los originó. Por lo tanto, se considera que las líneas celulares
continuas son sistemas celulares nuevos.
([LVWHQQXPHURVDVOtQHDVFHOXODUHVFRQWLQXDVWDQWRGHRULJHQ
QRUPDOFRPRQHRSOiVLFR'HQWURGHODVSULPHUDVHVWiQODVFpOXODV
Vero, provenientes de riñón de mono verde africano, las MDCK de
ULxyQGHSHUURODV%+.GHULxyQGHKiPVWHURODV5.GHULxyQ
GHFRQHMR'HQWURGHODVGHRULJHQQHRSOiVLFRODVPiVFRQRFLGDV
A
B
C
Figura 3.5. Cultivos celulares normales e infectados. $¿EUREODVWRV
GHSUHSXFLRKXPDQRVVLQLQIHFWDU%ídem, infectados con citomegaloYLUXV6HREVHUYD$&3IRFDO&FpOXODVGHULxyQGHPRQRLQIHFWDGDV
FRQSDUDPL[RYLUXV6HREVHUYDXQVLQFLFLRFRQQ~FOHRV [ son las células HeLa, derivadas de un FDUFLQRPDGHFpUYL[RODV
+(SGHcarcinoma de laringe. Si bien la sensibilidad de las líneas
FHOXODUHVFRQWLQXDVDORVGLIHUHQWHVYLUXVHVOLPLWDGDVRQGHEDMR
costo y se utilizan habitualmente para aislamiento de virus sincicial
respiratorio, herpesvirus, rubéola, poliovirus, &R[VDFNLHDGHQRYLUXVHWF 7DEOD Líneas celulares diploides
A partir de los cultivos primarios es posible obtener subcultivos al tratar
ODVFpOXODVSUHVHQWHVHQODPRQRFDSDFRQXQDHQ]LPDSURWHROtWLFD WULSVLQD \VHPEUDUHQUHFLSLHQWHVQXHYRVFRQPHGLRIUHVFR$VtHVSRVLEOH
seleccionar a partir de los cultivos primarios, células que conserven una
PRUIRORJtDLQWDFWDXQQ~PHURQRUPDOGHFURPRVRPDV GLSORLGH \VX
capacidad de crecimiento durante un número limitado de subcultivos.
Habitualmente, las líneas celulares pueden duplicarse un número limiWDGRGHYHFHV VLQSHUGHUVXVFDUDFWHUHVQRUPDOHV
58
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
Tabla 3.2. Cultivos celulares utilizados para aislamiento de virus.
Algunos virus, si bien son capaces de replicar en cultivos, no
producen acción citopatogénica visible directamente al microscoSLRySWLFRVLQHPEDUJRFRPRSURGXFWRGHODUHSOLFDFLyQYLUDOVH
OLEHUDQDOPHGLRGHFXOWLYRRHVWiQSUHVHQWHVHQODVFpOXODVLQIHFtadas, proteínas de origen viral que pueden ser demostradas por
GLYHUVRVSURFHGLPLHQWRV3RUHMHPSORODVKHPDJOXWLQLQDVSXHGHQ
detectarse por reacciones de hemaglutinación y otros antígenos
pueden ponerse en evidencia por reacciones de ¿MDFLyQGHcomplemento, inmunomarcaciones, etc.
/RVYLUXVTXHSRVHHQKHPDJOXWLQLQDVH[SUHVDQHVWRVDQWtJHQRV
en la membrana celular de las células que infectan. Esto puede demostrarse por reacciones de hemadsorciónHVGHFLU¿MDFLyQGH
JOyEXORVURMRVHQODVFpOXODVLQIHFWDGDV(VWDUHDFFLyQVHXWLOL]DSDUD
LGHQWL¿FDFLyQGHvirus respiratorios.
En algunos virus, la replicación ocurre sin producción de ACP
pero –sin embargo– esta replicación es capaz de inhibir la replicación de un segundo virus que se inocule en el mismo cultivo. Este
mecanismo se denomina interferencia viral, y se debe a la inhibición de algún paso temprano en el ciclo de replicación del segundo
virus debido a la replicación del primero en las mismas células.
(VWHIHQyPHQRVHHYDO~DSULQFLSDOPHQWHFRQ¿QHVGHLQYHVWLJDFLyQ
EiVLFD\IXHHPSOHDGRSDUDdiagnóstico del virus rubéola.
)LQDOPHQWHWDPELpQVXHOHQHPSOHDUVHWpFQLFDVTXHGHWHFWDQ
antígenos virales y en los últimos años se han desarrollado técnicas
que permiten detectar los genomas virales en las células infectadas.
Estas líneas diploides tienen una elevada sensibilidad a muchos
virus y son aptas para la producción de vacunas de uso humano.
/DVOtQHDVGLSORLGHVPiVXVDGDVVRQODV05& GHULxyQGHPRQR
UKHVVXV RODV:, Wistar Institute GHRULJHQKXPDQR$PEDV
líneas se utilizan para el aislamiento de adenovirus, citomegalovirus, varicela-zóster, rinovirus, etc., así como también como sustrato
para la replicación de muchas cepas vacunales.
Detección de antígenos virales
La detección de antígenos virales se realiza mediante una reacción
antígeno-anticuerpo, que puede ser puesta en evidencia mediante
PDUFDGRUHVWDOHVFRPRÀXRURFURPRVHQ]LPDVRUDGLRLVyWRSRV(Vtas técnicas son de aplicación amplia y fundamental en Virología
SDUDODLGHQWL¿FDFLyQFODVL¿FDFLyQ\FXDQWL¿FDFLyQGHORVDJHQWHV
YLUDOHVFRQ¿QHVGHLQYHVWLJDFLyQdiagnóstico y estudios epidemiológicos.
Tipo de cultivo
Primario
Riñón de mono
5LxyQGHFRQHMR
Riñón de embrión
KXPDQR
Diploide
Fibroblastos
Continuo
+(S
A549
MDCK
LLC-MK2
5KDEGRPLRVDUFRPD
5%
Susceptibilidad a
,QÀXHQ]DSDUDLQÀXHQ]DHQWHURYLUXV
+HUSHVVLPSOH[
$GHQRYLUXVHQWHURYLUXV
&LWRPHJDORYLUXVKHUSHVVLPSOH[
YDULFHOD]yVWHUUKLQRYLUXVDGHQRYLUXV
YLUXVVLQFLFLDOUHVSLUDWRULRDOJXQRV
HQWHURYLUXV
YLUXVVLQFLFLDOUHVSLUDWRULRDGHQRYLUXV
KHUSHVVLPSOH[DOJXQRVSDUDLQÀXHQ]D\
HQWHURYLUXVDGHQRYLUXVYLUXVVLQFLFLDO
respiratorio
DGHQRYLUXV
HQWHURYLUXV
LQÀXHQ]D
SDUDLQÀXHQ]D
HFKRYLUXV
Inmunofluorescencia (IF) )LJXUD Esta técnica utiliza
anticuerpos específicos marcados con fluorocromos como isoWLRFLDQDWRGHIOXRUHVFHtQDURGDPLQDURMR7H[DVXRWURV/DUHacción antígeno-anticuerpo se visualiza usando un microscopio
FRQOX]89(VDOWDPHQWHHVSHFtILFD\UiSLGD
(QODWpFQLFDGLUHFWDODVFpOXODVRWHMLGRVVRQWUDWDGRVFRQ
XQDLQPXQRJOREXOLQDHVSHFt¿FDGHDOWRWtWXORFRQMXJDGDFRQHO
2.2.4 Detección de los virus en cultivos celulares
(OGHVDUUROORGHODUHSOLFDFLyQYLUDOHVGHFLUODDPSOL¿FDFLyQGHO ÀXRURFURPR/DWpFQLFDLQGLUHFWDHQFDPELRXWLOL]Danticuerpos
YLUXVLQRFXODGRHQHOFXOWLYRSXHGHLGHQWL¿FDUVHSRUGLIHUHQWHVSUR- HVSHFt¿FRVQRPDUFDGRV\OXHJRGHODYDGRVpVWRVVHLQFXEDQ
FHGLPLHQWRVTXHWLHQGHQDGHWHFWDUODVPRGL¿FDFLRQHVSURGXFLGDV las muestras con DQWLFXHUSRV FRQMXJDGRV FRQ ÀXRURFURPRV \
dirigidos contra la especie animal en la que se preparó el antien el cultivo por efecto de la replicación viral.
VXHURYLUDO/DWpFQLFDLQGLUHFWDHVJHQHUDOPHQWHPiVVHQVLEOH
que la directa pues los DQWLFXHUSRVHVSHFt¿FRVDGKHULGRVDORV
Acción citopatogénica
Muchos virus replican con producción de acción citopatogénica antígenos virales pueden incrementar el número de uniones a los
(ACP WDPELpQGHQRPLQDGDefecto citopático. Esto consiste en anticuerpos marcados. Asimismo, requiere sólo anticuerpos maralteraciones de las monocapas celulares que pueden observarse di- cados contra la especie animal y no para cada muestra de virus
rectamente al microscopio óptico invertido, sin necesidad de colora- LQGLYLGXDO6LQHPEDUJRVHQHFHVLWDQPiVFRQWUROHV\SDVRVHQ
FLyQDOJXQD([LVWHQGLYHUVRVWLSRVGH$&3TXHVRQcaracterísticas. esta reacción.
Los resultados positivos por ,)VRQDTXHOORVTXHGHPXHVWUDQ
3RUHMHPSORORVSROLRYLUXV\ORVKHUSHVSURGXFHQXQD$&3TXHVH
PDQL¿HVWDDORVSRFRVGtDV\FRQVLVWHHQUHGRQGHDPLHQWRGHODVFp- XQDWLQFLyQHVSHFt¿FDGHODFpOXODLQIHFWDGDGRFXPHQWDQGRODSUHOXODVGHVSUHQGLPLHQWRGHODPRQRFDSDGHODVXSHU¿FLHHQTXHFUHFH VHQFLDGHDQWtJHQRVHQGLVWLQWDVORFDOL]DFLRQHVFHOXODUHV Q~FOHR
y liberación de las células alteradas al medio de cultivo. Esta acción FLWRSODVPDRPHPEUDQD /D,)HVDPSOLDPHQWHXWLOL]DGDHQHO
suele observarse en forma generalizada a toda la monocapa celular. GLDJQyVWLFRYLUROyJLFRWDQWRSDUDODGHWHFFLyQUiSLGDGHDQWtJHQRV
Por el contrario, otros virus, como el citomegalovirus, tienen virales en muestras clínicas como para diagnóstico serológico.
9pDVHHOFDStWXORDiagnóstico virológico XQD$&3OHQWDTXHVHPDQL¿HVWDOXHJRGHGtDVRVHPDQDVSRV
inoculación, y comienza en forma de focos bien delimitados de
FpOXODVUHGRQGHDGDV )LJXUD% 2WURVYLUXVSURGXFHQinclu- Inmunoensayos enzimáticos. Las técnicas para detectar antígenos
siones características localizadas en el núcleo o en el citoplasma virales por LQPXQRHQVD\RV HQ]LPiWLFRV WDPELpQ GHQRPLQDGRV
de las células, las que pueden ser visualizadas mediante tinciones ELISA GHOLQJOpVenzyme linked immuno sorbent assay VRQVLPLODUHVDODVWLQFLRQHVGHLQPXQRÀXRUHVFHQFLD/DGLIHUHQFLDHVTXH
histológicas o por técnicas inmunohistoquímicas.
Aquellos virus que tienen en su envoltura proteínas de fusión son en este caso, la marcación de los anticuerpos se realiza con enzimas
capaces de inducir la fusión de células vecinas formando sincicios HQOXJDUGHÀXRURFURPRV/DVHQ]LPDVPDUFDGRUDVPiVXWLOL]DGDV
FpOXODVJLJDQWHVPXOWLQXFOHDGDV características del virus sincicial VRQODSHUR[LGDVD\ODIRVIDWDVDDOFDOLQD/RVanticuerpos marcados
UHVSLUDWRULR )LJXUD& sarampión y algunas cepas de herpesvirus. XQLGRVDODQWtJHQR WpFQLFDGLUHFWD RDORVFRPSOHMRVDQWtJHQR
Cultivo de órganos
3DUDHODLVODPLHQWRGHFLHUWRVYLUXV FRURQDYLUXVRURWDYLUXV VH
pueden utilizar cultivos de órganos. Estos consisten en cortes de
WHMLGRVHPEULRQDULRVTXHPDQWLHQHQVXHVWUXFWXUD\IXQFLyQGXUDQte un cierto tiempo, mantenidos con medios especiales adecuados.
Capítulo 3 / ¿Cómo se estudian los virus?
59
pueden detectar DQWLFXHUSRVHVSHFt¿FRVHQXQVXHURSUREOHPDDO
HQIUHQWDUORFRQYLUXVFRQRFLGRV\F ORVHQVD\RVGHneutralización cruzada entre dos virus y sus antisueros pueden usarse para
FRPSDUDUDQWLJpQLFDPHQWHGLFKRVYLUXV\DTXHHVWHHQVD\RHVPiV
HVSHFt¿FRTXHRWUDVWpFQLFDVVHUROyJLFDV
Inhibición de la hemaglutinación
Si se hace reaccionar un virus con capacidad de hemaglutinaFLyQFRQVXDQWLFXHUSRHVSHFt¿FRpVWHDQXODUiVXFDSDFLGDGGH
hemaglutinación por bloqueo de las hemaglutininas presentes
en la envoltura del virión. Este fenómeno se llama inhibición de
ODKHPDJOXWLQDFLyQ\HVXWLOL]DGRFRQIUHFXHQFLDSDUDLGHQWL¿FDU
virus y en estudios serológicos para determinar la presencia de
DQWLFXHUSRVLQKLELGRUHVGHODKHPDJOXWLQDFLyQ 9pDVHHOFDStWXOROrthomyxovirus
Fijación de complemento
Esta técnica se basa en la captura de FRPSOHPHQWR & UHDOL]DGD
SRUORVFRPSOHMRVLQPXQHV6LVHWUDEDMDFRQHOVLVWHPDHQHVWXGLR
de antígeno y suero de referencia y luego se agrega un segundo
sistema formado por eritrocitos de carnero y anticuerpos dirigidos
KDFLDHVRVHULWURFLWRV VLVWHPDUHYHODGRU VHHVWDEOHFHUiXQDFRPpetencia por el C. Si la cantidad de C utilizada por el primer sistema
DQWLFXHUSR WpFQLFDLQGLUHFWD VRQGHWHFWDGRVSRUHODJUHJDGRGH HVSHTXHxDRQXODTXHGDUi&OLEUHTXHVHUiWRPDGRSRUHOVLVWHPD
un sustrato. Este sustrato reacciona con la enzima para producir un revelador, produciéndose la hemólisis de los eritrocitos. Si por el
SURGXFWRLQVROXEOHGHWHFWDEOHSRUH[DPHQPLFURVFySLFRRVROXEOH FRQWUDULRHOSULPHUVLVWHPDFRQVXPHHO&\QRGHMD&OLEUHSDUDVHU
FRORUHDGRÀXRUHVFHQWHROXPLQLVFHQWH/RV(/,6$VSRGUtDQVHU FDSWXUDGRSRUHOVLVWHPDUHYHODGRUQRKDEUiKHPyOLVLV\ODUHDFFLyQ
PiVVHQVLEOHVTXHOD,)\DTXHODPDUFDHQ]LPiWLFDSXHGHWHQHU VHUiSRVLWLYD8QDUHDFFLyQQHJDWLYD KHPyOLVLV VLJQL¿FDTXHQR
una acción continua sobre el sustrato y así producir una cantidad KD\D¿QLGDGHQWUHHODQWtJHQR\HOVXHURHQVD\DGR
FUHFLHQWHGHOSURGXFWRGHUHDFFLyQDPSOL¿FDQGRODUHDFFLyQLQLFLDO
Esta técnica detecta antígenos virales solubles, obteniéndose
La técnica de inmunoperoxidasa ,3 utiliza la enzima pe- generalmente reacciones cruzadas dentro de las familias, géneros
UR[LGDVDFRPRPDUFDGRUXQVXVWUDWRTXHFRQWLHQHSHUy[LGRGHKL- RVHURWLSRVTXHFRPSDUWHQDQWtJHQRV)XHXQDGHODVSULPHUDV
GUyJHQR\XQUHDFWLYRTXHDOVHUR[LGDGRSURGXFHXQSUHFLSLWDGR técnicas disponibles para la detección de anticuerpos antivirales,
FRORUHDGRLQVROXEOHHQHOOXJDUGHODDFWLYLGDGHQ]LPiWLFDTXHVH DXQTXHHQODDFWXDOLGDGKDVLGRUHHPSOD]DGDSRURWUDV YpDVHHO
corresponde con la localización del antígeno viral. La IP puede rea- capítulo 9 Diagnóstico virológico /RVVXHURVGHEHQWUDWDUVH
lizarse en forma directa o indirecta, al igual que la ,)/DVYHQWDMDV SUHYLDPHQWHFRQFDORU PLQXWRVDž& SDUDHOLPLQDUHO&
de la IP frente a la ,)VRQTXHXWLOL]DXQPLFURVFRSLRGHOX]FRP~Q endógeno.
y los preparados permanecen inalterados por varios años. Sus desYHQWDMDVVRQHOPD\RUQ~PHURGHSDVRVHOSRWHQFLDOFDQFHUtJHQR 2.2.5 Medición de la actividad biológica: titulación
de algunos sustratos y la necesidad de inactivar previamente la pe- La infectividad se mide determinando la cantidad de inóculo neUR[LGDVDHQGyJHQDSUHVHQWHHQFLHUWDVPXHVWUDV
FHVDULRSDUDREWHQHUXQDUHVSXHVWDHVSHFt¿FDHQXQGHWHUPLQDGR
hospedador. La determinación cuantitativa de la infectividad de una
Neutralización
preparación viral se denomina titulación. Por lo tanto, un título
Esta prueba se basa en la capacidad que tienen los anticuerpos de es el número de unidades infecciosas presentes en el inóculo por
GLVPLQXLURDQXODUODLQIHFWLYLGDGYLUDO(VODWpFQLFDFOiVLFDPiV unidad de volumen.
HVSHFt¿FDSDUDODLGHQWL¿FDFLyQGHYLUXV\HVODHOHJLGDFRPRgold
Se denomina unidad infecciosa a la mínima cantidad de
standard para evaluar a otras técnicas. En esta reacción intervie- material que es necesario inocular a un hospedador para obtener
QHQVyORORVDQWtJHQRVGHVXSHU¿FLHGHOYLULyQTXHVRQORVTXHKDQ una respuesta determinada. Esta respuesta puede ser localizada
sufrido las mayores presiones de selección durante la evolución y o generalizada. Según el tipo de respuesta, los procedimientos
TXHVRQHVSHFt¿FRVSDUDFDGDYLUXVGHQWURGHXQJpQHURRIDPLOLD SDUDFXDQWL¿FDUXQYLUXVVHFODVL¿FDQHQJUXSRVD WLWXODFLyQ
La técnica se realiza incubando el virus, a la temperatura y tiempo GHSXQWR¿QDOE HQXPHUDWLYRV\F GHJUDGDFLyQVLHQGRORVGRV
adecuados, con un suero de referencia que contiene anticuerpos primeros los que usualmente se utilizan.
HVSHFt¿FRV/XHJRVHPLGHODLQIHFWLYLGDGUHVLGXDOHQXQFXOWLYR
celular sensible. Su disminución indica la presencia de homología &XDQWL¿FDFLyQYLUDOSRUODWpFQLFDGHFXDQWL¿FDFLyQ
entre el par virus-anticuerpo enfrentados.
de unidades formadoras de placas (UFP)
([LVWHQGRVIRUPDVGHUHDOL]DUODUHDFFLyQ
/DWpFQLFDGHUHFXHQWRGHSODFDVSHUPLWHFXDQWL¿FDUODFDQWLGDGGH
‡ Virus constante-suero variable6HXWLOL]DXQDFDQWLGDG¿MDGH viriones presentes en un inóculo. Es un procedimiento enumerativo
YLUXVKDFLpQGRODUHDFFLRQDUFRQGLOXFLRQHVHQEDVHGHOVXHUR que se utiliza en investigación. Se basa en el recuento de lesiones
inmune. El título del suero es la inversa de la dilución que pro- ORFDOL]DGDVSRUHMHPSORSODFDVGHOLVLVHQPRQRFDSDVGHFpOXODV
GXFHXQDUHGXFFLyQGHOGHODLQIHFWLYLGDGHPSOHDGD focos en membrana corioalantoidea de embrión de pollo, focos de
en el ensayo.
proliferación en FXOWLYRVFHOXODUHV HQHOFDVRGHYLUXVWXPRUDOHV ‡ Virus variable-suero constante. Se realizan dos series de dilucioEs un procedimiento de fundamental importancia si se dispone
QHVHQEDVHGHODSUHSDUDFLyQYLUDOXQDGHHOODVVHKDFHUHDF- GHOVXVWUDWRFHOXODUDGHFXDGR\HVGHIiFLOUHDOL]DFLyQUHSURGXFLEOH
FLRQDUFRQXQDFRQFHQWUDFLyQ¿MDGHLQPXQRVXHUR\ODRWUDFRQ \H[DFWR
suero normal. Se puede así calcular el índice de neutralización
Un virus que se inocula en un cultivo de células susceptibles
como el logaritmo del cociente entre el título de la serie incubada se disemina habitualmente a todas las células a través del medio de
con suero normal y el de la enfrentada al inmunosuero.
FXOWLYR3RUORWDQWRQRHVIiFLOFXDQWL¿FDUODFDQWLGDGGHYLUXVSUH (VWDWpFQLFDWLHQHYDULDVDSOLFDFLRQHVD FXDQGRVHXVDXQDQ- sente en el inóculo, a menos que se efectúen diluciones del mismo
WLVXHURHVSHFt¿FRVHSXHGHQLGHQWL¿FDUYLUXVGHVQRFRFLGRVE VH y que se utilice un medio semisólido.
)LJXUD,QPXQRÀXRUHVFHQFLDGLUHFWDSDUDGHWHFFLyQGHDQWtgenos virales en cultivo. &pOXODVGHULxyQGHPRQRLQIHFWDGDVFRQ
YLUXV-XQtQDODVKRUDVSRVLQIHFFLyQWHxLGDVFRQXQDQWLFXHUSR
PRQRFORQDOPDUFDGRFRQLVRWLRFLDQDWRGHÀXRUHVFHtQD [ VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
60
Para realizar el plaqueo, los FXOWLYRVFHOXODUHV HQERWHOODVR
SROLFXEHWDV VHLQIHFWDQFRQGLOXFLRQHVGHYLUXV/XHJRGHXQDKRUD
GHDGVRUFLyQDž&VHFXEUHODPRQRFDSDFHOXODUFRQXQPHGLR
de cultivo semisólido que contiene agar, agarosa o metilcelulosa
\VHSURFHGHDODLQFXEDFLyQGHODVFpOXODVDž&GXUDQWHYDULRV
días. La cobertura de la monocapa con un medio semisólido impide
la diseminación del virus a través del medio de cultivo y hace que
los nuevos viriones formados deban infectar las células vecinas. Es
decir, se produce una diseminación de célula a célula. Cada virión
se replica y produce un foco o clon de células infectadas. Luego
de varios días de incubación, se tiñe la monocapa infectada con un
FRORUDQWHYLWDOFRPRHOURMRQHXWUR6RODPHQWHVHWHxLUiQODVFpOXODV
YLYDVPLHQWUDVTXHODVLQIHFWDGDVTXHGDUiQVLQWHxLU\IRUPDUiQXQD
placaYLVLEOHDODREVHUYDFLyQGLUHFWD )LJXUD /DLQIHFWLYLGDGVHSXHGHH[SUHVDUHQunidades formadoras de
placas (UFP) por ml. El título se calcula directamente a partir de
ODGLOXFLyQGHODPXHVWUD G HOQ~PHURGHSODFDVFRQWDGR Q \HO
YROXPHQGHLQyFXOR Y Título (UFP/ ml ) = n / v [ d
Esta técnica se emplea en investigación para determinar la
cantidad de virus presente en las muestras analizadas con alta precisión. Otra aplicación importante es la selección de mutantes de
YLUXV clones de virus DVtFRPRODE~VTXHGD\SURGXFFLyQGHFHSDV
atenuadas para uso en vacunación.
&XDQWL¿FDFLyQPHGLDQWHODWpFQLFDGHSXQWR¿QDO
Algunos virus no producen placas en medio semisólido como el
GHVFULWRPiVDUULED\SRUHOORODWLWXODFLyQSRU8)3QRSXHGHXWLOL]DUVHSDUDFXDQWL¿FDUVXSUHVHQFLD(QHVWRVFDVRVGHEHQHPSOHDUVH
las técnicas de SXQWR¿QDO.
3DUDHVWDSUXHEDVHUHDOL]DQGLOXFLRQHVVHULDGDVGHOYLUXV HQ
JHQHUDOHQEDVH ODVTXHVHLQRFXODQHQQ~PHURVLJXDOHVGH
unidades de pruebas WXERVFRQFpOXODVVXVFHSWLEOHVRDQLPDOHV
GHH[SHULPHQWDFLyQ /XHJRGHODLQFXEDFLyQVHUHJLVWUDFXLGDdosamente a lo largo de varios días o semanas, la aparición de
ACP en los cultivos o de enfermedad y/o muerte en los animales.
/DVXQLGDGHVGHSUXHEDGHVDUUROODUiQVLJQRVGHLQIHFFLyQHQODV
GLOXFLRQHVPiVEDMDVGHOYLUXV\QRHQODVPiVDOWDV(QODVGLOXFLRQHVLQWHUPHGLDVVRODPHQWHXQDSDUWHGHHOODVPRVWUDUiVLJQRV
GHLQIHFFLyQ3RUUD]RQHVPDWHPiWLFDVHVQHFHVDULRHPSOHDUORV
datos obtenidos en las distintas diluciones para poder calcular
ODGLOXFLyQOtPLWHHQTXHHOGHODVXQLGDGHVGHSUXHEDHVWiQ
LQIHFWDGDV3DUDHVWHFiOFXORH[LVWHQGLYHUVDVIyUPXODVVLHQGROD
PiVXWLOL]DGDODGH5HHG\0HQFK (VWHPpWRGRVHEDVD
en la propuesta de que si una unidad de prueba dio un resultado
SRVLWLYR HQ XQD GRVLV DOWD GH YLUXV WDPELpQ GDUi SRVLWLYR HQ
GRVLVPD\RUHVHVGHFLUHQGLOXFLRQHVPiVEDMDVGHOLQyFXOR
Coincidentemente, la unidad de prueba que dio resultado neJDWLYRFRQFLHUWDGRVLVGDUiQHJDWLYRFRQGRVLVPiVEDMDV/D
estimación de las dosis infectivas de cultivo 50 (DICT 50 VH
basa en las frecuencias acumulativas de las respuestas positivas
y negativas.
(OPpWRGRGH5HHG\0HQFKWRPDHQFXHQWDORVUHVXOWDGRV
obtenidos en varias diluciones del inóculo. La dilución que infecta
HOGHODVXQLGDGHVGHSUXHEDVHGHQRPLQDDosis infectante
de cultivo50 DICT50) si se trata de cultivos, o bien Dosis Letal 50
(DL50 VLVHWUDWDGHDQLPDOHV
$QDOLFHPRV HO VLJXLHQWH HMHPSOR GRQGH VH LQIHFWDURQ WXERV
FRQWHQLHQGRPRQRFDSDVGHFpOXODVHQFXOWLYRFRQPOGHFDGD
GLOXFLyQGHFLPDOGHYLUXV -4 /XHJRGHYDULRVGtDV
GHLQFXEDFLyQDž&VHREVHUYy\UHJLVWUyODDSDULFLyQGH$&3
7DEOD (QHVWHHMHPSORODGLVWDQFLDHQWUHGLOXFLRQHVGRQGHVHHQFXHQWUDOD',&7 GLOXFLRQHV-4\ VHFDOFXODPHGLDQWHOD
siguiente fórmula:
/RJDULWPRGHOD',&7 ORJDULWPRGLOXFLyQPiVFRQFHQWUDGD
GLVWDQFLDUHODWLYDGHOORJDULWPRGHODGLOXFLyQDOSXQWR[ORJDritmo del factor de dilución
/DGLVWDQFLDUHODWLYDGHOORJDULWPRGHODGLOXFLyQDOSXQWR
se calcula por la siguiente fórmula:
,QIHFWLYLGDGPD\RUGH± ±
²²²²²²²²²²²²²² ²²²² ±
,QIHFWLYLGDGPD\RUGH±
LQIHFWLYLGDGGHEDMRGH 3RUORWDQWRHOORJDULWPRGHOD',&7 (QFRQVHFXHQFLDXQDVXVSHQVLyQYLUDOGLOXLGDO4,7 contenida en
PO YROXPHQGHOLQyFXOR UHSUHVHQWD',&7(VWRVLJQL¿FD
que en esa dilución la mitad de los cultivos se infectaron con el
virus.
(QHVWHPpWRGRHOWtWXORFRUUHVSRQGHDOQ~PHURGH',&7 en el
volumen del inóculo.
En consecuencia:
7tWXOR 4,7 ',&7 [',&7 /ml
Virus
(VWDWpFQLFDHVPiVODERULRVDTXHHOUHFXHQWRGHSODFDVEDMRDJDU\
requiere de un operador adiestrado para observar la ACP, pero es sumaPHQWH~WLOFXDQGRVHWUDEDMDFRQPXFKDVPXHVWUDV
1) Infección de monocapa celular
3) Replicación en células adyacentes
2) Cubrir con agarosa y nutrientes
4) Tinción con colorante vital (rojo neutro)
5) Recuento de las placas obtenidas. El recuento es visual.
En este celdilla se aprecian 12 placas. Las células no infectadas
toman el colorante vital.
Figura 3.7. Esquema de los pasos para la producción de placas
bajo un medio semisólido (agarosa).
Comparación entre las diferentes pruebas: las pruebas de inIHFWLYLGDGVRQHQJHQHUDOPiVVHQVLEOHVTXHORVSURFHGLPLHQWRV
¿VLFRTXtPLFRVGHestudio de los virus. La precisión de las pruebas
depende del número de unidades de prueba empleados. Si se comparan recuento de placas y técnica de dilución límite para obtener
ODPLVPDSUHFLVLyQVHUtDQHFHVDULRHPSOHDUHQFDVRGHFRQWDU
SODFDVSRUFDYLGDGXQLGDGHVGHSUXHED(VWR~OWLPRHVFRPSOHMR
\FRVWRVRSRUHOORODVHQVLELOLGDGGHODWpFQLFDGHGLOXFLyQOtPLWH
HVPHQRU\DTXHVHXVDQKDELWXDOPHQWHyXQLGDGHVGHSUXHED
por cada dilución.
En general, el título obtenido por técnicas de infectividad es
inferior al número de partículas virales, detectadas por plaqueo. Por
HMHPSORXQDVXVSHQVLyQWLWXODGDSRUODWpFQLFDGHXQLGDGHVIRUPDGRUDVGHSODFDVWLHQH98)3\ODWLWXODFLyQSRUGLOXFLyQOtPLWHHQ
FXOWLYRLQGLFDVyOR',&7.
Se denomina H¿FLHQFLD GH LQIHFFLyQ a la relación entre el
título de infectividad sobre el número total de partículas. Esta
61
Capítulo 3 / ¿Cómo se estudian los virus?
Dilución
de virus
10-3
10-4
10-5
10-6
Nº de cultivos con ACP/Nº de
cultivos inoculados
4/4
3/4
2/4
0/4
Nº acumulativo de
cultivos infectados
9
5
2
0
Nº acumulativo de
cultivos no infectados
0
1
3
7
Infectividad
cociente
9/9
5/6
2/5
0/7
%
100
83
40
0
Tabla 3.3. Método de Reed y Müench para la titulación viral.
relación varía ampliamente dependiendo del virus y del hospeGHUR+DELWXDOPHQWHHVPHQRUGH\HVWRVHGHEHDODSUHVHQcia de partículas no infectivas con defectos en sus proteínas o
iFLGRVQXFOHLFRVLQFRUUHFWRVJHQHUDGRVGXUDQWHODUHSOLFDFLyQHQ
un determinado hospedero, o bien por inactivación producida por
agentes físicos o químicos.
La titulación de los virus es una técnica de rutina en un laboraWRULRGHLQYHVWLJDFLyQ/DFXDQWL¿FDFLyQGHXQYLUXVHVODEDVHHQ
la determinación de las curvas de un solo ciclo, en el estudio de la
neutralización de la infectividad viral, en el ensayo de la actividad
de agentes DQWLYLUDOHVHQHOPRQLWRUHRGHORVSDVRVGHXQDSXUL¿FDción viral y en los estudios de patogenicidad.
Por el contrario, en los laboratorios de diagnóstico, sólo es necesario conocer el título de material infectivo presente en una muestra en algunas oportunidades, como es el caso de realizar alguna técnica serológica especial o para estudio de resistencia a antivirales.
Bibliografía
‡
:DJQHU(.+HZOHWW0-Basic Virology. Massachusetts, USA. BlacNZHOO6FLHQFH,QF
‡
0DK\%:-.DQJUR+2Virology Methods Manual. London, Great
%ULWDLQ$FDGHPLF3UHVV
4
Genética viral
Víctor Romanowski
La genética es la ciencia de la transmisión de los caracteres heUHGLWDULRV\VXYDULDFLyQ1RGHEHGHMDUGHWHQHUVHHQFXHQWDTXH
fueron los sistemas virus-célula los que permitieron, en la segunda
PLWDGGHOVLJORSDVDGRH[WUDRUGLQDULRVDYDQFHVHQHOFRQRFLPLHQWRGHORVPHFDQLVPRVPROHFXODUHVEiVLFRVFRPSURPHWLGRVHQOD
WUDQVPLVLyQ\H[SUHVLyQGHODLQIRUPDFLyQJHQpWLFD
El propósito de este capítulo es introducir los conceptos generales involucrados en la genética de los virus, es decir, en la
replicación y transmisión de la información genética a la progenie
y su variación. Los mecanismos de replicación de los distintos tiSRVGHJHQRPDVVHGHVFULEHQHQHO&DStWXOR3RUORWDQWRDTXtVH
HQIRFDUiQDVSHFWRVUHODFLRQDGRVFRQODYDULDFLyQGHORVJHQRPDV
virales y sus consecuencias.
1. INTRODUCCIÓN
A LA TERMINOLOGÍA
Para comenzar, necesitaremos familiarizarnos con algunos términos utilizados en forma arbitraria en la descripción de diferencias
entre virus.
6LELHQQRH[LVWHQGXGDVVREUHHOVLJQL¿FDGRGHgenotipo LQIRUPDFLyQJHQpWLFDGH¿QLGDSRUODVVHFXHQFLDVGHiFLGRQXFOHLFR
TXHFRPSUHQGHWDQWRODVUHJLRQHVTXHVHH[SUHVDQHQIRUPDGH
51$\SURWHtQDVFRPRODVUHJLRQHVUHJXODWRULDV \fenotipo caUDFWHUtVWLFDVREVHUYDEOHVSURGXFWRGHODH[SUHVLyQGHOJHQRWLSR HO
uso habitual de algunos otros términos no es tan claro y requiere
algunas consideraciones.
Así, los términos cepa, tipo, variante y mutante se usan
H[WHQVDHLQGLVFULPLQDGDPHQWHSDUDGHQRPLQDUDYLUXVTXHGL¿HUHQGHDOJXQDPDQHUDKHUHGDEOHGHXQYLUXVSDUHQWDORwild
type VLOYHVWUH /RVJHQHWLVWDVPROHFXODUHVOHDVLJQDQHOQRPEUH
de wild type wt DXQYLUXVJHQHUDOPHQWHFXOWLYDGRHQHOODboratorio, del que se obtuvieron mutantes que se comparan al
wtFRPRUHIHUHQFLD(QHVWHFRQWH[WRGHEHGLIHUHQFLDUVHHQWUH
los virus wt de laboratorio y los virus recientemente aislados de
su hospedero natural, que se denominan aislamientos de campo
¿HOGLVRODWHV (QIXQFLyQGHVXXVRKDELWXDOVHSXHGHQDVRFLDUVLJQL¿FDGRV
SDUWLFXODUHVDORVRWURVWpUPLQRVPHQFLRQDGRVPiVDUULED$Vt
cepa es utilizado para designar distintos wt y mutantes caracteri]DGRVGHOPLVPRYLUXVtipo se convirtió en sinónimo de serotipo
GH¿QLGRSRUQHXWUDOL]DFLyQFUX]DGDGHODLQIHFWLYLGDG XQPLVPR
VHURWLSRLQFOX\HYDULDVFHSDV \variante se utiliza para indicar
que un virus es genotípicamente diferente del wt.
Estas diferencias terminológicas no resultan esenciales
cuando se conoce la secuencia nucleotídica del genoma en
FXHVWLyQ DXQ FXDQGR HQ PXFKRV FDVRV QR UHVXOWH FODUR TXp
cambios nucleotídicos tienen un determinado efecto a nivel del
IHQRWLSR *HQHUDOPHQWHHOSRUFHQWDMHGHGLIHUHQFLDVHQWUHODV
secuencias nucleotídicas de dos virus determina si pertenecen
DXQPLVPRJpQHUR GLIHUHQFLDVGHKDVWD DXQDPLVPDHVSHFLH GLIHUHQFLDVQRPD\RUHVDOSRUHMHPSOR DXQPLVPR
WLSRRVHURWLSR GLIHUHQFLDVQRPD\RUHVDSRUHMHPSOR /DVGLIHUHQFLDVFRQVLGHUDGDVVX¿FLHQWHVSDUDXELFDUDGRVYLUXV HQ GRV HVSHFLHV GLIHUHQWHV R SDUD GH¿QLU TXH VH WUDWD GH
dos cepas distintas dentro de la misma especie dependen de la
IDPLOLDGHYLUXVGHTXHVHWUDWH YHUODSiJLQDZHEGHO&RPLWp
,QWHUQDFLRQDOGH7D[RQRPtDGH9LUXVR,&79KWWSZZZQFEL
QOPQLKJRY,&79GE,FWY 2. BASES
MOLECULARES DE LOS CAMBIOS EN LOS GENOMAS
Los virus se reproducen con ayuda de las células a las que infecWDQSDUDJHQHUDUQXHYDVFRSLDVGHVtPLVPRV SURJHQLH (QHVWH
proceso es esencial que la progenie de partículas virales reciba
XQDFRSLD¿HOGHOiFLGRQXFOHLFRSDWHUQR ¢RPDWHUQR"HQUHDOLGDG
FRPRORVYLUXVQRWLHQHQVH[RQRQRVYDPRVDGHWHQHUDGLVFXWLUOD
FRQYHQLHQFLDGHHVWRVWpUPLQRV /RVSURFHVRVGHUHSOLFDFLyQGHORViFLGRVQXFOHLFRVVRQEDVWDQWHHODERUDGRV\ODFRSLDGHODVHFXHQFLDQXFOHRWtGLFDHVH[WUDRUGLQDULDPHQWH¿HO FRPRXQDVHFUHWDULDPHWLFXORVDTXHFRSLD
XQGRFXPHQWRPX\LPSRUWDQWH DXQTXHGHYH]HQFXDQGRVH
SXHGDGHVOL]DUDOJ~QHUURU ODFRSLDPHFDQRJUD¿DGDQRHVWDQ
¿HO FRPR XQD IRWRFRSLD (Q OD UHSOLFDFLyQ GH OD LQIRUPDFLyQ
HQIRUPDGH'1$H[LVWHQPHFDQLVPRVGHFRUUHFFLyQGHHUURUHV
proofreadingLPDJLQDUDXQDVHFUHWDULDTXHPLUDODSDQWDOODGH
VXSURFHVDGRUGHWH[WRPLHQWUDVHVFULEH\DOGHWHFWDUXQHUURU
YXHOYHLQPHGLDWDPHQWHDWUiV±SUHVLRQDODWHFODbackspace– y
VXVWLWX\HODOHWUDPDOWLSHDGDSRUODFRUUHFWD 6LHVWRIXHUDHVtrictamente lo único que ocurre no habría variación genética ni
evolución.
En términos generales, las variaciones de los genomas ocurren
SRUGRVPHFDQLVPRVTXHFDPELDQODVHFXHQFLDGHORViFLGRVQXcleicos, de manera que, al menos, algunos miembros de la progenie
QRUHVXOWDQLGpQWLFRVDVX V SURJHQLWRU HV mutación y recombinación. En el caso de virus en los que el genoma se encuentra repartiGRHQYDULDVPROpFXODVGH'1$R51$ JHQRPDVVHJPHQWDGRV OD
YDULDFLyQWDPELpQSXHGHRFXUULUSRUUHRUGHQDPLHQWRGHORVMXHJRV
GHPROpFXODV reasociación o reassortment 2.1 MUTACIONES
Las mutaciones son cambios en la secuencia nucleotídica. ComSUHQGHQFDPELRVGHXQQXFOHyWLGRSRURWUR WUDQVLFLRQHVXQDSXULQDSRURWUDSXULQDRXQDSLULPLGLQDSRURWUDWUDQVYHUVLRQHVXQD
SLULPLGLQDSRUXQDSXULQD\YLFHYHUVD LQVHUFLRQHVGHXQRRPiV
QXFOHyWLGRV\GHOHFLRQHV HOLPLQDFLyQGHXQRRPiVQXFOHyWLGRVGH
ODVHFXHQFLDRULJLQDO 2.1.1. Mutaciones espontáneas
En este capítulo no nos referiremos a los distintos agentes mutagénicos de tipo químico o físico que aumentan la frecuencia de
mutación de acuerdo a la concentración o dosis en que se admiQLVWUHQDOJXQRVDFW~DQVREUHHOPDWHULDOJHQpWLFR SRUHMHPSOR
DJHQWHVPHWLODQWHV HQIRUPDGLUHFWD\RWURVUHTXLHUHQTXHVHHVWp
UHSOLFDQGRSDUDSURGXFLUVXHIHFWR SRUHMHPSORDQiORJRVGHEDVHV Algunos virus generan una gran proporción de mutantes por
SDVDMHHQDXVHQFLDGHPXWiJHQRV/DVPXWDFLRQHVHVSRQWiQHDVVH
acumulan en los genomas de los virus produciendo alteraciones
HQHOIHQRWLSRTXHHVWiVXMHWRDODpresión de selección durante la
evolución de ese virus.
Las PXWDFLRQHVHVSRQWiQHDVVHGHEHQDHUURUHVSURGXFLGRVGXrante la replicación. La frecuencia de mutación en virus con genoPDVD'1$HVPX\EDMDGH D por nucleótido incorporado
RVHDXQQXFOHyWLGRGHFDGDDPLOORQHVGHQXFOHyWLdos polimerizados en una secuencia ordenada de acuerdo al molde
SDWHUQRGH'1$ (VWRTXLHUHGHFLUTXHSRGUtDPRVHQFRQWUDUHQ
64
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
Figura 4.1. Dogma central de la biología molecular. 6HHVTXHPDWL]DODUHSOLFDFLyQ\H[SUHVLyQGHOJHQRPDGHODVFpOXODV\GHORV
GLIHUHQWHVWLSRVGHJHQRPDVGHYLUXV LQGLFDGRVHQORVUHFXDGURVGHODGHUHFKD /RVLQGLFDGRVSRUODVÀHFKDVFXUYDVHQFRORUJULV\
QHJURVRQSURFHVRVQRLQFOXLGRVHQHOdogma central original y se observan en sistemas virales con genomas a RNA y en los eventos de
WUDQVSRVLFLyQGHUHWURHOHPHQWRVGHOJHQRPDFHOXODU UHWURWUDQVSRVRQHVUHWURSRVRQHV/,1(V6,1(VHWF promedio, a lo sumo, un nucleótido cambiado por mutación esponWiQHDHQHOJHQRPDGHXQDVRODGHFDGDSDUWtFXODVYLUDOHV
provenientes de una placa generada por la replicación de un virus
FRQXQJHQRPDD'1$GHSDUHVGHEDVHV
Esto se debe a que las DNA polimerasas poseen una actividad
HQ]LPiWLFDTXHOHVSHUPLWHFRUUHJLUHUURUHVGXUDQWHODUHSOLFDFLyQ
7DEOD /DV'1$SROLPHUDVDVLQFRUSRUDQUHVLGXRVGHQXFOHyVLGRPRQRIRVIDWR G103 DSDUWLUGHQXFOHyVLGRVWULIRVIDWRFRPSOHPHQWDULRV G173V DODVEDVHVGHODKHEUDPROGHGH'1$'H
WDOPDQHUDODKHEUDTXHHVVLQWHWL]DGDFUHFHHQHOVHQWLGR¶¶6L
SRUHUURUHOQXFOHyWLGRLQFRUSRUDGRHQHOH[WUHPR¶GHODFDGHQD
creciente no es perfectamente complementario al que se encuentra
en la cadena molde, la polimerasa tarda en seguir elongando esta
FDGHQD\OHGDWLHPSRDVXDFWLYLGDGGHH[RQXFOHDVD¶¶SDUD
HOLPLQDUDOQXFOHyWLGRPDOLQFRUSRUDGR SRUKLGUyOLVLVGHO~OWLPR
HQODFHIRVIRGLpVWHU Mientras que los genomas a DNA son bastante estables, los
YLUXVFRQ51$H[KLEHQIUHFXHQFLDVGHPXWDFLyQHQHORUGHQGH
Molde/
producto
DNA / DNA
DNA / RNA
RNA / RNA
RNA / DNA
Enzima (a)
DNA SRO'1$GHS
(DNA pol)
RNA SRO'1$GHS
(RNApol)
RNA SRO51$GHS RdRp)
RNA SROUHSOLFDVDWUDQVFULSWDVD
DNA SRO51$GHS
(RT)
Transcriptasa reversa o inversa
D por nucleótido incorporado. De esta manera, en promedio,
sería probable encontrar un nucleótido cambiado en cada uno de
los viriones que se recuperan de una placa de virus y que provienen
de la replicación de una única partícula viral cuyo genoma tiene un
WDPDxRGHQXFOHyWLGRV
A los virus con genoma de RNA se deben agregar los retroviUXVTXHH[SDQGHQD~QPiVHOHVTXHPDEiVLFRFHQWUDOGHODELRORJtD
PROHFXODU HVGHFLUHOÀXMRGHLQIRUPDFLyQ'1$ĺ51$ĺ3URWHtQD
)LJXUD (QOD7DEODVHUHVXPHQODVDFWLYLGDGHVGHODVHQ]LPDVLQYRlucradas en la copia de la información genética de virus.
/RVYLUXVH[KLEHQXQDYDULHGDGGHHVWUDWHJLDVSDUDODH[SUHVLyQ
y replicación de sus genomas y, para hacerlo, usan enzimas que han
evolucionado dando lugar a mecanismos de copia de mayor o menor
¿GHOLGDG'HHVWDPDQHUDFRQRFLHQGRHOtipo de genoma y la estrateJLDGHUHSOLFDFLyQSXHGHLQIHULUVHHQXQDSULPHUDDSUR[LPDFLyQVLVH
trata de un virus muy variable o muy estable desde el punto de vista
genético.
Actividad
Replicación de genomas a DNA
'1$ĺ'1$
([RQXFOHDVD¶¶
Transcripción
'1$ĺ51$
Transcripción, replicación de genomas a RNA
51$ĺ51$
Transcripción inversa
51$ĺ'1$ F'1$
'1$ĺ'1$
(b)
51DVD+
(c)
Integrasa
Corrección de errores
(frecuencia de error)
Sí
9)
No
4)
No
3 - 105)
No
4)
Tabla 4.1. Propiedades de las polimerasas de ácidos nucleicos
D /DVDEUHYLDWXUDVSRO\GHSVLJQL¿FDQSROLPHUDVD\GHSHQGLHQWHUHVSHFWLYDPHQWH(QWUHSDUpQWHVLVVHPHQFLRQDQODVDEUHYLDWXUDV
KDELWXDOHVGHODVHQ]LPDVWDOFRPRDSDUHFHQHQODOLWHUDWXUDFLHQWt¿FDLQWHUQDFLRQDO
E 51DVD+ GHJUDGD51$HQKtEULGRV51$'1$ HVXQGRPLQLRGHODWUDQVFULSWDVDLQYHUVDHQDOJXQRVUHWURYLUXV\HVXQSROLSpSWLGR
VHSDUDGRHQRWURV
(c) Integrasa (LQWHJUDFLyQGHODFRSLDGH'1$HQHOJHQRPDGHODFpOXODKRVSHGHUD HVXQGRPLQLRGHODWUDQVFULSWDVDLQYHUVDHQDOJXQRV
UHWURYLUXV\HVXQSROLSpSWLGRVHSDUDGRHQRWURV
65
Capítulo 4 / Genética viral
En algunos casos, la frecuencia de PXWDFLyQHVSRQWiQHDKDFH
que sea imposible contar con un stock de virus genéticamente homogéneo, ya que en cada generación aparecen nuevos cambios
en la secuencia de genomas individuales. Si la velocidad de replicación del virus wt RULJLQDOHVPiVDOWDTXHODGHORVHYHQWXDOHV
PXWDQWHVHQODSREODFLyQSUHGRPLQDUiHOwt. En caso contrario,
KDEUiXQDFROHFFLyQPiVRPHQRVYDULDGDGHJHQRPDVFRQPiVR
menos cambios con respecto a la secuencia nucleotídica del wt.
Esto es especialmente cierto en virus a RNA. Así, en virus de la
HQIHUPHGDGGH1HZFDVWOH 1'9 VHHQFRQWUDURQPXWDQWHVFRQ
morfología de placa distinta a la del wtFRQXQDIUHFXHQFLDGH
D\HQHOYLUXVGHODHVWRPDWLWLVYHVLFXODU 969 VHDLVODURQ
PXWDQWHVVHQVLEOHVDODWHPSHUDWXUD ts FRQIUHFXHQFLDVGHD
3RUHOFRQWUDULRHQODPD\RUtDGHORVFDVRVGHYLUXVD'1$
la frecuencia de PXWDFLyQHVSRQWiQHDHVPX\EDMDSDUDVHUWHQLGD
en cuenta.
Las técnicas de la biología molecular han permitido recientemente
XQDQiOLVLVPiVGLUHFWRGHODVIUHFXHQFLDVGHPXWDFLyQHVSRQWiQHD'H
estos estudios surge que las frecuencias de error en la replicación de
los genomas a RNA son, en efecto, altas, aunque varían en varios órGHQHVGHPDJQLWXG D GHSHQGLHQGRGHOYLUXV/DDFXPXODFLyQ
progresiva de cambios en la secuencia nucleotídica del genoma viral
conduce a un cambio en la composición genética de una población de
virus, donde las proporciones de las distintas variaciones del genoma
RULJLQDOFDPELDQFRQHOWLHPSR6LSXGLpUDPRVREWHQHUXQDLQVWDQWinea en distintos momentos de la población viral en los individuos HIV
positivos que fueron contagiados por recibir sangre contaminada de un
único donante, el resultado no sería el mismo para los distintos tiempos
\ORVGLVWLQWRVSDFLHQWHV YHUVHFFLyQVREUHevolución, efecto cuello de
botella)LJXUD (QJHQpWLFDGHSREODFLRQHVORVFDPELRVREVHUYDGRV
VHFRQRFHQFRPRGHULYDJHQpWLFD genetic drift La estabilidad genética en las vacunas a virus vivos atenuados
es un motivo de preocupación y cuidadosa evaluación y control.
En el caso de los virus a RNA, se ha propuesto mantener una coSLDGHOJHQRPDHQIRUPDGHF'1$FORQDGR FRSLDGHO51$YLUDO
utilizando una transcriptasa inversa, obtención de DNA de doble
KHEUDHLQVHUFLyQHQXQSOiVPLGR SDUDSRGHUXVDUORFRPRstock
PiVHVWDEOHGHELGRDTXHODUHSOLFDFLyQGHO'1$VHUHDOL]DSRU
enzimas que corrigen eventuales errores en la incorporación de
nucleótidos. Esto es técnicamente factible en aquellos virus en los
que se ha logrado recuperar virus a partir de cDNA infectivo.
2.1.2. Tipos de mutantes
Mutantes letales. El cambio en la secuencia nucleotídica conduce
a la anulación de alguna de las funciones esenciales del virus. Este
tipo de mutantes no puede ser aislado, a menos que se utilicen
OtQHDVFHOXODUHVTXHH[SUHVHQHOJHQIDOWDQWH complementación
JHQpWLFD Mutantes letales condicionales. Este tipo de mutantes puede
propagarse en una condición que se denomina permisiva, aunque
QRORKDFHQHQRWUDVLWXDFLyQ SRUHMHPSORPXWDQWHVts y cs Mutantes sensibles a la temperatura (ts: temperature sensitive). La alteración en la secuencia nucleotídica es tal que el producto del gen alterado resulta inactivo a una cierta temperatura llamaGDQRSHUPLVLYD DOWD DODTXHQRSXHGHDGRSWDUVXFRQIRUPDFLyQ
activa. Sin embargo, el producto de ese gen es capaz de mantener
la conformación necesaria para su actividad biológica cuando el
YLUXVFUHFHDXQDWHPSHUDWXUDSHUPLVLYD EDMD Mutantes sensibles al frío (cs: cold sensitive). Responden al
mismo principio que los ts, pero la condición permisiva es, en este
caso, una temperatura alta.
Mutantes de rango de hospederos. Se trata de mutantes que
son capaces de crecer en un tipo de células y no en otro. Algunos
mutantes que se usan como vacunas a virus vivos poseen un neuURWURSLVPR FDSDFLGDGGHLQIHFWDUFpOXODVGHOVLVWHPDQHUYLRVR muy disminuido cuando se los compara con el virus wt del que
fueron derivados.
Mutantes resistentes a drogas. Las interacciones entre la droga
y la molécula viral blanco se ven afectadas por la mutación. Por
HMHPSORODtranscriptasa inversa de un retrovirus es capaz de utiOL]DUFRPRVXVWUDWRDOJXQRVDQiORJRVGHQXFOHyVLGRV SRUHMHPSOR
$=7 TXHXQDYH]LQFRUSRUDGRVDODFDGHQDFUHFLHQWHGH'1$
LPSLGHQODLQFRUSRUDFLyQGHOSUy[LPRQXFOHyWLGR(QIRUPDHVSRQWiQHDSXHGHQDSDUHFHUPXWDQWHVFRQXQDDOWHUDFLyQHQHOVLWLR
activo de la WUDQVFULSWDVDLQYHUVDGHPDQHUDWDOTXHHVWRVDQiORJRV
de nucleótidos ya no son reconocidos como sustrato y la enzima se
torna refractaria a la terapia antiviral.
Mutantes de deleción. Este tipo de mutantes puede ser el resultado de la eliminación de regiones esenciales o no esenciales
de la secuencia nucleotídica del genoma viral. En este último caso,
los virus son viables, mientras que en el primero no lo son y sólo
son capaces de replicarse en presencia de un virus helper, que les
VXPLQLVWUHODIXQFLyQTXHHOORVQRSRVHHQ RVLODFpOXODFRQWLHQH
ORVJHQHVYLUDOHVQHFHVDULRVLQWHJUDGRVHQVXJHQRPD Mutantes de escape a la neutralización (resistentes a anticuerpos monoclonales, mar). Algunos cambios en las secuencias de
JHQHVTXHFRGL¿FDQSURWHtQDVH[WHUQDVGHOYLULyQSXHGHQUHVXOWDU
en alteraciones de epítopes que son reconocidos en el wt por cierto
anticuerpo monoclonal. De esta manera, el mutante es capaz de
eludir la neutralización por ese anticuerpo e infectar a la célula
KRVSHGHUD/DLGHQWL¿FDFLyQGHORVFDPELRVSURGXFLGRVHQODVHFXHQFLDQXFOHRWtGLFDHQWDOHVPXWDQWHVSHUPLWHGH¿QLUODVUHJLRQHV
IXQFLRQDOHVHQODVSURWHtQDVYLUDOHVH[WHUQDV
Algunas mutaciones pueden resultar en varias alteraciones
IHQRWtSLFDV$VtSRUHMHPSORXQDmutación ts en un gen puede
producir un virus atenuado y con un tropismo tisular alterado. El
efecto múltiple de una única mutación se denomina pleiotropismo
o efecto pleiotrópico.
3. INTERACCIONES
GENÉTICAS ENTRE VIRUS
3.1. RECOMBINACIÓN
Los virus con genomas que consisten en una sola molécula de
DNA o RNA pueden intercambiar información genética en una
FpOXODLQIHFWDGDVLPXOWiQHDPHQWHFRQGRVYLUXVGLVWLQWRVSRULQWHracción física directa de sus genomas.
/RVYLUXVJUDQGHVD'1$ DGHQRKHUSHVSR[ SXHGHQLQWHUcambiar información genética por recombinación homóloga. Generalmente, la recombinación entre dos mutantes que coinfectan
una célula produce proporciones equivalentes de los tipos de
UHFRPELQDQWHVUHFtSURFRVDGHPiVGHYLULRQHVFRQORVJHQRPDV
SDUHQWDOHV )LJXUD /Drecombinación puede ocurrir también
HQWUHYLUXVGHGLVWLQWRVWLSRVGHQWURGHOPLVPRJUXSR SRUHMHPplo, adeno WLSR\ SHURVyORHQUHJLRQHVGHDOWDKRPRORJtDGH
secuencia nucleotídica.
Los eventos moleculares que conducen a la recombinación ocuUUHQHQIRUPDVLPXOWiQHDFRQODUHSOLFDFLyQGHOJHQRPD(QHOFDVR
de los virus a DNA la recombinación ocurre según el modelo de corte
\UHXQLyQ RPHFDQLVPRGHUHFRPELQDFLyQLQWUDPROHFXODU 0LHQWUDV
WDQWRHQORVYLUXVD51$ODVHYLGHQFLDVH[SHULPHQWDOHVDSR\DQHO
PHFDQLVPRGHVHOHFFLyQGHFRSLD copy choice HQHOTXHODRNA
polimerasa salta de un molde a otro generando una molécula del genoma en la que una parte resulta de copiar el RNA molde de uno de
ORVYLUXVSDUHQWDOHV\RWUDSDUWHGHORWUR )LJXUD 7DPELpQVHKDQGHVFULWRPHFDQLVPRVGHWUDQVHVWHUL¿FDFLyQ
parecidos químicamente a los que utilizan las células eucarióticas
SDUDSURFHVDUVXVP51$V splicingRFRUWH\HPSDOPH La recombinación en el hospedero infectado con dos variantes
de un virus puede producir virus con una patogenicidad alterada.
En este sentido, se han descrito infecciones in vivo con dos varianWHVQRYLUXOHQWDVGHOYLUXVKHUSHVVLPSOH[ +69 TXHJHQHUDURQ
recombinantes letales.
3.2. REASOCIACIÓN DE SEGMENTOS GENÓMICOS (REASSORTMENT)
En los genomas no segmentados, la frecuencia de recombinación
GHSHQGHGHODGLVWDQFLDGHORVPDUFDGRUHVJHQpWLFRV SRUHMHPSOR
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
66
Marcadores genéticos
Virulento (vir)
Atenuado
Vir
Crece a 40 ºC
No crece a 40 ºC (ts)
Epítope que reacciona
con anticuerpo monoclonal
neutralizante
Epítope cambiado,
resistente al anticuerpo
neutralizante (mar)
ts
Virus
parentales
mar
Coinfección
Replicación y
recombinación
Fenotipo
vir
vir
ts
-
mar
-
-
ts
mar
vir
-
mar
Vir
Progenie
Muchas copias de los genomas originales A
-
ts
-
vir
-
mar
-
ts
-
vir
ts
mar
-
-
-
vir
ts
-
-
-
mar
Productos de recombinación
X
Pocas copias de genomas recombinados B, C,
D y E son pares de combinaciones recíprocas
producidas según el modelo de ruptura y reunión
(breakage-reunion).
Los puntos de recombinación se marcan con X y los
fenotipos se indican al costado.
La frecuencia de recombinación es proporcional a la
distancia entre los marcadores. Así, entre ’\ȅKD\
mayores oportunidades de recombinación que entre
’ y Ƒ.
3RUHOORKDEUiPD\RUSURSRUFLyQUHFRPELQDQWHGHO
tipo B y C, y menos del tipo D. A su vez, también
SXHGHRFXUULUPiVGHXQHYHQWRGHUHFRPELQDFLyQ
por par de genomas, produciendo otras combinaciones de marcadores como en E.
X
X
X
X
Figura 4.2. Recombinación homóloga de genomas lineales de DNA.
mutaciones tsHQGRVJHQHVGLVWLQWRV$\% VREUHHOcromosoma,
OOHJDQGRDXQPi[LPRWHyULFRGHVyORHQHOFDVRGHTXHORV
PDUFDGRUHVHVWpQDOHMDGRVDXQDGLVWDQFLDLQ¿QLWD
/RVYLUXVFRQJHQRPDVHJPHQWDGRHQFDPELRH[KLEHQXQFRPportamiento muy distinto: dado un par de marcadores, la frecuencia
de UHFRPELQDFLyQHVPX\DOWD KDVWD FXDQGRpVWRVSHUWHQHFHQ
DVHJPHQWRVGLVWLQWRVRHVPX\EDMDFXDQGRORVPDUFDGRUHVVH
encuentran sobre el mismo segmento.
A diferencia de los genomas de molécula única, en una inIHFFLyQPL[WDGHGRVYLUXVFRQJHQRPDVVHJPHQWDGRVODSURJHQLHSXHGHFRQWHQHUODVFRPELQDFLRQHV assortments DOWHUQDWLYDV
de segmentos por simple empaquetamiento o reasociación reassortment GHVHJPHQWRVGHXQRXRWURYLUXV )LJXUD (VWH
IHQyPHQRRFXUUHHQYLUXVGHODVIDPLOLDVD51$GHVLPSOH Orthomyxo, Bunya, Arena YDULDV IDPLOLDV GH YLUXV GH SODQWDV \
GREOH Reo FDGHQD\FRQGXFHDYDULDFLRQHVEDVWDQWHEUXVFDVHQ
ORVFRPSOHPHQWRVJHQpWLFRVGHODSURJHQLH genetic shift FXDQGR
se la compara con los virus parentales y las variaciones generadas por incorporación de mutaciones durante la replicación. En
la naturaleza se han encontrado virus de la gripe con distintas
FRPELQDFLRQHVGHVHJPHQWRV HOYLUXVWLHQHXQJHQRPDFRPSXHVWR
SRURFKRVHJPHQWRVGH51$GHFDGHQDVLPSOH UHVSRQVDEOHVGH
XQDGUDPiWLFDGLYHUVLGDGDQWLJpQLFDGHORVGLVWLQWRVVXEWLSRV YDULDQWHV YLUDOHV HOVHJPHQWRFRQWLHQHHOJHQGHOSUHFXUVRUGHOD
KHPDJOXWLQLQD\HOGHODneuraminidasa, ambas proteínas de la
HQYROWXUDYLUDO 3.3. COMPLEMENTACIÓN
(QXQDLQIHFFLyQPL[WDGRVPXWDQWHVOHWDOHVFRQGLFLRQDOHV
pueden dar progenie wt por UHFRPELQDFLyQ R reasociación
HQ HO FDVR GH JHQRPDV VHJPHQWDGRV (VWHwt VHUi HO ~QLFR
miembro de la progenie capaz de replicarse en la condición
no permisiva.
3RURWUDSDUWHHQODLQIHFFLyQPL[WDHQFRQGLFLRQHVQRSHUmisivas, también se puede producir un aumento en el rendimiento
de la progenie de los mutantes sin que cambien sus genomas. En
este fenómeno, que se conoce como complementación, uno de los
mutantes proporciona el producto génico que es defectuoso en el
otro y viceversa, permitiendo que se produzca la replicación.
(VWRVLJQL¿FDTXHVLDPERVPXWDQWHVVRQGHIHFWXRVRVHQHO
PLVPRJHQQRVHSURGXFLUicomplementación, ya que ninguno
GH ORV YLUXV SDUHQWDOHV SRGUi SURYHHU HO SURGXFWR R OD IXQFLyQ
faltante. Este razonamiento se utiliza para agrupar mutantes de
manera que aquellos que son incapaces de complementar se encuentran en el mismo grupo de complementación y se considera
que poseen defectos en el mismo gen o producto génico. En teoría,
puede haber tantos grupos de complementación como genes en el
JHQRPD6LQHPEDUJRGHELGRDOFDUiFWHUDEVROXWDPHQWHOHWDOGH
algunas PXWDFLRQHV\DOFDUiFWHUQRHVHQFLDOGHDOJXQDVIXQFLRQHV
o productos génicos virales, a menudo, el número de grupos de
complementación resulta menor que el número real de genes.
La complementación se observa en una serie de situaciones
naturales. Cuando algunos virus animales se propagan repetidamente por cultivos celulares a altas multiplicidades de infección,
DSDUHFHQPXWDQWHVGHGHOHFLyQHQIRUPDHVSRQWiQHD(VWRVPXWDQWHVGHJHQRPDPiVFRUWRLQWHU¿HUHQFRQHOFUHFLPLHQWRGHRWURV
virus y mutantes. Ellos mismos son incapaces de crecer de manera
independiente y son mantenidos en la población viral por complementación con los pocos virus que poseen genoma completo,
TXHVHHQFXHQWUDQHQODPLVPDSREODFLyQ YHULQWHUIHUHQFLDPiV
DGHODQWH 2WURFDVRVHSUHVHQWDHQORVYLUXVWXPRUDOHVD51$ UHWURYLUXV ODPD\RUtDGHORVFXDOHVHVGHIHFWLYDHQODUHSOLFDFLyQGHELGRDH[WHQVDVGHOHFLRQHVHQORVJHQHVTXHFRGL¿FDQIXQFLRQHVLQYROXFUDGDV
en la replicación. Los stocksGHHVWRVYLUXVFRQWLHQHQDGHPiVGHORV
YLUXVWUDQVIRUPDQWHVGH¿FLHQWHVHQUHSOLFDFLyQXQYLUXVUHODFLRQDGR
GH¿FLHQWHHQtransformación pero que provee las funciones necesarias
Capítulo 4 / Genética viral
67
Genomas parentales
En una coinfección la RNA pol copia uno u otro
genoma y a veces salta del molde inicial para
seguir copiando otra molécula.
Ź
Progenie
Muchas copias de los
genomas parentales.
Algunos genomas
recombinados por el mecanismo de copy choice
no generan productos de
recombinación recíproca.
Figura 4.3. Recombinación de RNA: modelo de copy choice.
LCM (WE)
LCM (ARM)
L
L
S
S
Coinfección
De una célula por dos cepas distintas del virus LCM
L
L
S
Progenie
S
L
L
S
S
Combinaciones de los segmentos de RNA
genómico L y S de las dos cepas
Figura 4.4. Reasociación genética (genetic reassortment). /RVDUHQDYLUXVVRQHOHMHPSORPiVVLPSOHGHYLUXVFRQJHQRPDGH51$
VHJPHQWDGR\DTXHVRODPHQWHFRQVWDGHGRVPROpFXODVGHQRPLQDGDV/\6TXHVHDVRFLDQFRQODSURWHtQD1SDUDIRUPDUODVQXFOHRFiSVLGHV6LGRVFHSDV :(\$50 GLVWLQWDVGHODUHQDYLUXV/&0LQIHFWDQXQDPLVPDFpOXODDOFRPSOHWDUVHODPRUIRJpQHVLVGHODVSDUWtFXODV
YLUDOHVSRUEURWDFLyQGHODPHPEUDQDGHODFpOXODLQIHFWDGDHQHOLQWHULRUSRGUiQTXHGDUHQFHUUDGDVGLIHUHQWHVFRPELQDFLRQHVGH51$V
JHQyPLFRV/\6/DVFRPELQDFLRQHVSXHGHQVHUD~QPD\RUHV\DTXHVHKDGHPRVWUDGRTXHORVYLULRQHVSXHGHQHPSDTXHWDUPiVGHXQD
FRSLDGHO51$6
SDUDODUHSOLFDFLyQ replication-competent (VWHVHJXQGRYLUXVUHVFDWD
al virus defectivo en replicación, manteniéndolo en la población viral.
2WURHMHPSORGHcomplementación se encuentra en la aplicación
de los UHWURYLUXV \RWURV FRPRvectores para introducir genes foUiQHRV WUDQVGXFFLyQ HQRUJDQLVPRVPXOWLFHOXODUHVRHQFpOXODVHQ
cultivo. Resulta conveniente que los vectores virales no contengan
ODLQIRUPDFLyQJHQpWLFDGHOYLUXV TXHORKDFHSDWyJHQRSDUDHORUJDQLVPREODQFR 3HURHQWRQFHV¢FyPRVHSXHGHQSURGXFLUYLUXV
FRQORVJHQHVTXHVHGHVHDQWUDQVGXFLU"3DUDHOORVHXWLOL]DQOtQHDV
celulares, llamadas empaquetadoras packaging cells TXHFRQWLHQHQLQWHJUDGRVDVXVJHQRPDVORVJHQHVYLUDOHV HQHOFDVRGHretrovirus, gag, pol y env QHFHVDULRVSDUDFRQVWUXLUODVSDUWtFXODVYLUDOHV
alrededor del genoma sin genes virales provisto por el vector. Los
viriones que salen de estas células son capaces de infectar por una
VRODYH]VXVFpOXODVEODQFRSHURHVWDVFpOXODVQRSRGUiQSURGXFLU
SURJHQLH vectores virales suicidas 4. INTERACCIONES
NO GENÉTICAS ENTRE VIRUS
Una serie de interacciones no genéticas que ocurre entre los virus
puede afectar los resultados de los estudios genéticos al enmascarar el verdadero genotipo.
4.1. HETEROCIGOSIS
Dado que, en general, los virus no poseen un número diploide
de cromosomas, no puede hablarse de homo y heterocigotas.
Sin embargo, los genomas de los retrovirus son diploides y conVLVWHQHQGRVPROpFXODVGHO51$JHQyPLFRGHPDQHUDTXHHQ
este caso los virus pueden ser heterocigotas para cualquiera de
sus genes. Otro caso particular es el de varios virus a DNA, que
contienen regiones repetidas donde es factible la heterocigosis
KHUSHVVLPSOH[ En virus envueltos, con genomas haploides, es posible encontrar partículas multiploides como resultado de un empaquetamiento poco prolijo. En este caso, cuando de una coinfección con dos
YDULDQWHV SRUHMHPSORGRVPXWDQWHVts UHVXOWDODSURGXFFLyQGH
XQDSDUHQWHUHFRPELQDQWH FRQIHQRWLSRwt a partir de mutantes ts éste segrega las dos variantes originales luego de su aislamiento y
FXOWLYR )LJXUD Esto es así porque en los heterodiploides o multiploides producidos en coinfecciones con dos virus defectivos en dos genes distintos el
IHQRWLSRHVVLOYHVWUH wt \DTXHODFRPSOHPHQWDFLyQHVWiDVHJXUDGD
por la presencia de ambos genomas.
No se han descrito casos de heterocigosis ni partículas multiSORLGHVHQYLUXVQRHQYXHOWRVGHELGRDTXHH[LVWHQPD\RUHVUHVWULFciones en el empaquetamiento y es improbable que dos moléculas
GHXQJHQRPDSXHGDQDFRPRGDUVHHQXQDFiSVLGHYLUDO
4.2. INTERFERENCIA
La interferencia en el crecimiento entre dos virus homólogos o muy
relacionados se observa cuando alguno de los dos posee una venWDMDVREUHHORWUR3XHGHRFXUULUHQGLVWLQWDVHWDSDVGHODLQIHFFLyQ
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
68
A
B
Coinfección 1
Progenie 1
Recombinante
verdadero
Heterodiploide
aislamiento
infección 2
Progenie 2
Progenie 2
ĸ
Sólo una fracción
ĸ de la progenie es wild type
(exhibe el fenotipo wt)
Todos son wild type
(todos exhiben el fenotipo wt)
Figura 4.5. Heterocigosis. (QHOHMHPSORHVTXHPDWL]DGRHQOD¿JXUDODFRLQIHFFLyQFRQGRVPXWDQWHVtsHQORVJHQHV$\%UHVSHFWLYDPHQWHSURGXFHXQDSURJHQLHFRPSXHVWDSRUGLVWLQWRVWLSRVGHSDUWtFXODVYLUDOHV$GHPiVGHYLULRQHVLGpQWLFRVDORVSDUHQWDOHV ts), se
SXHGHQDLVODUYLULRQHVFDSDFHVGHUHSOLFDUVHDWHPSHUDWXUDQRSHUPLVLYD(VWRV~OWLPRVSXHGHQVHUUHFRPELQDQWHVYHUGDGHURV FRQODV
versiones wtGHORVJHQHV$\% RKHWHURGLSORLGHVTXHFRQWLHQHQGRVFRSLDVGHORVJHQRPDVFRQODVPXWDFLRQHVtsHQORVJHQHV$\%
$PERVYLUXVVRQFDSDFHVGHLQIHFWDU\GDUXQDQXHYDSURJHQLHHQFRQGLFLRQHVQRSHUPLVLYDV0LHQWUDVODLQIHFFLyQFRQORVUHFRPELQDQWHV
wtSURGXFHXQWLSRGHYLULRQHVORVKHWHURGLSORLGHVJHQHUDQXQDFROHFFLyQGHSDUWtFXODVYLUDOHVHQODTXHVRODPHQWHXQDSDUWHVLJXHVLHQGR
KHWHURGLSORLGH IHQRWLSRwt) y se observa la segregación de los genotipos parentales (tsA y ts% DGVRUFLyQ SRUHMHPSORHOSDUDPL[RYLUXV1'9 SHQHWUDFLyQ reWURYLUXV RUHSOLFDFLyQ PXFKRVYLUXV La interferencia homóloga a nivel de replicación se debe por lo
general a partículas DI GHIHFWLYDVLQWHUIHUHQWHV TXHVHDFXPXODQ
SRUSDVDMHVVXFHVLYRVGHLQIHFFLRQHVFRQDOWDPXOWLSOLFLGDG6HKD
GHVFULWRHQYDULDVIDPLOLDVGHYLUXVD51$ Rhabdo, Toga, Orthomyxo, Paramyxo \HQDOJXQRVD'1$ Herpes 1RUPDOPHQWH
las partículas DI contienen las mismas proteínas que las partículas
HVWiQGDUSHURVXVJHQRPDVVRQPiVFRUWRVGHELGRDODVGHOHFLRQHV
(QDOJXQRVFDVRVHOWDPDxRGHODVSDUWtFXODV',HVPiVSHTXHxR
SRUHMHPSOR969 Las partículas DI son defectivas en replicación y requieren que
XQYLUXVQRUPDOFRLQIHFWHODVPLVPDVFpOXODV DFWXDQGRFRPRDX[LOLDU
o helper SDUDSRGHUUHSOLFDUVH'HVSXpVGHYDULRVSDVDMHVVHULDGRVHO
WtWXORGHODVSDUWtFXODV',DXPHQWDFRQUDSLGH]OXHJRODSURSRUFLyQ
GHYLUXVHVWiQGDUHQODSURJHQLHGLVPLQX\H\¿QDOPHQWHEDMDHQ
IRUPDSURJUHVLYDODSURGXFFLyQGHYLUXVWRWDO DXWRLQWHUIHUHQFLD (Q
algunos casos, esta secuencia conduce a una infección persistente,
PDQWHQLHQGRXQEDODQFHHQWUHODVSDUWtFXODVHVWiQGDU\ODV',
Los virus DI contienen, generalmente, deleciones internas
SHURUHWLHQHQODVVHFXHQFLDVQXFOHRWtGLFDVGHORVH[WUHPRVTXH
son importantes para la replicación de los virus a RNA. En los
virus DI a DNA se conserva el origen de replicación y, a veces, se
encuentra repetido. En todos los casos, para causar interferencia
los genomas DI deben replicarse. Para hacerlo utilizan la replicaVDGHOYLUXVQRUPDOFRPSLWLHQGRH¿FLHQWHPHQWHFRQORVJHQRPDV
normales por esta enzima. De esta manera, los genomas normales
encuentran menos enzima disponible para su propia replicación.
$GHPiVGHODinterferencia homóloga, se conoce la interferencia heteróloga, cuyo mecanismo es variable y ocurre entre virus
no relacionados.
3RUHMHPSORHO51$GHO1'9 Paramyxo QRUHSOLFDHQFpOXlas previamente infectadas con algunos otros virus como Sindbis
Toga SUREDEOHPHQWHSRUTXHIRUPDDOJ~QFRPSOHMRLQDFWLYRFRQ
OD51$UHSOLFDVDGHOYLUXVLQWHUIHUHQWH ORVPXWDQWHVGH6LQGELV
GH¿FLHQWHVHQ51$UHSOLFDVDQRLQWHU¿HUHQ (OYLUXVSROLR Picorna LQWHU¿HUHFRQODPXOWLSOLFDFLyQGHRWURVYLUXVD51$GHELGRD
la alteración que produce en la maquinaria de biosíntesis de pro-
WHtQDVGHODFpOXODKRVSHGHUD TXHHQODVLQIHFFLRQHVSURGXFWLYDV
con picornavirus debe reconocer mRNAs sin cap 4.3. MEZCLA FENOTÍPICA
En una célula infectada por un par de virus relacionados pueden
producirse viriones compuestos por proteínas estructurales de amERV\HOJHQRPDGHXQRXRWUR )LJXUD (VWHSURFHVRVHFRQRFH
como mezcla fenotípica y ocurre porque las proteínas homólogas
FRQODPLVPDIXQFLyQ\HVWUXFWXUDVPX\VLPLODUHV GHXQR\RWUR
YLUXVSXHGHQVXVWLWXLUVHXQDVDRWUDVHQODIRUPDFLyQGHFiSVLGHV
\HQHOHQVDPEODMHFRQHOPDWHULDOJHQpWLFR SRUHMHPSORSROLRYLUXVWLSRV\ /DVcaracterísticas antigénicas de tales partículas
HVWiQGDGDVSRUODVSURWHtQDVH[WHUQDV\QRUHÀHMDQODLGHQWLGDG
del genoma.
(QHOFDVRGHORVYLUXVHQYXHOWRVODVQXFOHRFiSVLGHVGHXQYLrus pueden encerrarse en la membrana lipídica con glicoproteínas
FRGL¿FDGDVSRURWURYLUXVTXHFRLQIHFWDODFpOXOD(VWHIHQyPHQR
de mezcla fenotípica se conoce como formación de pseudotipos.
3RUHMHPSORHQFRLQIHFFLRQHVGH969FRQDOJXQRVretrovirus se
forman pseudotipos que pueden ser neutralizados con anticuerpos
anti-VSV.
5. INTERACCIONES
GENÉTICAS ENTRE LOS VIRUS
Y LA CÉLULA HOSPEDERA
5.1. TRANSFORMACIÓN
La transformación de un cultivo celular se mide por una variedad de
PRGL¿FDFLRQHVGHSDUiPHWURVPRUIROyJLFRVELRTXtPLFRV\GHFUHFLmiento y, con frecuencia, por la capacidad de formar tumores por inoculación en animales seleccionados. Varios virus con genoma a DNA
HVSHFLHVGHODVÀLDV Polyoma y Papilloma, y algunos adeno y herpesYLUXV VRQFDSDFHVGHWUDQVIRUPDUOtQHDVFHOXODUHVHQODVTXHQRSXHden llevar a cabo el ciclo de replicación completo. La transformación
UHTXLHUHODH[SUHVLyQGHXQJHQYLUDO SRUHMHPSORHODQWtJHQR7GHO
SRO\RPDYLUXV69 \GHSHQGHWDPELpQGHODH[SUHVLyQGHDOJXQRV
JHQHVFHOXODUHV SRUHMHPSORODSURWHtQDFHOXODUS 69
Capítulo 4 / Genética viral
Figura 4.6. Mezcla fenotípica. /DFRLQIHFFLyQGHXQDPLVPDFpOXODFRQGRVYLUXVHPSDUHQWDGRV\ GRVVHURWLSRVHQHVWHHMHPSOR SURGXFH
XQDSURJHQLHFRPSXHVWDSRUGLVWLQWRVWLSRVGHSDUWtFXODVYLUDOHV DGHPiVGHODVSDUHQWDOHV HQODVTXHHOiFLGRQXFOHLFRGHOJHQRWLSRUHVXOWD
HPSDTXHWDGRSRUXQDPH]FODSURWHtQDVHVWUXFWXUDOHVGHtipo 1 y 2 (PH]FODIHQRWtSLFD HOiFLGRQXFOHLFRGHOJHQRWLSRHQFHUUDGRHQODHVWUXFWXUD
de proteínas del WLSR SVHXGRWLSR RYLFHYHUVDHWF&XDQGRVHWUDWDGHGRVYLUXVQRHPSDUHQWDGRVVHIDYRUHFHODIRUPDFLyQGHSVHXGRWLSRV
SRUHMHPSORJHQRPDVGHUHWURYLUXV\HQYROWXUDGHUKDEGRYLUXV En los retrovirus la replicación y la transformación no son
PXWXDPHQWHH[FOX\HQWHVDXQTXHQRHVQHFHVDULRTXHRFXUUDOD
replicación. La transformación ha sido estudiada in extenso en
los retrovirus de tipo C que causan leucemias y sarcomas. En los
diferentes grupos de retrovirus los mecanismos de transformación
parecen transcurrir por mecanismos diferentes.
El genoma de los virus de VDUFRPDGH5RXV 569 FRQWLHQH
un oncogén, indispensable para la transformación. Se han descriWRPiVGHWUHLQWDRQFRJHQHVTXHUHSUHVHQWDQYHUVLRQHVDOWHUDGDV
FRQDOJXQRVFDPELRVHQODVVHFXHQFLDVQXFOHRWtGLFDV GHORVJHQHV
KRPyORJRVFHOXODUHV TXHSDUWLFLSDQHQWUDQVGXFFLyQGHVHxDOHV
FRQWUROGHOFLFORFHOXODUHWF \TXHIXHURQDGTXLULGRVSRUGLVWLQWRV
retrovirus.
Los virus de leucemia, en cambio, no contienen oncogenes en
sus genomas y transforman luego de un período de latencia muy
prolongado. Generalmente, los virus producidos por las células
transformadas no han adquirido oncogenes de origen celular. El
PRGHORSURSXHVWRSDUDH[SOLFDUHOHIHFWRWUDQVIRUPDQWHVHEDVDHQ
la inserción del provirus en el DNA celular de manera tal que un
SURWRRQFRJpQFHOXODUTXHGDEDMRHOFRQWUROWUDQVFULSFLRQDOGHXQ
promotor viral.
5.2. INTEGRACIÓN
Los genomas de los virus transformantes a DNA se encuentran por
lo general integrados en el genoma de la célula hospedera transformada. El número de copias del genoma viral insertado en el DNA
FHOXODUYDUtDHQWUH\\WDPELpQHVYDULDEOHHOVLWLRGHintegraFLyQ/RVGDWRVH[SHULPHQWDOHVIDYRUHFHQHOPRGHORGHintegración
por recombinación ilegítima entre secuencias no homólogas del
DNA viral y celular.
La integración de los genomas de retrovirus en el estado de
SURYLUXVWDPSRFRRFXUUHHQXQVLWLR¿MRGHO'1$FHOXODUSHURHQ
HOJHQRPDYLUDOH[LVWHXQVLWLRGH¿QLGRSDUDODintegración, que
RFXUUHGHPDQHUDVLPLODUDODGHORVWUDQVSRVRQHV UHWURSRVRQHV
\UHWURWUDQVSRVRQHV 5HVXOWDPX\LQWHUHVDQWHTXHXQDSURSRUFLyQ
VLJQL¿FDWLYDGHO'1$KXPDQR FRQVLVWDHQVHFXHQFLDVUH-
petidas, en gran parte relacionadas a retrovirus, que tuvieron una
importante incidencia en la HYROXFLyQGHOJHQRPD LQVHUFLyQGHleción, duplicación de segmentos de DNA, generación de familias
GHJHQHV 5.3. INFECCIÓN PERSISTENTE
Cuando un virus lítico establece una infección persistente en un
KXpVSHGVXVFHSWLEOHVHHMHUFHQSUHVLRQHVGHVHOHFFLyQWDQWRVREUH
el virus como sobre la célula hospedera. El virus debe cambiar
para no dañar a la célula en la que se mantiene o, alternativamente,
la célula debe cambiar para soportar la replicación viral sin ser
OLVDGD$PEDVVLWXDFLRQHVKDQVLGRGRFXPHQWDGDVH[SHULPHQWDOmente.
6. EVOLUCIÓN
VIRAL
La evolución viral es observable, sobre todo a nivel fenotípico, a través de la variación antigénica y la resistencia a agentes
TXLPLRWHUiSLFRV(QHVWDVHFFLyQQRVFRQFHQWUDUHPRVHQODvaULDFLyQDQWLJpQLFD UHDFWLYLGDGIUHQWHDDQWLFXHUSRV DXQTXHORV
FRQFHSWRVVRQH[WHQVLYRVDRWURVFDUDFWHUHVIHQRWtSLFRV(VWDV
variaciones surgen como resultado de las sustituciones de amiQRiFLGRVHQORVGRPLQLRVGHODVSURWHtQDVTXHLQWHUDFW~DQFRQ
los componentes del sistema inmune. Las mutaciones puntuales,
deleciones e inserciones, como también el reemplazo de genes
enteros o segmentos genómicos por recombinación o reasociaFLyQ reassortment SXHGHQSURGXFLUYLULRQHVFRQSURSLHGDGHV
antigénicas alteradas.
En poblaciones virales se encuentran variantes resistentes a un
DQWLFXHUSRPRQRFORQDOQHXWUDOL]DQWHFRQIUHFXHQFLDVGHD.
3HUR¢FyPRHVWDVYDULDQWHVSUHVHQWHVHQSURSRUFLRQHVWDQEDMDV
se convierten en predominantes en las poblaciones virales durante
HOGHVDUUROORGHODHQIHUPHGDGRGXUDQWHDOJ~QEURWHHSLGpPLFR"
1RVUHIHULUHPRVDTXtDODGLYHUVL¿FDFLyQDQWLJpQLFDHQORVYLUXVD
RNA, por ser en estos casos donde los cambios se aprecian en una
HVFDODPiVGUDPiWLFD
70
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
La variación genética observada en los virus a RNA es el resultado de, al menos, dos procesos diferentes: la generación de
PXWDQWHV\VXH¿FLHQFLDFRPSHWLWLYDIUHQWHDORVGHPiVYLUXVGHOD
población. La generación de genomas mutantes durante la replicación viral es una consecuencia inevitable de la naturaleza de las
HQ]LPDVTXHFRPHWHQHUURUHV 51$SROLPHUDVDVR51$UHSOLFDVDV
de los virus a RNA y transcriptasas inversas de UHWURYLUXVYHUPiV
DUULED $OJ~Qtipo particular de mutación puede estar favorecido
o impedido por condiciones tales como la naturaleza de la enzima
YLUDOHOFRQWH[WRGHODVHFXHQFLDQXFOHRWtGLFD SRUHMHPSORXQD
VHFXHQFLD1$$$$$111 ODFRQFHQWUDFLyQGHORVGLVWLQWRVQXcleótidos en los poolesFHOXODUHV ODLQFRUSRUDFLyQGHXQD*HQHO
lugar que corresponde a otro nucleótido estaría favorecida por una
FRQFHQWUDFLyQUHODWLYDPHQWHDOWDGH*73IUHQWHDORVRWURV173V etc. Las frecuencias de mutación tan grandes como las indicadas
PiVDUULEDDVHJXUDQTXHHQFDGDFpOXODLQIHFWDGD \SRUVXSXHVWR
HQXQRUJDQLVPRHQWHUR VHJHQHUHQPXFKRVPXWDQWHV WDOFRPRVH
ha probado utilizando la técnica de 57PCR que evita la necesidad
GHQXHYRVSDVDMHVHQFXOWLYRVFHOXODUHV (VPX\GLItFLOGHLPDJLnar que en la replicación de virus a RNA no aparezca al menos un
nucleótido cambiado por genoma y, por lo tanto, las poblaciones
de virus son en realidad una mezcla de JHQRWLSRV(VWRVH[LVWHQ
HQODIRUPDGHXQDGLVWULEXFLyQGLQiPLFDTXHVHKDGDGRHQOODPDU
cuasiespecie quasispecies La frecuencia de PXWDFLyQVHUH¿HUHDODLQFRUSRUDFLyQGHYDriaciones en la secuencia nucleotídica durante la replicación del
genoma, y debe distinguirse de la frecuencia o proporción en que
encontramos un mutante determinado en la población. Esta última
es el resultado de la frecuencia de PXWDFLyQSHURDGHPiVGHOD
competencia entre ese mutante y todas las otras variantes geneUDGDV ¿WQHVV /DFRPSHWLWLYLGDGGHOPXWDQWHSXHGHUHVXOWDUGH
ODH¿FLHQFLDUHODWLYDGHFXDOTXLHUDGHORVSURFHVRVELRTXtPLFRV
en el ciclo de vida del virus: replicación del genoma, síntesis y
procesamiento de proteínas, ensamble de partículas, liberación a
partir de las células infectadas, estabilidad de los viriones fuera
de la célula, etc.
En el término de varias generaciones, la evolución de los geQRPDVYLUDOHVVHYHUiLQÀXHQFLDGDDGHPiVSRUODVHOHFFLyQSRsitiva y el muestreo al azar, tal como ocurre cuando unas pocas
partículas virales son transmitidas de un individuo infectado a
RWURKRVSHGHURVXVFHSWLEOH HIHFWRGHFXHOORGHERWHOODgenetic
bottleneck)LJXUD Por mucho tiempo se ha supuesto que la variación antigénica era el resultado de la selección directa de variantes causada
por las respuestas humorales y/o celulares del sistema inmune
GHOKRVSHGHUR VHOHFFLyQQHJDWLYDGHODVYDULDQWHVDQWLJpQLFDV
RULJLQDOHVSUHGRPLQLRGHODVQXHYDVYDULDQWHVTXHHVFDSDQDOD
reacción con los DQWLFXHUSRVSUHVHQWHV 6LQHPEDUJRHQHVWXGLRV
realizados en ausencia de anticuerpos DQWLYLUDOHV SRUHMHPSOR
en FXOWLYRVFHOXODUHVHQLQGLYLGXRVLQPXQRGHSULPLGRV WDPELpQ
DSDUHFHQYDULDQWHVDQWLJpQLFDVSUHGRPLQDQWHV KHUSHVVLPSOH[
y especies de Picorna, Lenti, Paramyxo, Orthomyxo ([LVWHQ
HYLGHQFLDVH[SHULPHQWDOHVFRQVLGHUDEOHVVREUHHVWHIHQyPHQR
en infecciones de organismos enteros, en los que la respuesta de
anticuerpos neutralizantes no es determinante directa de la preYDOHQFLDGHXQDGHWHUPLQDGDYDULDQWHDQWLJpQLFD$VtSRUHMHPplo, el grado de YDULDFLyQDQWLJpQLFDHQODVSURWHtQDVH[WHUQDVGH
SDUDPL[RYLUXVHVVLPLODUDOREVHUYDGRHQVXSROLPHUDVD TXHQR
es blanco de los DQWLFXHUSRVQHXWUDOL]DQWHV &RPRHMHPSORVHSXHGHFLWDUXQDYDULDQWHDQWLJpQLFDSUHdominante del virus de LQÀXHQ]DSRUFLQD JHQHUDGRHQDXVHQFLDGHSUHVLyQVHOHFWLYDSRUXQDQWLFXHUSRQHXWUDOL]DQWH TXH
FRQWHQtDXQFDPELRHQODVHFXHQFLDGHXQHStWRSH UHDFWLYLGDG
VHUROyJLFDGLVWLQWD 3RURWUDSDUWHHVWHFDPELRUHVXOWDEDHQ
XQDPD\RUH¿FLHQFLDHQODLQWHUDFFLyQGHOYLUXVFRQVXreceptor
celular, lo que favorecía la replicación de esta variante frente
DRWUDVFRQXQDPHQRUD¿QLGDGSRUORVUHFHSWRUHV VHOHFFLyQ
SRVLWLYDGHOPXWDQWH 'HPDQHUDTXHODGLYHUVL¿FDFLyQDQWLJpQLFDGHSHQGHGHODJHQHUDFLyQHVWRFiVWLFDGHPXWDQWHVGHODVHOHFFLyQSRVLWLYDGHDTXHOORVTXHHVWpQPHMRUDGDSWDGRVDODPELHQWHTXHVXVSURJHQLWRUHV
o los elegidos al azar, de acuerdo al efecto de cuello de botella y
la probabilidad de incorporar otras mutaciones adicionales con
HIHFWRPiVQHXWUR WROHUDGDVSRUODVHOHFFLyQQHJDWLYD 7. TÉCNICAS
DE BIOLOGÍA MOLECULAR
PARA EL ANÁLISIS DE GENOMAS
La biología molecular moderna provee al virólogo una serie de
PHWRGRORJtDV\KHUUDPLHQWDVTXHSHUPLWHQHODQiOLVLVGHWDOODdo de los genomas virales. En particular, la determinación de
secuencias nucleotídicas de genomas y la comparación de los
PLVPRVFRQWULEX\HDHVWDEOHFHUXQDWD[RQRPtDPiVUDFLRQDO\
al establecimiento de las relaciones evolutivas de los distintos
JUXSRVWD[RQyPLFRV(OFRQRFLPLHQWRGHODVHFXHQFLDQXFOHRWtdica también permite establecer relaciones de parentesco entre
distintos aislamientos de virus, elucidar los orígenes de un brote
epidémico, deducir cómo aparecieron nuevas variantes virales,
establecer puntos de recombinación, deleción o inserción en un
genoma y hacer inferencias sobre los virus parentales, etc. El
DGYHQLPLHQWRGHODUHDFFLyQHQFDGHQDGHODSROLPHUDVD 3&5 y su combinación con la síntesis de cDNA utilizando transcripWDVDLQYHUVD 573&5 KDQSRVLELOLWDGRODREWHQFLyQGHGDWRVGH
secuencias nucleotídicas a partir de cantidades escasas de material infectado y son técnicas poderosas que no dependen de la
posibilidad de propagar el virus en condiciones de laboratorio.
La automatización de la determinación de secuencias nucleotídicas la ha convertido en el procedimiento rutinario de elec-
Figura 4.7. Efecto del cuello de botella. 'XUDQWHODUHSOLFDFLyQGHXQYLUXVHQXQLQGLYLGXR RHQXQDFpOXOD DSDUHFHQPXWDQWHVHVSRQWiQHRVTXHFRQVWLWX\HQXQDSREODFLyQ$&XDQGRVyORXQQ~PHUROLPLWDGRGHYLULRQHVGHHVWDSREODFLyQ$DOFDQ]DDLQIHFWDUDRWUR
LQGLYLGXRVHJHQHUDXQDSURJHQLH SREODFLyQ% HQODTXHODVSURSRUFLRQHVGHODVYDULDQWHVJHQyPLFDVUHVXOWDGLIHUHQWHGHODTXHVH
HQFRQWUDEDHQODSREODFLyQRULJLQDO
Capítulo 4 / Genética viral
71
YLUDORULJLQDOVyORVHFRQVHUYHQODVVHFXHQFLDVWHUPLQDOHV/75
long terminal repeats \VHrellena el medio GLVWDQFLDHQWUHGLFKDVVHFXHQFLDVWHUPLQDOHV FRQHOJHQGHHOHFFLyQ
/RVYLUXVJUDQGHVD'1$ YDFFLQLDEDFXOR FRQJHQRPDVGH
DSDUHVGHEDVHVQRSXHGHQFRUWDUVH\UHDUPDUVH
in vitro con facilidad utilizando enzimas de restricción y DNA
ligasa. Por ello, los genes a insertar habitualmente se introducen
SULPHURHQSOiVPLGRVDSURSLDGRV(QHVWDVFRQVWUXFFLRQHVHOJHQ
FORQDGRVHHQFXHQWUDÀDQTXHDGRSRUVHFXHQFLDVFRUWDVFRUUHVSRQdientes, en general, a un gen no esencial del virus que se utilizar
FRPRYHFWRU(VWHSOiVPLGRVHLQWURGXFHHQODVFpOXODVVXVFHSWLEOHV
SRUWUDQVIHFFLyQMXQWRFRQHO'1$JHQyPLFRYLUDO SRUWUDQVIHFFLyQRSRULQIHFFLyQFRQHOYLUXVHQWHUR (QODFpOXODODSUHVHQFLD
FRQMXQWDGHDPERV'1$VRIUHFHODRSRUWXQLGDGSDUDTXHRFXUUD
8. VIRUS COMO VECTORES DE EXPRESIÓN DE GENES
la recombinación homóloga que reemplaza al gen viral por el gen
El reemplazo de genes virales no esenciales por recombinación FORQDGRÀDQTXHDGRSRUVHFXHQFLDVYLUDOHVREWHQLpQGRVHGHHVWD
in vitro e in vivo permite obtener vectores que son capaces de IRUPDXQYLUXVUHFRPELQDQWH0iVUHFLHQWHPHQWHVHGHVDUUROODURQ
inocularH¿FLHQWHPHQWHQXHYDLQIRUPDFLyQJHQpWLFDHQFpOXODVHQ metodologías muy ingeniosas que permiten replicar estos genomas
FXOWLYR\RUJDQLVPRVHQWHURV$VtVHDSURYHFKDQORVH[TXLVLWRV\ YLUDOHVHQEDFWHULDV\TXHLQFUHPHQWDQODH¿FLHQFLDHQODREWHQFLyQ
VR¿VWLFDGRVPHFDQLVPRVTXHKDQDGTXLULGRORVYLUXVDWUDYpVGH de virus recombinantes.
Los YHFWRUHVYLUDOHVSHUPLWHQH[SUHVDUJHQHVHQVLVWHPDVHXsu HYROXFLyQSDUDSHQHWUDUHQODFpOXODKRVSHGHUDFRQDOWDH¿FLHQcia e introducir su material genético. Probablemente haya pocos carióticos aprovechando la maquinaria de las células hospederas,
virus que no podrían ser usados como transportadores de genes ORTXHLQFOX\HODVPRGL¿FDFLRQHVGXUDQWH\GHVSXpVGHODWUDGXFFORQDGRVDXQTXHVHVHOHFFLRQDQDTXHOORVTXHPiVVHDGHFXDQDO ción. Las aplicaciones de estos vectores son múltiples, entre ellas,
la fabricación de YDFXQDVPiVVHJXUDV\HFRQyPLFDV\ODWHUDSLD
REMHWLYRGHVHDGR
/RVJHQRPDVGHORVYLUXVSHTXHxRVD'1$ 69%39 VH génica. Por otra parte, la potencial utilidad de algunos virus ha
SXHGHQPDQLSXODUIiFLOPHQWHin vitro HQXQWXERGHHQVD\R SDUD estimulado el estudio de su biología a nivel molecular detallado,
LQVHUWDUQXHYRVJHQHV\TXLWDUUHFRUWDURPRGL¿FDUVHFXHQFLDVQX- contribuyendo al crecimiento de la Virología como ciencia.
cleotídicas utilizando las herramientas habituales de la ingeniería
genética.
AGRADECIMIENTO
En los retrovirus se aprovecha la propiedad de integración en
el genoma de la célula hospedera. Esto requiere que del genoma $O'U$JXVWtQ(8UHSRUODSURGXFFLyQGHODV¿JXUDV
ción a la hora de caracterizar un nuevo aislamiento de virus.
Sin embargo, en distintos momentos de la historia reciente de la
genética molecular se desarrollaron variadas metodologías para
la caracterización de genomas, que brindan distinta información y son accesibles en la mayoría de los laboratorios de escasa
FRPSOHMLGDG SDWURQHVGHUHVWULFFLyQPCR-5)/3hibridación,
¿QJHUSULQWV5$3'V66&3HWF SDUDHVWDEOHFHUVLGRVYLUXVVRQ
iguales o diferentes.
El repertorio de armas bioquímicas con que cuenta la genética,
en general, y la genética molecular de virus, en particular, crece
con rapidez y, afortunadamente, es incorporado tanto a estudios
EiVLFRVFRPRFOtQLFRV\DSOLFDFLRQHVGLDJQyVWLFDVGHUXWLQD
Bibliografía
‡
‡
‡
%DQQHUW 1 .XUWK 5 5HWURHOHPHQWV DQG WKH KXPDQ JHQRme: New perspectives on an old relation". Proc Natl Acad Sci
&DQQ$Principles of Molecular Virology. Elsevier Academic Press,
%XUOLQJWRQ0$
(QTXLVW/:6NDOND$05DFDQLHOOR95)OLQW6- Principles of Virology: Molecular Biology, Pathogenesis, and Control of Animal Viruses.
nd(G$PHULFDQ6RFLHW\IRU0LFURELRORJ\:DVKLQJWRQ'&
‡
‡
0RUVH66Evolutionary biology of viruses5DYHQ3UHVV1HZ<RUN
6DOOLH55HSOLFDWLYHKRPHRVWDVLV,,,QÀXHQFHRISRO\PHUDVH¿delity on RNA virus quasispecies biology: Implications for immune
recognition, viral autoimmunity and other virus receptor diseases".
Virology J.9HUVLyQHOHFWUyQLFDJUDWXLWDHQKWWSZZZ
YLURORJ\MFRPFRQWHQW
5
Patogenia de las infecciones virales
Verónica Lidia Mathet - José Raúl Oubiña
1. INTRODUCCIÓN
(Q XQD LQIHFFLyQ YLUDO H[LVWHQ FLHUWRV HVWDGLRV REOLJDWRULRV TXH
permiten a los virus la diseminación de un hospedero a otro y por
ende, su mantenimiento en la naturaleza. Estos estadios son los
siguientes:
Infección inicial del hospedero. En esta etapa el virus se adVRUEH D FpOXODV VXVFHSWLEOHV \ OXHJR SHQHWUD HQ HO WHMLGR GHO
hospedero.
Diseminación de la infección. El virus puede multiplicarse y
diseminarse localmente o a través del cuerpo.
Egreso del virus al exterior.
(VWDV HWDSDV SXHGHQ RFXUULU D YHFHV VLQ FDXVDU HQIHUPHGDG
aparente en el hospedero: es el caso de las infecciones denominadas subclínicas o inaparentes. Por el contrario, en otras ocasiones
VHSURGXFHQVLJQRV\VtQWRPDVTXHSRGUiQVHURQRFDUDFWHUtVWLFRV
de la infección generada por un virus determinado. El tiempo que
transcurre entre la infección inicial del hospedero y la producción
de enfermedad corresponde al período de incubación de la misma.
(QHVWHFDStWXORVHGHVFULELUiQDOJXQRVHYHQWRVGHODUHODFLyQ
virus-hospedero: la entrada y diseminación de virus en el organismo, los mecanismos de lesión celular inducidos por acción viral
directa y aquellos que son el resultado de la respuesta del hospedero frente al virus o a algunos de sus componentes. La relación
virus-célula que posibilita la propagación viral se describe en el
FDStWXOR/DFDSDFLGDGRQFRJpQLFDGHDOJXQRVYLUXVVHDQDOL]DHQ
HOFDStWXOR(QHOFDStWXORVHGHWDOODQORVHYHQWRVUHODFLRQDGRV
con la constelación de factores vinculados a los mecanismos de
defensa del hospedero frente a la infección viral, mientras que en
HOVXEVLJXLHQWHFDStWXORVHDERUGDQORVGLYHUVRVmecanismos de
evasión viral a la respuesta inmune del hospedero y que también
forman parte de la patogénesis viral.
1.1. UNA APROXIMACIÓN AL VOCABULARIO
&RQHOREMHWLYRGHORJUDUTXHHOOHFWRUSXHGDDFFHGHUFRQPD\RU
IDFLOLGDGDODWHPiWLFDGHVDUUROODGDHQHVWHFDStWXORDFRQWLQXDFLyQ
VHPHQFLRQDHOVLJQL¿FDGRGHDOJXQRVWpUPLQRVXWLOL]DGRV6LELHQ
DOJXQRVDXWRUHVGHODOLWHUDWXUDDQJORVDMRQDKDQDGRSWDGRFRPR
sinónimo los términos patogenicidad y virulencia, en esta obra, dichos vocablos se asignan a conceptos diferentes.
Permisivas
Susceptibles
Figura 5.1. Células susceptibles y permisivas. 6RQVXVFHSWLEOHV
DODLQIHFFLyQSRUXQGHWHUPLQDGRYLUXVDTXHOODVTXHSRVHHQHOORV
UHFHSWRU HV >\ HYHQWXDO HV FRUUHFHSWRU HV @ SDUD HO PLVPR 6yOR
DTXHOODVTXHDGHPiVGHOreceptor ( ) poseen los factores de transFULSFLyQ TXHSHUPLWHQODH[SUHVLyQGHORVJHQHVYLUDOHVVRQ
SHUPLVLYDV7RGDFpOXODSHUPLVLYDHVVXVFHSWLEOHDXQTXHQRWRGDV
ODVVXVFHSWLEOHVVRQSHUPLVLYDV
agente etiológico consiguientemente asociado a una alta virulencia.
(QPRGRDQiORJRORVSDFLHQWHVTXHSDGHFHQUDELDKDELWXDOPHQWH
HYROXFLRQDQDOyELWRVLHQGR±SRUHQGH±Pi[LPDODYLUXOHQFLDGHO
virus homónimo. Por el contrario, uno de los agentes causales de
UHVIUtRFRP~QGHQRPLQDGRUKLQRYLUXVH[KLEHKDELWXDOPHQWHXQD
YLUXOHQFLDPX\EDMD
1.1.1. Patogenicidad
Este vocablo deriva del griego Pathos y gene TXH VLJQL¿FDQ HQfermedad y génesis, o "dar origen a". En otras palabras, implica la
FDSDFLGDGGHXQDJHQWHSDUDSURGXFLUHQIHUPHGDG3RUHMHPSORHO
virus sarampión es un agente altamente patógeno, ya que sobre un
número determinado de individuos infectados y no inmunizados
SUHYLDPHQWHODJUDQPD\RUtDGHHOORVGHVDUUROODUiHOFXDGURH[DQWHPiWLFR\VLVWpPLFRFDUDFWHUtVWLFR
Por el contrario, virus como polio o hepatitis A, cuando infectan lactantes menores de un año producen infecciones subclínicas
RLQDSDUHQWHVVLHQGR±SRUHQGH±VXSDWRJHQLFLGDGSUiFWLFDPHQWH
nula en ese grupo etario.
1.1.3. Células susceptibles y permisivas
/RVYLUXVSXHGHQLQWHUDFWXDUFRQODVXSHU¿FLHGHFpOXODVTXHH[SUHVDQUHFHSWRUHV\FRUUHFHSWRUHVSDUDORVPLVPRV YpDVHHOFDStWXOR y que pueden permitir su ingreso a aquellas. Dichas células reciben
la denominación de susceptibles. Sin embargo, el mero ingreso del
YLUXVDODFpOXODQRLPSOLFDTXHHQHOODHVWHDJHQWHSRGUiSURSDJDUVH
Se requiere la presencia de diversos factores celulares tales como
IDFWRUHVGHWUDQVFULSFLyQTXH±SRUHMHPSOR±SXHGHQLQWHUDFWXDUFRQ
ORVSURPRWRUHV\SRWHQFLDGRUHV enhancers GHOJHQRPDYLUDOSHUmitiendo la producción de progenie viral. A las células que disponen
de los factores necesarios para la replicación viral se las denomina
permisivas. En síntesis, toda célula permisiva es susceptible, mas no
WRGDFpOXODVXVFHSWLEOHVHUiSHUPLVLYD )LJXUD &RPRHMHPSOR
H[LVWHQHQHOVHUKXPDQRUHFHSWRUHVSDUDHOYLUXVpolio en órganos
WDQGLYHUVRVFRPR±HQWUHRWURV±FRUD]yQULxyQSXOPyQDGHPiVGHO
SNC. Sin embargo, el virus a pesar de dichos receptores, no puede
producir progenie en corazón, pulmón o riñón dado que las células
de estos órganos son susceptibles pero no permisivas al virus, en
contraposición con lo observado en el SNC.
1.1.2. Virulencia
,QGLFD OD JUDYHGDG GH OD HQIHUPHGDG 3RU HMHPSOR ORV HQIHUPRV
de SROLRPLHOLWLVH[KLEHQVHYHUDVUHVWULFFLRQHVPRWRUDVHVWDQGRHO
1.1.4. Determinantes del tropismo viral
6LELHQKDVWDODGpFDGDGHVHDFHSWDEDTXHHOWURSLVPRYLUDOGHpendía únicamente de la interacción entre los receptores y correcep-
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
74
Diseminación viral en el organismo
Superficie:
1- piel / mucosa
2- tracto gastrointestinal
3- tracto respiratorio
+
Sitios de replicación
Egreso viral del organismo
Infección
+
Ganglio linfático
+
1- Herpes simplex*
HPV
2- Norovirus
Rotavirus
3- Influenza
RSV
Adenovirus
Replicación en
puerta de entrada
Sangre
(viremia primaria)
Bazo
Hígado
Médula
ósea +
+
+
Sitios de
replicación
Músculo
+
Endotelio de
vasos sanguíneos
+
HIV
HBV
HCV
Sangre
(viremia secundaria)
Sitios de
replicación
Piel
+
Mucosa
+
Pulmón
+
Corazón
+
Riñón
+
Tracto
gastrointestinal
+
Glándulas
salivales
+
Encéfalo
+
Transmisión a
otro hospedador
Varicela-zóster*
Enterovirus
Rhinovirus
Sarampión
Varicela-zóster*
Arenavirus
Hantavirus
Coxsackie B**
Arenavirus
Hantavirus
Rotavirus
Enterovirus
Reovirus
Rabia*
Parotiditis
Poliovirus**
Togavirus**
Figura 5.2. Entrada, diseminación y egreso viral del organismo. /RVYLUXVSXHGHQLQJUHVDUDORUJDQLVPROXHJRGHLQIHFWDUXQDGHWHUPLQDGDVXSHU¿FLH SLHOPXFRVDRWUDFWRHVSHFt¿FR /DLQIHFFLyQSXHGHTXHGDUFLUFXQVFULSWDDGLFKRVLWLR ORFDOL]DGD RGLVHPLQDUVH VLVWpPLFD 'HVGHODVXSHU¿FLHHSLWHOLDOORVYLUXVSXHGHQVHUWUDQVSRUWDGRVKDFLDORVJDQJOLRVUHJLRQDOHV'HVGHDOOtORVYLUXVVRQYHUWLGRVD
ODVDQJUHGXUDQWHXQEUHYHSHUtRGRGHWLHPSR\HQEDMDFXDQWtD YLUHPLDSULPDULD ORTXHSHUPLWHODGLVHPLQDFLyQDyUJDQRVFRPRKtJDGR
ED]RPpGXODyVHDP~VFXOR\HQGRWHOLRYDVFXODU/XHJRGHUHSOLFDUDOOtVHSURGXFHXQDYLUHPLDVHFXQGDULDGHPD\RUGXUDFLyQ\FXDQWtD
DWUDYpVGHODFXDOORVYLUXVDOFDQ]DQFpOXODVEODQFRSHUPLVLYDV6HPHQFLRQDQVyORDOJXQRVHMHPSORVLOXVWUDWLYRV(QHVWHGLDJUDPDQR
VHLQGLFDODYtDGHGLVHPLQDFLyQQHXUDOGHDOJXQRVYLUXV FRPRRFXUUHFRQODUHFXUUHQFLDGHOYLUXVYDULFHOD]yVWHUDVRFLDGRDO]yVWHU
RFRQODUHFXUUHQFLDGHOKHUSHVVLPSOH[RODGLVHPLQDFLyQQHXUDOGHOYLUXVUDELD0~OWLSOHVYLUXVDOFDQ]DQHOyUJDQREODQFR\DSDUWLUGH
VXUHSOLFDFLyQDOOtSXHGHQWUDQVPLWLUVHDRWURRUJDQLVPRVLQHPEDUJRDOJXQRVYLUXVHQFXHQWUDQXQDYtDPXHUWDHQGLFKRyUJDQRVLQ
GLVHPLQDUVHDOH[WHULRUDSDUWLUGHpVWH'HWRGDVIRUPDVDSHVDUGHGLFKRLPSHGLPHQWRDQDWyPLFRSXHGHQLJXDOPHQWHWUDQVPLWLUVHDO
H[WHULRU \DTXHHJUHVDQGHORUJDQLVPRSRURWUDVYtDV
WRUHVGHODVXSHU¿FLHFHOXODUFRQHOOLJDQGRHVSHFt¿FRYLUDO SUHVHQWH
HQODVXSHU¿FLHGHODVSDUWtFXODVHQYXHOWDVRGHVQXGDV GLYHUVRVH[perimentos demostraron que los receptores son necesarios pero insu¿FLHQWHVSDUDGHWHUPLQDUGLFKRWURSLVPR$FWXDOPHQWHVHDFHSWDTXH
son también relevantes las interacciones entre los factores transcripcionales celulares con las polimerasas virales y/o con los promotores
y enhancers del genoma viral. En ciertas circunstancias, un único
cambio aminoacídico en la polimerasa viral, ha permitido cambiar
el tropismo de un virus, tal como se observó en la infección murina
H[SHULPHQWDOFRQHOYLUXVGHODFRULRPHQLQJLWLVOLQIRFLWDULD /&0 (QORVtWHPVVXEVLJXLHQWHVVHPHQFLRQDUiQHMHPSORVLOXVWUDWLYRVGHYLUXVTXHDSDUWLUGHGLIHUHQWHVSXHUWDVGHHQWUDGD )LJXUD
SURPXHYHQLQIHFFLRQHVFRQXQDHVSDFLDOLGDGORFDOL]DGDRVLVtémica. Asimismo, las diversas infecciones virales pueden clasi¿FDUVH VHJ~Q VX WHPSRUDOLGDG DJXGDV R SHUVLVWHQWHV \ DIHFWDUD
LQGLYLGXRVLQPXQRFRPSHWHQWHVRLQPXQRVXSULPLGRV )LJXUD YH]HVWiLQÀXHQFLDGRSRUODSXHUWDGHHQWUDGD\ODYtDGHGLVHPLQDción del agente.
Desde el punto de vista de la puerta de entrada al organismo,
ORVYLUXVSXHGHQLQJUHVDUSRUGLYHUVDVYtDV0iVD~QDOJXQRVYLUXV
SRVHHQPiVGHXQDSXHUWDDOWHUQDWLYD$OJXQRVHMHPSORVVHLQGLFDQ
HQOD7DEOD
2.1 PIEL
'DGRTXHpVWHHVHOyUJDQRPiVJUDQGHGHOFXHUSRKXPDQR\WHQLHQGRHQFXHQWDTXHHVWiFRQVWLWXLGRSRUFpOXODVPXHUWDVHQVXVFDSDVPiV
H[WHUQDV UHFXpUGHVHTXHORVYLUXVUHSOLFDQVyORHQFpOXODVYLYDV HV
comprensible que constituya una importante barrera para el ingreso de
estos agentes infecciosos. Sin embargo, los virus pueden penetrar diFKDEDUUHUDHQORVVLWLRVHQORVTXHODPLVPDHVWiGDxDGD7DOHVHOFDVR
GHODHQWUDGDGHOYLUXVUiELFRHQHOOXJDUGHODPRUGHGXUDSURGXFLGD
SRUHMHPSORSRUSHUURV]RUURVRPXUFLpODJRV$VLPLVPRORVDUERYLUXV
penetran la piel al ser introducidos mediante la picadura de artrópodos,
2. PUERTAS DE ENTRADA
WDO FRPR VH REVHUYD FRQ HO YLUXV GH OD ¿HEUH DPDULOOD YHKLFXOL]DGR
El evento inicial en el ciclo de replicación viral es la adherencia a en la saliva de Aëdes aegypti. Las FpOXODVGHQGUtWLFDV &' GHODSLHO
FpOXODVGH/DQJHUKDQV>[email protected]\~RWUDVcélulas dendríUHFHSWRUHVHVSHFt¿FRVFHOXODUHV véase el capítulo 2 y el ítem 6 de
este capítulo /DSUHVHQFLDRDXVHQFLDGHGLFKRVUHFHSWRUHVSXHGH WLFDVLQPDGXUDVGHODGHUPLV\HOLQWHUVWLFLR>TXHH[SUHVDQODPROpFXOD
repercutir sobre el espectro de hospederos susceptibles a la infec- '&6,*1 Dendritic Cell -SSHFL¿FIntercellular adhesion moleculeción viral, así como en el tropismo tisular de los virus, el que a su 3-Grabbing Non-integrinR&' @IXHURQSRVWXODGDVVXFHVLYDPHQ-
75
Capítulo 5 / Patogenia de las infecciones virales
1) VIRUS QUE PENETRAN A TRAVÉS DE PIEL O MUCOSAS
A través de microtraumas
Hepadnaviridae
+HSDWLWLV%
Papilomaviridae
3DSLORPDYLUXVWRGRVORVWLSRV
Herpesviridae
+HUSHVVLPSOH[\
Poxviridae
0ROXVFRFRQWDJLRVR
Arenaviridae
-XQtQ
Flaviviridae
+HSDWLWLV&
Transmitidos por artrópodos
Poxviridae
7DQDSR[YLUXV
Flaviviridae
'HQJXH¿HEUHDPDULOODYLUXVGHO2HVWHGHO1LOR
Togaviridae
(QFHIDOLWLVGH6DQ/XLV
Reoviridae
Fiebre por garrapatas de Colorado
Bunyaviridae
Fiebre del Valle de Rift
Transmitidos por vertebrados
Rhabdoviridae
Rabia
Transmitidos mediante inyección
Hepadnaviridae
+HSDWLWLV%
Retroviridae
9LUXVGHODLQPXQRGH¿FLHQFLDKXPDQD
Herpesviridae
&LWRPHJDORYLUXVKXPDQR(SVWHLQ%DUU
Filoviridae
Ébola
Flaviviridae
+HSDWLWLV&
Tracto genital
Papilomaviridae
7LSRVJHQLWDOHV HM
Herpesviridae
+HUSHVVLPSOH[
Retroviridae
9LUXVGHODLQPXQRGH¿FLHQFLDKXPDQD
Hepadnaviridae
+HSDWLWLV%
Filoviridae
Ébola
Mucosa conjuntival
Adenoviridae
$GHQRYLUXVVHURWLSRV+\
Picornaviridae
(QWHURYLUXV
(FKRYLUXV
Coxsackie A 24
2) VIRUS QUE PENETRAN POR VÍA RESPIRATORIA
Con manifestaciones clínicas locales
Orthomyxoviridae
,QÀXHQ]D
Paramyxoviridae
3DUDLQÀXHQ]DVLQFLFLDOUHVSLUDWRULRPHWDSQHXPRYLUXVKXPDQR
Picornaviridae
5KLQRYLUXVDOJXQRVHQWHURYLUXV
Coronaviridae
&RURQDYLUXV
Adenoviridae
$GHQRYLUXV
Herpesviridae
(SVWHLQ%DUUFLWRPHJDORYLUXVKXPDQRKHUSHVVLPSOH[
Con manifestaciones clínicas generalizadas
Togaviridae
5XEpROD
Herpesviridae
Varicela-zóster
Parvoviridae
(U\WKURYLUXV SDUYRYLUXV KXPDQR%
Paramyxoviridae
Sarampión, parotiditis
Picornaviridae
$OJXQRVHQWHURYLUXV
Polyomaviridae
%.\-&
(continúa en la página siguiente)
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
76
Bunyaviridae
+DQWDDQ
Poxviridae
9LUXHOD HUUDGLFDGR
3) PUERTA DE ENTRADA DIGESTIVA
Orofacial
Herpesviridae
+HSHVVLPSOH[(SVWHLQ%DUU
&LWRPHJDORYLUXVKXPDQR
Intestinal
Con manifestaciones clínicas locales
Reoviridae
5RWDYLUXV SXHGHDVRFLDUVHWDPELpQDLQIHFFLyQH[WUDLQWHVWLQDO
Caliciviridae
1RURYLUXV
Adenoviridae
$GHQRYLUXV
Con manifestaciones clínicas generalizadas
Picornaviridae
3ROLRYLUXV
+HSDWLWLV$
$OJXQRVHQWHURYLUXV
Hepeviridae
+HSDWLWLV(
Sin producción de manifestaciones clínicas
Picornaviridae
$OJXQRVHQWHURYLUXV
Adenoviridae
$OJXQRVDGHQRYLUXV
Reoviridae
5HRYLUXV
4) INFECCIÓN FETAL TRANSPLACENTARIA
Togaviridae
5XEpROD
Herpesviridae
&LWRPHJDORYLUXVKXPDQR
Poxviridae
9LUXHOD HUUDGLFDGR
Parvoviridae
(U\WKURYLUXV SDUYRYLUXV KXPDQR%
Retroviridae
9LUXVGHODLQPXQRGH¿FLHQFLDKXPDQD
Hepadnaviridae
+HSDWLWLV%
Flaviviridae
+HSDWLWLV&
Tabla 5.1. Puertas de entrada viral al organismo: algunos ejemplos.
WHFRPRSHUPLVLYDVDODLQIHFFLyQDXQTXHORVUHSRUWHVPiVUHFLHQWHV
indican que son las últimas las que desempeñan un rol principal. La
infección de unas ú otras células dendríticas favorece la infección cuWiQHD\ODVXEVLJXLHQWHGLVHPLQDFLyQYLUDODRWURVyUJDQRV2WURVYLUXV
pueden potencialmente penetrar la piel mediante inyección al efectuarse transfusiones controladas en forma inadecuada o cuando no son
GHWHFWDEOHVORVPDUFDGRUHVHVSHFt¿FRVWDOHVHOFDVRGHOvirus hepatitis
% +%9 GHOYLUXVKHSDWLWLV& +&9 GHOYLUXV(SVWHLQ%DUU (%9 del FLWRPHJDORYLUXVKXPDQR +&09 \GHGLYHUVRVretrovirus, tales
FRPRORVYLUXVGHODOHXFHPLD7KXPDQD Human T Leukemia Virus
R+7/9 \HIV. La viremia persistente asociada con diversa freFXHQFLDDODFLUFXODFLyQSODVPiWLFDGHYLUXVOLEUHHQODVLQIHFFLRQHV
crónicas producidas por HBV, HCV o HIV, así como la integración
del provirus de UHWURYLUXVFRPR+7/9RHIV en OLQIRFLWRV7CD4+
de individuos infectados, y la asociación de HBV y HCV a linfocitos
y monocitos multiplica las posibilidades de propagación de dichos
DJHQWHVHQGURJDGLFWRVTXHFRPSDUWHQDJXMDV(QRWUDVLQIHFFLRQHVGH
la piel propiamente dicha, como es el caso de la verruga producida por
GLYHUVRVSDSLORPDYLUXVKXPDQRV +39 HOVLWLRLQLFLDOGHODLQMXULD
puede pasar inadvertido.
2.2 OROFARINGE Y TRACTO RESPIRATORIO
Es éste un sitio muy importante de penetración de virus. Sin embargo, normalmente los mecanismos de eliminación viral que partici-
SDQHQHOiUEROUHVSLUDWRULRPDQWLHQHQOLPSLRHOWUDFWRUHPRYLHQGR
ODVSDUWtFXODVLQKDODGDVORJUDQGRDVtTXHORVSXOPRQHVVHDQSUiFticamente estériles. La estructura mucociliar que recubre la caviGDGQDVDO\ODPD\RUSDUWHGHOiUEROUHVSLUDWRULREDMRSHUPLWHTXH
ODVSDUWtFXODVH[WUDxDVTXHVHGHSRVLWDQVREUHHOPXFXVSXHGDQVHU
transportadas hacia las fauces posteriores y luego deglutidas. En
ODVSRUFLRQHVWHUPLQDOHVGHOiUEROUHVSLUDWRULREDMRQRH[LVWHGLFKD
FXELHUWDPXFRFLOLDUHODOYpRORHVWiIRUPDGRSRUFpOXODVHSLWHOLDOHV
células dendríticas y macrófagos con elevada actividad fagocítica.
(O GHVWLQR GH XQD SDUWtFXOD H[WUDxD LQKDODGD HVWi GHWHUPLQDGR SRU VX WDPDxR VL HV PD\RU GH ȝP TXHGDUi DWUDSDGD HQ
las fosas nasales, mientras que aquellas cuyo tamaño oscila entre
ȝP VH GHSRVLWDUiQ D OR ODUJR GHO WUDFWR UHVSLUDWRULR DOWR \
EDMR3DUWtFXODVPHQRUHVGHȝPSXHGHQHQWUDUDORVSXOPRQHV\
algunas de ellas alcanzan los alvéolos. Al producirse un estornudo
o un acceso de tos se producen aerosoles conteniendo partículas
TXHRVFLODQHQWUHȝPDPiVGHȝP7HQLHQGRHQFXHQWDTXHODV
SDUWtFXODVGHȝPWDUGDQDSUR[LPDGDPHQWHPLQXWRVHQFDHU
GHXQDDOWXUDGHPHWURVVHLQ¿HUHTXHDTXHOODVSDUWtFXODVPHQRres a dicho tamaño poseen un tiempo de circulación considerable
en ambientes cerrados. En el caso de los virus respiratorios, dicho
tiempo de circulación favorece su transmisión aerógena.
'XUDQWH XQ DFFHVR GH WRV VH H[SHOHQ FLHQWRV GH PLFURJRWDVGH)OJJHDXQDYHORFLGDGDSUR[LPDGDDORVNPKRUD
mientras que al estornudar se eliminan cientos de miles de mi-
Capítulo 5 / Patogenia de las infecciones virales
77
el polo baso-lateral, mientras que rubéola lo hace preferencialmente por el polo apical.
PATOGÉNESIS DE LAS INFECCIONES VIRALES
La prevalencia de las infecciones virales respiratorias agudas
es diferente según sea el hospedero un paciente inmunocompetente
ƔSegún hospedador
o inmunosuprimido. En este último caso, son frecuentes y de maInmunocompetente
yor gravedad las infecciones por adenovirus, RSV, HMPV, HCMV,
,QPXQRGHILFLHQWH
KHUSHVVLPSOH[RYDULFHOD]yVWHU
Como ya se mencionó anteriormente, el virus LQÀXHQ]DVHXQH
a las células a través de la interacción de sus hemaglutininas con
ƔSegún espacialidad de la infeción
JOLFRSURWHtQDV FHOXODUHV TXH FRQWLHQHQ iFLGR 1DFHWLO QHXUDPtQL/RFDOL]DGDV
FR iFLGR VLiOLFR DXQTXH HOOR QR HV VX¿FLHQWH SDUD SURPRYHU OD
6LVWpPLFDV
infección, habiéndose postulado la necesidad de un UHFHSWRUPiV
HVSHFt¿FRSDUDTXHGLFKRHYHQWRRFXUUDin vivo. Sin embargo, la
ƔSegún temporalidad de la infección
transmisibilidad de las diferentes cepas del virus LQÀXHQ]DHVYDULD$JXGDV
ble. La presencia de la neuraminidasa viral se asocia a la liberación
3HUVLVWHQWHV
de viriones de la célula, y por ende, probablemente, a su transmiCrónicas
sibilidad. A su vez, otra posible función de la neuraminidasa sea
Latentes
liberar viriones de inhibidores presentes en el mucus que contienen
Lentas
iFLGRQHXUDPtQLFRDQiORJRDOGHORVUHFHSWRUHVFHOXODUHV
Transformantes
Otros factores que afectan la transmisión de los virus que penetran por vía respiratoria incluyen la intensidad de las secreciones
SRU ERFD R QDUL] OD FRQWDPLQDFLyQ GH PDQRV \ REMHWRV OD UHVLVFigura 5.3. &ODVL¿FDFLyQGHODVLQIHFFLRQHVYLUDOHV
tencia a la desecación de cada virus en particular, y el número de
partículas infecciosas liberadas.
Desde el punto de vista de las células infectadas, puede obserFURJRWDV D XQD YHORFLGDG FHUFDQD D ORV NPKRUD (VWRV YDUVHLQIHFFLyQGHODVFpOXODVHSLWHOLDOHV FRPRRFXUUHFRQLQÀXHQdatos ilustran la facilidad de transmisión de las infecciones za o 569 GHODV&' FRPRVHREVHUYDFRQVDUDPSLyQR569 RGH
virales respiratorias en las que se eliminan viriones a través de los macrófagos alveolares. El virus LQÀXHQ]DSXHGHLQIHFWDUGLFKRV
macrófagos septales pero produce en ellos un ciclo de replicación
GLFKDVVHFUHFLRQHV )LJXUD 8Q PLVPR YLUXV SXHGH DIHFWDU XQD R PiV ORFDOL]DFLRQHV GHO abortivo: se sintetizan antígenos virales sin liberación de virus
iUEROUHVSLUDWRULRDVXYH]P~OWLSOHVYLUXVSXHGHQDIHFWDUXQDGH- LQIHFFLRVR/DSURGXFFLyQGH75$,/ TNFĮRelated ApoptosisInduced Ligand SRUORVPDFUyIDJRVSURPXHYHODapoptosis de las
WHUPLQDGDORFDOL]DFLyQ )LJXUD FpOXODVHSLWHOLDOHVORFXDOHVWiDVRFLDGRDOH[XGDGRSXOPRQDURELas infecciones virales que tienen por puerta de entrada el trac- servado en las neumonías causadas por LQÀXHQ]D(QHOFDVRGHO
to respiratorio pueden asociarse a manifestaciones localizadas o RSV, las células que son blanco para su ingreso al organismo cosistémicas, dependiendo si la infección queda restringida a células rresponden a las del epitelio ciliado columnar. La oclusión aérea
especializadas de dicho tracto o si se infectan elementos móviles observada en casos fatales de bronquiolitis agudas –patología de la
UHVLGHQWHVHQpO &' RVLVHSURGXFHYLUHPLDTXHGLVHPLQHDOYL- que RSV es la primera causa- se asocia a la acumulación de restos
UXVDXQyUJDQRVHFXQGDULRGHDWDTXH/D HYHQWXDO GLVHPLQDFLyQ celulares conteniendo cuerpos apoptóticos y proteínas séricas, con
YLUDODRWUDVSDUWHVGHORUJDQLVPRGHSHQGHGHODVXSHU¿FLHFHOXODU afectación funcional de los macrófagos alveolares, lo que resalta el
a través de la cual egresan los virus en las células epiteliales pola- papel de la inmunidad innata en su génesis.
El desenlace de una infección respiratoria aguda puede variar
UL]DGDVDTXHOORVTXHVyORORKDFHQSRUHOSRORDSLFDOSURPRYHUiQ
LQIHFFLRQHV ORFDOL]DGDV SRU HMHPSOR OD SURGXFLGD SRU ORV YLUXV ampliamente, dependiendo de la respuesta inmune del hospedero,
VLQFLFLDO UHVSLUDWRULR >[email protected] PHWDSQHXPRYLUXV KXPDQR >[email protected] ODTXHGH¿QLUiODFLQpWLFDGHODHOLPLQDFLyQYLUDO(QHVWHFRQWH[WR
RSDUDLQÀXHQ]DKXPDQR ORVTXHHJUHVDQSRUHOSROREDVRODWHUDO desempeñan un rol muy importante tanto la respuesta innata como
producen infecciones sistémicas afectando diversos órganos de la la adaptativa. Entre las células de la respuesta innata, diferentes
economía. Hay virus que egresan preferencialmente por un polo, subpoblaciones de &' PLHORLGHV FRQYHQFLRQDOHV \ SODVPRFLaunque también lo hacen en menor grado por otro: es el caso de los toides son responsables de distintas tareas que incluyen desde la
virus sarampión y rubéola. Sarampión lo hace principalmente por captación antigénica, hasta la presentación a OLQIRFLWRV7CD4+ y
&'+, como la producción de ,QWHUIHUyQĮUHVSHFWLYDPHQWH8QD
actividad alterada de las &' SRUHMHPSORFRPRUHVXOWDGRGHVX
LQIHFFLyQ SXHGHIDYRUHFHU±MXQWRDODGLYHUVLGDGDQWLJpQLFD±ODV
reinfecciones por un mismo virus, como se observa con RSV, como
FRQVHFXHQFLDGHXQDDIHFWDFLyQGHODVLQDSVLVLQPXQROyJLFD FRQWDFWRLQWHUFHOXODU HQWUHCD y OLQIRFLWRV7ORTXHLPSLGHXQDUHVpuesta adaptativa protectora adecuada.
La infección de las CD puede promover su maduración, como
lo hace LQÀXHQ]DORTXHIDFLOLWDVXHOLPLQDFLyQSRUORVlinfocitos
73RUHOFRQWUDULRHOYLUXVVDUDPSLyQLPSLGHVXPDGXUDFLyQDOLQKLELUODH[SUHVLyQGH&'OLJDQGRHQORVOLQIRFLWRV7ORFXDOFRQtribuye a la inmunosupresión observada en la fase aguda de la enfermedad homónima. En otros casos, como ocurre en la infección
por HCMV, las células dendríticas progenitoras portan el genoma
YLUDOHQIRUPDODWHQWH véase más adelante ítem 5.2 VLQH[SUHVLyQ
de genes de la fase lítica. Al madurar dichas células, se produce la
reactivación viral con producción de virus infeccioso, lo cual es
Figura 5.4. Formación de microgotas de Flügge. Las mismas se dependiente de la diferenciación celular que –a su vez– promueve
H[SHOHQGXUDQWHHODFWRGHWRVHURGHHVWRUQXGDUDVtFRPRWDPELpQ una remodelación de la cromatina en la región del promotor inmeDOSURQXQFLDUODFRQVRQDQWH)
diato temprano viral. La infección de las CD mieloides con HCMV
78
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
Virus X
Epitelio A
Virus Y
Epitelio A
Virus Z
Epitelio B
Virus X
Epitelio C
Epitelio B
Epitelio C
Figura 5.5. Virus respiratorios y localización de las infecciones. 8QPLVPRYLUXVSXHGHORFDOL]DUVHHQGLYHUVRVVLWLRVGHOiUEROUHVSLUDWRULRXQDPLVPDORFDOL]DFLyQDQDWyPLFDSXHGHVHUHOVLWLRGHPXOWLSOLFDFLyQGHGLYHUVRVYLUXV
es permisiva y lítica, afecta su maduración, bloquea la secreción
de FLWRTXLQDVGL¿FXOWDVXPLJUDFLyQHQUHVSXHVWDDquimioquinas e
impide su habilidad aloestimulatoria. Por el contrario, la infección
con HCMV de las CD plasmocitoides afecta diferencialmente su
capacidad de colaborar con la respuesta adaptativa: inhibe la colaboración con los OLQIRFLWRV7CD4+ y &'+ FRQWULEX\HQGRDRWUR
HMHPSORGHLQPXQRVXSUHVLyQWHPSRUDULD DODYH]TXHSURPXHYHOD
hiperactividad de los OLQIRFLWRV% )LJXUD 7DPELpQHVUHOHYDQWHHQODUHVSXHVWDLQQDWDODDFWLYLGDGGHOHMH
1.7PDFURIiJRV&'G+PHGLDGDSRU,/\DTXHGHSHQGLHQdo del mismo es posible promover al cabo de una infección viral
DJXGD TXH GHMH PHUDPHQWH YHVWLJLRV YLUDOHV SRU HMHPSOR JHQRmas sólo detectables por 3&5 XQD HQIHUPHGDG FUyQLFD LQÀDPDtoria como la enfermedad obstructiva crónica pulmonar o el asma
)LJXUD (VWHQXHYRPHFDQLVPRSDWRJpQLFR TXHVHRSRQHDO
dogma que sostenía la asociación con una respuesta adaptativa alWHUDGD SRGUtDH[SOLFDUODDVRFLDFLyQHQWUHLQIHFFLRQHVSURGXFLGDV
por 569R+039FRQHODVPDDXQTXHD~QGHEHGH¿QLUVHVLSDUD
ello se requiere la persistencia viral en CD, macrófagos u otras
estirpes celulares.
(QOD7DEODVHPXHVWUDQODVSULQFLSDOHVDVRFLDFLRQHVHQWUH
virus e infecciones agudas de la orofaringe y el tracto respiratorio
DOWR\EDMRHQSDFLHQWHVSHGLiWULFRV
7HQJDHQFXHQWDHOOHFWRUTXHODUHSOLFDFLyQYLUDOHQODRURIDringe puede ser una puerta de entrada para virus que replican subsiguientemente en el tracto respiratorio como entérico.
Algunos virus pueden infectar directamente las células del
epitelio faucial o células subyacentes, produciéndose como consecuencia de ello, anginas generalmente eritematosas, contribuyendo
HQDSUR[LPDGDPHQWHXQDOWRWDOGHFDVRV
(Q ORV SDFLHQWHV SHGLiWULFRV HV PX\ IUHFXHQWH OD LQIHFFLyQ
DPLJGDOLQDFRQDGHQRYLUXV 7DEOD 6LVHFRQVLGHUDVHHQFDPbio la prevalencia global de los diversos virus asociados a faringitis, irrespectivamente de la edad del individuo, debería mencionarse en orden decreciente la contribución de rhinovirus, coronavirus,
KHUSHVVLPSOH[ WLSRV\ SDUDLQÀXHQ]DLQÀXHQ]D WLSRV$\% &R[VDFNLH$ WLSRV±\ YLUXV(SVWHLQ±%DUUcitomegalovirus humano y HIV.
En el caso de la infección primaria por EBV se ha postulado
que el mismo puede unirse a linfocitos B en reposo de la orofaringe
para iniciar una infección latente, y mediante transferencia viral –
desde dicha población y aún sin replicar inicialmente en ella–, puede infectar productivamente células epiteliales faríngeas en donde
ODLQIHFFLyQVHFLUFXQVFULEH QRVHREVHUYDKDELWXDOPHQWHUHSOLFDFLyQHQHOWUDFWRGLJHVWLYRGHLQGLYLGXRVLQPXQRFRPSHWHQWHV 2.3 OROFARINGE Y TRACTO ENTÉRICO
Esta puerta de entrada es la segunda en orden de frecuencia como
PHGLRGHGLVHPLQDFLyQGHLQIHFFLRQHVYLUDOHVVyORDYHQWDMDGDSRU
ODYtDUHVSLUDWRULD/DVJOiQGXODVVDOLYDOHVFRQVWLWX\HQODSULQFLSDO
fuente de IgA secretoria presente en el tracto respiratorio superior
\HQHOWUDFWRHQWpULFRORFXDOFRQ¿HUHSURWHFFLyQIUHQWHDP~OWLSOHV
infecciones virales que ingresan por dichas vías.
La hipotética participación de las amígdalas en el ingreso del
+,9DORUJDQLVPRHVWiVXVWHQWDGDHQXQOLPLWDGRQ~PHURGHHVWXdios in vitro\GHSULPDWHVLQRFXODGRVSRUYtDRUDOFRQ6,9 Simian
,PPXQRGH¿FLHQF\9LUXV /DH[SUHVLyQGHOreceptor para complePHQWR &5 GH)&Ȗ5,,,\GHOFRUUHFHSWRU&;&5 DVtFRPR
de &&5 SRUFpOXODVHSLWHOLDOHVRSRUORVOLQIRFLWRV7CD4+ y CDs
GHODVDPtJGDODVMXQWRDXQDGLVPLQXFLyQGHORVPHGLDGRUHVGHOD
UHVSXHVWDLQQDWD FRPRXQDSURWHDVDDQWLYLUDOVHFUHWDGDSRUOHXFRFLWRV IDYRUHFHODSRWHQFLDOLQWHUDFFLyQHQWUHHIV y las amígdalas.
Si bien todos estos elementos participan en la patogénesis de la infección por HIV, su contribución a la transmisión oral de este virus
HVD~QGHEDWLGDWHQLHQGRHQFXHQWDODEDMDH¿FDFLDGHHVWDYtD UHVSHFWRDODKRPRVH[XDO RKHWHURVH[XDO La susceptibilidad a la infección por HIV en la cavidad oral
HVWi LQÀXLGD SRU GLYHUVRV IDFWRUHV D ODV SURSLHGDGHV ItVLFDV GH
ODV FpOXODV GH OD PXFRVD QR VH KD GH¿QLGR VL ORV TXHUDWLQRFLWRV
±GDGRTXHH[SUHVDQUHFHSWRUHVSDUDHOYLUXV– presentan al HIV a
células profesionales presentadoras de antígenos, o si las células de
Langerhans –CD inmaduras– muestrean y procesan al virus direcWDPHQWH E HOWLHPSRGHH[SRVLFLyQDOYLUXVDQWHVGHODGHJOXFLyQ
F ODDFFHVLELOLGDGDODVFpOXODVEODQFR\G ODLQIHFWLYLGDGGHOD
"forma de presentación" del +,9 OLEUHGHFpOXODVRHQPDFUyIDJRVXRWUDVFpOXODVHQVDOLYDOHFKHPDWHUQDRVHPHQ 6LELHQORV
Capítulo 5 / Patogenia de las infecciones virales
Control
CDs
CDt
A
IE-FITC
CD123-TRITC
Imagen
superpuesta
pp150-FITC CD123-TRITC
Imagen
superpuesta
Control
CDs
CDt
B
Figura 5.6. Expresión de proteínas del citomegalovirus humano
(HCMV) en células dendríticas plasmocitoides periféricas sanguíneas (CDs) y tisulares (CDt). $QiOLVLVSRULQPXQRÀXRUHVFHQFLD
FRQGRVFRORUHV XWLOL]DQGRPLFURVFRStDFRQIRFDO/DH[SUHVLyQGHOD
proteína inmediato-temprana -IE- (ADODVKVSRVWLQIHFFLyQ>[email protected] \GHODSURWHtQDWDUGtDSSGHO+&09 BDOWRGtDSL HVUHYHODGD
con DQWLFXHUSRVFRQMXJDGRVFRQLVRWLRFLDQWRGHÀXRUHVFHtQD ),&7 FRQXQFRORUYHUGHPDQ]DQD/DH[SUHVLyQGH&' PDUFDGRUGH
ODVFpOXODVSODVPRFLWRLGHV HQDPtJGDODV\VDQJUHHVUHYHODGDFRQ
DQWLFXHUSRV FRQMXJDGRV FRQ LVRWLRFLDQDWR GH WHWUDPHWLO URGDPLQD
75,&7 FRQFRORUURML]R/DVXSHUSRVLFLyQGHLPiJHQHVUHYHODODLQfección de las FpOXODV GHQGUtWLFDV SODVPRFLWRLGHV FRQ +&09 FRORU
DPDULOOR /DEDUUDUHSUHVHQWD—P'H6FKQHLGHU.et al. Human
Cytomegalovirus Impairs the Function of Plasmacytoid Dendritic Cells
in Lymphoid Organs 3/R6 21( H GRLMRXUQDO
SRQH5HSURGXFLGRFRQDXWRUL]DFLyQ
OLQIRFLWRV7LQIHFWDGRVFRQHIV son infrecuentemente detectados
HQODPXFRVDRUDOH[LVWHQFLUFXQVWDQFLDVHQODVTXHORVIDFWRUHVGH
resistencia pueden ser superados, lo cual permite la penetración del
+,9GHVGHHOH[WHULRURHOHJUHVRYLUDOKDFLDHOPLVPR/RVWtWXORV
PiVDOWRVGHYLUXVLQIHFFLRVRVHGHWHFWDQDQWHVGHODDSDULFLyQGHO
VtQGURPHUHWURYLUDODJXGRORTXHVXJLHUHODH[LVWHQFLDGHYLULRQHV
PX\SURQWROXHJRGHODH[SRVLFLyQ\DQWHVGHODVHURFRQYHUVLyQ
0HQRVGHOGHORVLQGLYLGXRVTXHVHURFRQYLHUWHQH[KLEHQ+,9
libre en saliva.
'H WRGDV IRUPDV VH KD HVWDEOHFLGR TXH OD H[SRVLFLyQ RUDO DO
HIV promueve la infección y subsiguiente depleción de linfocitos
79
7GHPHPRULD £FRQPDUFDGRUHVIHQRWtSLFRVGHFpOXODVHQUHSRVR ubicados en la mucosa del tracto intestinal. Esta vía de ingreso,
HVGHHVSHFLDOVLJQL¿FDFLyQHQODWUDQVPLVLyQGHODLQIHFFLyQQHRnatal por HIV mediante la lactancia materna y potencialmente en
DGXOWRVDQWHHOVH[RRUDO/DGHJOXFLyQGHYLUXVHIV presente en la
ERFD GLOXLGRHQODOHFKHPDWHUQDFRQFHQWUDGRHQHOVHPHQ SXHde promover su captura y tansmisión a través de receptores &&5
en intestino, a pesar del desafío a su infectividad impuesto por la
DFLGH]GHOS+JiVWULFR HQHOODFWDQWH /DVFpOXODVHSLWHOLDOHV
GHO \H\XQR H[SUHVDQ ORV UHFHSWRUHV JDODFWRVLO FHUDPLGD \ &&5
pero no CXCR4, lo que sugiere un potencial mecanismo para la
transmisión preponderante de cepas "5 GHQRPLQDGDVPDFUyIDJRWUySLFDV RFRQWURSLVPRGXDO PDFUyIDJR\OLQIRWUySLFDV GHO
+,9HQODLQIHFFLyQSULPDULDDWUDYpVGHOWUDFWRJDVWURLQWHVWLQDO
VXSHULRU/XHJRGHOSDVDMHGHOHIV a través del epitelio mediante
endocitosis dependiente de microtúbulos, el virus es transportado
por transcitosis a las CD mieloides. Éstas entran en contacto con
el virus mediante el receptor '&6,*1 XQDOHFWLQDWLSR& ORTXH
permite el ingreso viral a vesículas endocíticas. Las &' TXH QR
QHFHVLWDQHVWDULQIHFWDGDVDXQTXHVRQSHUPLVLYDV HQWUDQHQFRQtacto con OLQIRFLWRV7CD4+ VLQDSVLVLQPXQROyJLFD \UHJXUJLWDQ
el virus hacia estos últimos. El contacto del HIV con macrófagos y
OLQIRFLWRV7CD4+ &&5+ y/o CXCR4+ promueve la fusión, ingreso
y replicación viral. A partir de esta instancia, +,9HVWiHQFRQGLFLRnes de iniciar la infección sistémica.
5HFLHQWHPHQWH VH KD HVWDEOHFLGR TXH H[LVWH XQD DVRFLDFLyQ
etiológica entre ciertos tumores de cabeza y cuello (originados
en las amígdalas) y la infección persistente por HPV. El tipo
±KDELWXDOPHQWHDVRFLDGRDOFDUFLQRPDGHFXHOORXWHULQR±HVWi
LPSOLFDGRHQODJpQHVLVGHDSUR[LPDGDPHQWHXQGHORVFDUFLnomas de células escamosas de amígdala.
'LYHUVRVIDFWRUHVLQÀX\HQHQODSUREDELOLGDGGHLQIHFFLyQYLUDO
GHOLQWHVWLQRHO\DPHQFLRQDGRSDVDMHDWUDYpVGHOS+iFLGRJiVWULFRODH[LVWHQFLDGHiFLGRVELOLDUHVHOWUiQVLWRLQWHVWLQDO\ODSUHsencia de moco y enzimas proteolíticas. Si un virus determinado no
HVUHVLVWHQWHDOS+iFLGR\DODDFFLyQVROXELOL]DGRUDGHODVVDOHVELOLDUHVVREUHVXHQYROWXUDOLStGLFDGLItFLOPHQWHSRGUiFDXVDULQIHFción a través de esta puerta de entrada. De allí que los virus envuelWRVQRSHQHWUDQDORUJDQLVPRSRUHVWDYtDKDELWXDOPHQWH$GHPiV
de la mencionada infección del lactante con +,9RWUDH[FHSFLyQOD
constituyen algunos miembros de la familia Coronaviridae, tales
como los torovirus, causantes de gastroenteritis y enterocolitis necrotizantes en el neonato.
El movimiento intestinal opera como mecanismo de barrido.
8QDSHOtFXODGHPRFRUHFXEUHODVXSHU¿FLHGHODVFpOXODVHSLWHOLDOHV
\TXLWDSUREDELOLGDGHVDXQD¿UPHDGKHUHQFLDGHORVYLUXVFRQORV
UHFHSWRUHVFHOXODUHVHVSHFt¿FRVSDUDLQLFLDUODLQIHFFLyQ$GHPiV
dicho moco contiene anticuerpos de clase IgA secretoria, los que al
igual que en el tracto respiratorio, desempeñan un papel relevante
en la neutralización ó agregación local de los virus. Ello implica
una importante barrera en la cadena epidemiológica de transmisión
viral. Este fenómeno es aprovechado en eventos de inmunización,
tal como se observa en vacunados contra la poliomielitis con la
vacuna atenuada Sabin.
A diferencia de los virus respiratorios, los virus entéricos raramente producen enfermedad como consecuencia de su multiplicación en las células del tracto digestivo. De allí que no es frecuente
la asociación de infecciones virales de este tracto con diarrea o vómitos o dolor abdominal. Sin embargo, HQWUHDTXHOORVYLUXVSURductores de sintomatología local merece destacarse la gastroenteritis producida por rotavirus (principalmente en menores
de dos años), o por los virus Norwalk o sapovirus (miembros
respectivos de los géneros Norovirus y Sapovirus de la familia
Caliciviridae), los adenovirus entéricos, y los astrovirus. Las infecciones por reovirus, se asocian habitualmente a manifestaciones
gastrointestinales leves.
Los rotavirus merecen una mención especial, dado que en años
recientes se ha establecido que no sólo causan gastroenteritis a traYpVGHODVtQWHVLV\OLEHUDFLyQH[WUDFHOXODUGHODHQWHURWR[LQD163
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
80
IL-13
Virus
CPA
CD1dglicolípido
Macrófago
NKT
IL-13
Metaplasia
epitelial mucosa
Músculo liso
hiperreactivo
Epitelio
Músculo
liso
Figura 5.7. Circuito NKT - IL-13 - Macrófago en la génesis de la enfermedad obstructiva crónica y el asma. Véase el texto. Adaptada de Kim EY et al. Nat Med VLQRTXHHVWiQDVRFLDGRVHQDSUR[LPDGDPHQWHXQGHORVFDVRV
a viremia, y son capaces de infectar diversos órganos, tales como
SXOPRQHVKtJDGR61&HVWyPDJRSiQFUHDVWHVWtFXORVHWFSRUOR
cual no deben ser considerados meramente agentes de infecciones
ORFDOL]DGDVHQHOWUDFWRJDVWURLQWHVWLQDO FRPRVHORVFRQVLGHUyKDVWDPX\UHFLHQWHPHQWH VLQRWDPELpQVLVWpPLFDV )LJXUD DXQTXHD~QQRVHKDGH¿QLGRVXpatogenia. Estudios en animales inIHFWDGRVH[SHULPHQWDOPHQWHGHPRVWUDURQTXHORVURWDYLUXVFDXVDQ
lesiones en pulmones e hígado, pudiendo replicar en macrófagos.
Como contrapartida, los órganos blanco habituales de la mayoría de los virus que penetran por vía enteral se encuentran a distancia: el S.N.C., el corazón o la piel para los enterovirus, el hígado
para ciertos virus productores de KHSDWLWLV $\( HWF
Cabe destacar que mientras los rotavirus replican activamente
en las células M del epitelio gastrointestinal -provocando la lisis de
las mismas-, los reovirus ingresan a las capas basales del epitelio
por transcitosis a través de estas mismas células, donde pueden infectar a partir de su polo basal otras células epiteliales intestinales
o bien CDs y macrófagos. Por el mecanismo de transcitosis los viUXVHQGRFLWDGRVWUDQVLWDQGHVGHODVXSHU¿FLHDSLFDODODEDVRODWHUDO
GHQWURGHYHVtFXODVSDUDOXHJRVHUH[RFLWDGRVVLQTXHVHSURGX]FD
infección de la célula en cuestión.
La mucosa rectal puede ser también blanco de la infección por
diversos virus en hombres que mantienen por vía anal relaciones
KRPRVH[XDOHV UHFHSWLYDV VLQ SURWHFFLyQ 'DGR TXH HO HSLWHOLR HV
FLOtQGULFR QR HVWUDWL¿FDGR FRPR HO YDJLQDO VH IDYRUHFH HO FRQtacto con las CDs '&6,*1 SRVLWLYDV OR FXDO H[SOLFD DO PHQRV
SDUFLDOPHQWH SRUTXpHVPiVH¿FLHQWHODWUDQVPLVLyQSRUHVWDYtD
TXH D WUDYpV GH OD YDJLQD )LJXUD 6H HVWLPD TXH ORV PLFURtraumatismos que ocurren en este tipo de relaciones, favorece el
ingreso viral. Entre los agentes asociados a esta vía de transmisión,
se encuentran HIV, +%9+&09YLUXVKHUSHVKXPDQR HHV ±DJHQWHHWLROyJLFRGHOsarcoma de Kaposi–, y HCV en pacientes
KRPRVH[XDOHVFRLQIHFWDGRVFRQHIV.
2.4 APARATO GÉNITO-URINARIO
/DLQIHFFLyQYLUDOGHOiUEROXULQDULRQRHVIUHFXHQWH6LELHQPXchos virus pueden replicar in vitro en cultivos celulares de riñón
KXPDQRVRQSRFRVORVTXHVHDVRFLDQDLQIHFFLRQHVGHOiUEROXULnario in vivo GRQGH HO ÀXMR GH RULQD VLUYH FRPR PHFDQLVPR GH
barrido.
Hasta el presente sólo se han asociado los adenovirus con seroWLSR\DFLVWLWLVKHPRUUiJLFDHQniños y en pacientes inmunocomprometidos. En la infección por +%9 ORV FRPSOHMRV LQPXQHV
constituidos por antígenos HBs y HBe y sus respectivos anticuerpos
desempeñan un papel patogénico en las nefritis observadas en alJXQRVSDFLHQWHV6LQHPEDUJRHOGHSyVLWRGHLQPXQRFRPSOHMRVHV
GH FRUWD GXUDFLyQ \ OD JORPHUXORQHIULWLV QR HV IUHFXHQWH7DPELpQ
se observan glomerulonefritis membranosas asociadas a la infección
por HCV.
/DVXSHU¿FLHGHOWUDFWRJHQLWDOHVWiPiVH[SXHVWDDODVLQIHFFLRQHV(OFRQWDFWRGHPXFRVDVGXUDQWHODVUHODFLRQHVVH[XDOHV\
HOSDVDMHGHOSURGXFWRGHODFRQFHSFLyQDWUDYpVGHOFDQDOGHSDUWR
FRQVWLWX\HQODIXHQWHGHLQIHFFLyQSDUDORVPLHPEURVGHXQDSDUHMD
o para el recién nacido, respectivamente. Como se observa en la
¿JXUDHQODYDJLQDH[LVWHXQHSLWHOLRHVWUDWL¿FDGRHQHOTXHVH
ORFDOL]DQODVFpOXODVGH/DQJHUKDQV\GHEDMRGHOFXDOVXE\DFHQWHMLGRVHVWURPDOHVGHQVDPHQWHSREODGRVFRQRWUDVcélulas dendríticas
'&6,*1 SRVLWLYDV PRQRFLWRVPDFUyIDJRV \ OLQIRFLWRV 7 TXH
H[SUHVDQ&'\ORVFRUUHFHSWRUHVSDUDHIV CXC-R4 y/o &&5
/DVXVFHSWLELOLGDGDODVLQIHFFLRQHVGLYHUVDVQRVyORHVWiLQÀXLGD
SRU OD UHVSXHVWD DGDSWDWLYD SUHVHQFLD GH ,J$ VHFUHWRULD FRQ DFtividad neutralizante y linfocitos CD4+ y &'+FLWRWy[LFRV VLQR
también por componentes de la respuesta innata, en la que sobreVDOHQ PHGLDGRUHV SROLSHSWtGLFRV DQ¿SiWLFRV FDWLyQLFRV FRPR ODV
PROpFXODV6/3OLVR]LPDODFWRIHUULQD\Į\ȕGHIHQVLQDVSLP-1,
XQDPROpFXODFRQSURSLHGDGHVDQWLLQÀDPDWRULDVFX\DFRQFHQWUDFLyQ HQ YDJLQD DOFDQ]D —J—O \ TXH HVWi LQFUHPHQWDGD veces en el tapón mucoso del cuello uterino, posee una actividad
protectora anti-HIV, como lo demuestra la menor tasa de transPLVLyQ YHUWLFDO HQ DTXHOODV PDGUHV TXH H[KLEHQ FRQFHQWUDFLRQHV
elevadas. Aunque la concentración de lisozima PXURSHSWLGDVD HV
EDMDHQODYDJLQD a—JPO HVWiVLJQL¿FDWLYDPHQWHDXPHQWDGD
HQHOWDSyQPXFRVRFXDQGRODPLVPDHVWiGLVPLQXLGDHQHOWUDEDMR
de pretérmino, ocurren eventos de corioamnionitis, que facilitan
ODLQIHFFLyQGHOSURGXFWRGHODFRQFHSFLyQ'RPLQLRVHVSHFt¿FRV
de la lisozima, tienen actividad anti-HIV, la que a nivel del tapón
mucoso sería efectiva in vivo. Otro polipéptido con actividad antiYLUDO GLUHFWDRLQGLUHFWDPHQWHGHPRVWUDGDFRQWUDKHUSHVVLPSOH[
HCMV y +,9 HVODlactoferrina, la que inhibe la fusión y subsiguiente ingreso del +,9DODVFpOXODVDOXQLUVHDO9loop de la
JOLFRSURWHtQDGHHQYROWXUDJS/DODFWRIHUULQDHVWiSUHVHQWHD
XQDEDMDFRQFHQWUDFLyQHQODYDJLQD —JPO SHURHVWiVLJQL¿FD-
81
Capítulo 5 / Patogenia de las infecciones virales
Coronavirus
229E y C43
Adenovirus
Enterovirus
,QÀXHQ]D
Metapneumovirus humano
ParaLQÀXHQ]D
RSV
Rhinovirus
Resfrío común
+
++
++
++
+/-
+
+
+++
Amigdalitis
+++
-
++
+
+/-
+
+
-
Laringitis
+
-
+
++
+/-
+++
+
+
%URQTXLWLV
+
+
+
+++
+++
++
+++
+
%URQTXLROLWLV
+
+
+
++
+++
++
+++
++
1HXPRQtD
+
+
+
+++
+++
++
+++
++
Tabla 5.2. Virus asociados a infecciones respiratorias agudas altas y bajas en pacientes pediátricos. 5HFLHQWHPHQWHVHKDQGHVFXELHUWRGRVQXHYRVFRURQDYLUXVKXPDQRVGHQRPLQDGRV1/\+.8TXHLQIHFWDQHODSDUDWRUHVSLUDWRULR6XSDWRJHQLFLGDG±DOLJXDO
TXHODGHORVERFDYLUXV\ODGHORVSROLRPDYLUXV:XR.,±GHEHVHUD~QHVWDEOHFLGD
WLYDPHQWHFRQFHQWUDGDHQHOWDSyQYDJLQDO —JJ /DVĮGHIHQsinasWLHQHQHIHFWRVLQKLELWRULRVVREUHKHUSHVVLPSOH[\+,9IUHQWH
DHVWH~OWLPRLQKLEHQODIXVLyQYLUDODODPHPEUDQDFLWRSODVPiWLFD
H[KLEHVLPLOLWXGFRQODHVWUXFWXUDGHODJOLFRSURWHtQDGHHQYROWXUD
YLUDOJS \DQLYHOLQWUDFHOXODUPHGLDQWHLQKLELFLyQGHOD3.&6L
ELHQODVȕGHIHQVLQDVGHODPXFRVDRUDO +%'\+%' LQKLEHQDO
HIV, se desconoce si las mismas son inducidas en la vagina como
resultado de la infección por dicho virus.
$XQTXHORVPHFDQLVPRVTXHOOHYDQDYLDMDUDWUDYpVGHODPXFRVDYDJLQDODORVGLYHUVRVYLUXVQRHVWiQWRWDOPHQWHGH¿QLGRVSDrecería involucrar a las células del epitelio. En el caso del HIV, las
FpOXODVHSLWHOLDOHV\ODVGH/DQJHUKDQV pVWDVPHGLDQWHHQGRFLWRVLV
DWUDYpVGHP~OWLSOHVUHFHSWRUHV VRQODVSULPHUDVHQHQFRQWUDUVH
FRQHOYLUXV8QDYH]TXHpVWHDOFDQ]DODOiPLQDSURSLDSXHGHGLrectamente infectar macrófagos o OLQIRFLWRV7 PHGLDQWHODIXVLyQ
con el UHFHSWRUHVSHFt¿FR RDGKHULUVHDRWUDVCDs (DC-SIGN poVLWLYDV TXHOXHJRPLJUDQKDFLDORVJDQJOLRVUHJLRQDOHVGRQGH
transferirán las partículas virales a los linfocitos T CD4+ en los
que el virus replica vigorosamente ()LJXUD La infección de
éstos puede ocurrir mediante trans-infección o cis-infección de
las CDs )LJXUD . La trans-infección de éstas puede acaecer
por 2 vías: D el transporte viral a través de la vía endocítica y
posterior "regurgitación" en exosomas; RE OD sinapsis infecciosa, por contacto entre la &' FRQSDUWLFLSDFLyQGH'&6,*1 \
HOOLQIRFLWR7CD4+. La infección "genuina" de las CDs puede ocurrir subsiguientemente, luego de la interacción con los /7CD4+,
así como también es posible la misma luego de ocurrir la interacFLyQHQWUHXQDVLJQL¿FDWLYDFXDQWtDGHSDUWtFXODVGHOHIV con DCSIGN, para ser luego sean transferidas a los verdaderos receptores
del +,9HQODV&'VHLQLFLDUVXLQIHFFLyQSURGXFWLYD cis-infección
de las CDs). ([LVWHQ HYLGHQFLDV TXH LQGLFDQ TXH HVWD ~OWLPD HV
relevante para la infección a largo plazo de los linfocitos T CD4+,
KDELpQGRVHGRFXPHQWDGRTXHHVWHPHFDQLVPRVHUtDD~QPiVFUtWLFR
TXHODWUDQVLQIHFFLyQHQHOFRQWH[WRJHQHUDOGHODLQIHFFLyQ
La infección de las células de Langerhans tiene efectos opuestos según estén o no activadas: en el primer caso contribuyen a la
GLVHPLQDFLyQYLUDO\DTXHSHUPLWHQODUHSOLFDFLyQ\WUDQV¿HUHQOD
progenie a los OLQIRFLWRV 7 HQ HO JDQJOLR (Q FRQWUDSRVLFLyQ ODV
células de Langerhans inmaduras eliminan la infección a través de
la langerina, otro receptor lectina tipo C, que permite la internalización viral y promueve su degradación intracelular. Es posible que
una fracción de HIV escape a esta barrera antiviral, y pueda continuar el ciclo mediante la trans infección de los OLQIRFLWRV7CD4+
GHPHPRULD FRQODVXESREODFLyQYLUDO5 RHQHWDSDVPiVDYDQzadas de la infección los CD4+ naïve FRQODVXESREODFLyQ; La
coinfección con otros agentes de transmisión sexual, impide la
protección conferida por las células de Langerhans contra el
HIV, al activarlas.
/DSUHVHQFLDGHPROpFXODVGHKHSDUiQVXOIDWRVHQODVXSHU¿FLH
epitelial permite la adsorción de múltiples virus, tales como herpes
VLPSOH[HPV, HCMV, y ciertas cepas del HIV. Dichas moléculas
VLUYHQFRPRUHFHSWRUHVLQLFLDOHVGHEDMDD¿QLGDGTXHSHUPLWHQOD
VXEVLJXLHQWH LQWHUDFFLyQ FRQ RWURV UHFHSWRUHV GH PD\RU D¿QLGDG
DOJXQRV GH ORV FXDOHV KDQ VLGR GH¿QLGRV SDUD YLUXV LQGLYLGXDOHV
De hecho, entre los virus transmitidos por vía genital se encuenWUDQORVKHUSHVVLPSOH[WLSR±\FRQPHQRUIUHFXHQFLDHO±ORV
SDSLORPDYLUXV KXPDQRV HVSHFLDOPHQWH ORV JHQRWLSRV \ >GH
[email protected]\
\>HQWUHORVDSUR[LPDGDPHQWHGHDOWRULHVJRDVRFLDGRVDO
[email protected] +&09\ORVYLUXVFDXVDQWHVGHO6,'$ HIV\ $SUR[LPDGDPHQWHRFXUUHQQXHYDVLQIHFFLRQHV
GHWUDQVPLVLyQVH[XDODODxR'LFKDVLQIHFFLRQHV XOFHUDWLYDV\QR
XOFHUDWLYDV LQFUHPHQWDQHQWUH\YHFHVHOULHVJRGHinfección
por +,9VLHQGRHVWH~OWLPRYHFHVVXSHULRUHQSDFLHQWHVVL¿OtWLFRV
o en quienes padecen la infección genital herpética.
La infección por HPV afecta a más del 50% de la población
femenina sexualmente activa, lo que la ubica como la infección
GHWUDQVPLVLyQVH[XDOPiVSUHYDOHQWHGHOPXQGRDXQTXHODPD\RUtDGHODVPXMHUHVHOLPLQDODLQIHFFLyQDOFDERGHGRVDFLQFRDxRV
DSUR[LPDGDPHQWHXQGHVDUUROODXQDinfección persistente que
puede asociarse a diversos desenlaces dependiendo del genotipo, la
FDUJD\ODVYDULDQWHVYLUDOHV\GHFRIDFWRUHVGHOKRVSHGHUR VXVFHSWLELOLGDG\UHVSXHVWDLQPXQH \VXVKiELWRVFRQGXFWDOHV WDEDTXLVPR DQWLFRQFHSWLYRV KRUPRQDOHV HWF (O HPV interacciona iniFLDOPHQWHFRQSURWHRJOLFDQRVGHKHSDUiQVXOIDWR ORTXHSURPXHYH
XQFDPELRFRQIRUPDFLRQDOGHODFiSVLGH \TXL]iVWUDQVLWRULDPHQWH
FRQODODPLQLQDXRWUD V PROpFXOD V SUHVHQWH V HQODPDWUL]H[tracelular, para subsiguientemente ingresar a las células. La replicación del HPV es un paradigma de evasión a la respuesta inmune
LQQDWDGDGRTXHDTXpOODQRVHDVRFLDDLQÀDPDFLyQ
Se ha documentado la presencia de diversos virus en sePHQ\ÀXLGRVYDJLQDOHV. Merecen destacarse entre los primeros
HIV, HBV, HCMV, (%9YLUXVKHUSHVKXPDQR ++9 YLUXV
KHUSHVVLPSOH[,+7/9\XQDJHQWHDSDUHQWHPHQWHDSDWyJHQR
SDUDHOKXPDQR±SHURTXHSDUHFHUtDLQÀXLUIDYRUDEOHPHQWHVREUH
el curso de la infección con HIV– denominado *%9& LQLFLDOmente también designado virus KHSDWLWLV * ; asimismo, se han
aislado HIV, +%9+&09KHUSHVVLPSOH[\YLUXVrubéola de
ODVVHFUHFLRQHVFHUYLFDOHV/DLQIHFWLYLGDGYLUDOHQHVWRVÀXLGRV
HVWiLQÀXHQFLDGDSRUFRPSRQHQWHVGHHVWRV~OWLPRVDVtSRUHMHPSORVHKDGHPRVWUDGRTXHODSUHVHQFLDGH¿EULOODVGHDPLORLGHHQ
HOVHPHQ 6(9,Semen derived Enhacement of Viral Infection GHULYDGDVGHODIRVIDWDVDiFLGDSURVWiWLFDLQFUHPHQWDDyUGHnes de magnitud la adhesión/infectividad del HIV al funcionar
como un puente policatiónico que neutraliza la repulsión de carJDVQHJDWLYDVHQWUHODPHPEUDQDYLUDO\ODFLWRSODVPiWLFDGHOHSLtelio y CDs, favoreciendo la adherencia viral. Dado que en proPHGLRKD\SUHVHQWHVXQDVFRSLDVGH51$GHOHIV/ml de
semen en individuos infectados, una eyaculación de 4 ml implica
el depósito en la mucosa vaginal de una cuantía inferior a la del
XPEUDOQHFHVDULRSDUDSURGXFLUODLQIHFFLyQ ORFXDOFRQWULEX\HD
la inferior tasa de transmisión antes mencionada del HIV por vía
VH[XDOUHVSHFWRDRWURVYLUXVFRPR+%9 'HDOOtTXHODSDUWLFLpación de SEVI, sea crítica para incrementar la infectividad del
LQyFXOR(QFRQWUDSRVLFLyQWDPELpQVHKDSRVWXODGRODH[LVWHQFLD
82
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
Figura 5.8. Microscopía confocal de la mucosa rectal humana
conteniendo células que expresan DC-SIGN, CCR5 y CD4. DCSIGN se observa en color verde (paneles A-F), &&5HQURMR $\& R
D]XO ( &'HQURMR %'\( \HOPDUFDGRUGHFpOXODVHQGRWHOLDOHV
&'HQURMR ) /RVQ~FOHRVVHYLVXDOL]DQHQFRORUD]XO/DÀHFKD
LQGLFDXQDFpOXOD HQEODQFR TXHH[KLEHWULSOHPDUFDFLyQSDUDDCSIGN, &&5\&'/DOHWUD/PXHVWUDODOX]'H-DPHVRQ%et al.
J Virol.±5HSURGXFLGRFRQDXWRUL]DFLyQ
Figura 5.9. Microscopía confocal de la mucosa vaginal humana
para detectar células que expresen DC-SIGN, CCR5 y CD4. Las céOXODVGH/DQJHUKDQVQRH[SUHVDQ'&6,*1&RUWHVGHWHMLGRVFRQJHODGRV
GHYDJLQDIXHURQWHxLGRVFRQDQWLFXHUSRVSDUDDC-SIGN marcados ya sea
HQFRORUYHUGH SDQHOHV$% RURMR &' HQFRPELQDFLyQFRQDQWLFXHUSRV
para &&5HQURMR $ &'HQURMR % R&0+,,HQYHUGH &' \SDUD
ORVJUiQXORVGH%LUEHFNGHFpOXODVGH/DQJHUKDQVHQURMR ' /RVQ~FOHRV
VHYLVXDOL]DQHQFRORUD]XO/DFDEH]DGHÀHFKDEODQFDLQGLFDODEDVHGHO
HSLWHOLRYDJLQDO/DOHWUD/PXHVWUDODOX]['H-DPHVRQ%et al. J
Virol.±5HSURGXFLGRFRQDXWRUL]DFLyQ
de una molécula inhibitoria de dicho virus en el plasma seminal, dociclitis. La infección por estos virus promueve un desequilibrio
TXHFRQWHQGUtDFDUERKLGUDWRV SRVLEOHPHQWHXQDFDGHQDODUJDGH entre eventos angiogénicos y anti-angiogénicos, lo que gatilla la
UHVLGXRVGH1PDQRVD HLPSHGLUtDODXQLyQGHOHIV a DC-SIGN. vascularización corneal. Las trombospondinas\\SURWHtQDV
La presencia del HIV y del HBV en el canal de parto consti- GHODPDWUL]FHOXODU SRWHQWHVDJHQWHVDQWLDQJLRJpQLFRV HVWiQGLtuye una fuente importante de contagio en recién nacidos en países rectamente LPSOLFDGDV HQ OD JpQHVLV GH ODV TXHUDWLWLV YpDVH HO
con alta prevalencia de individuos crónicamente infectados.
tWHP0HFDQLVPRVLQGLUHFWRVGHOHVLyQ 2.5 VÍA CONJUNTIVAL
3. VÍAS
La secreción lacrimal y el constante parpadeo mantienen la conMXQWLYDK~PHGD\OLPSLD1XHYDPHQWHDTXtSDUDHYLWDUVHUDUUDVtrados por el mecanismo mencionado, los virus deben adherirse
¿UPHPHQWHDVXVUHFHSWRUHV6LELHQpVWDQRHVXQDYtDKDELWXDOGH
SHQHWUDFLyQYLUDOSXHGHRFXUULUHQFDVRGHOHVLyQGHODFRQMXQWLYD
$PRGRGHHMHPSORXQRIWDOPyORJRSXHGHVHUHOLQYROXQWDULR
WUDQVPLVRUGHXQRMRDORWURGHadenovirus WLSRDOLQWHQWDUXQD
H[WUDFFLyQGHXQFXHUSRH[WUDxRDWUDYpVGHOVLPSOHFRQWDFWRFRQ
ODVPDQRVFRQWDPLQDGDV2WURVYLUXVSXHGHQSURGXFLUXQDFRQMXQtivitis luego de haber replicado en otro órgano de la economía: tal
HVHOFDVRGHODFRQMXQWLYLWLVVDUDPSLRQRVDRODREVHUYDGDFRQFLHUtos adenovirus. En contraste con ellos, el HQWHURYLUXVSURGXFH
XQDFRQMXQWLYLWLVKHPRUUiJLFDOXHJRGHXQSHUtRGRGHLQFXEDFLyQ
GHVyORKRUDV\DTXHODFRQMXQWLYDHQVtPLVPDHVHOVLWLRLQLFLDO
GHODLQIHFFLyQ7DPELpQYDULDQWHVGH&R[VDFNLH$KDQVLGRDVRFLDGDVDEURWHVGHFRQMXQWLYLWLVKHPRUUiJLFDVDFDHFLGRVHQÈIULFD
y Brasil.
El espectro de compromiso ocular asociado a virus herpes simSOH[\LQFOX\HODVFRQMXQWLYLWLVODVTXHUDWLWLVFDWDUDWDVHLUL-
Las vías de diseminación pueden corresponder a uno de los siJXLHQWHVFLQFRJUXSRV GLVHPLQDFLyQORFDOVREUHODVVXSHU¿FLHV
HSLWHOLDOHV LQYDVLyQVXEHSLWHOLDO\GLVHPLQDFLyQOLQIiWLFD GLVHPLQDFLyQVDQJXtQHD YLUHPLD HLQYDVLyQWLVXODU GLVHPLQDFLyQ
D WUDYpV GHO OtTXLGR FHIDORUUDTXtGHR \ QHUYLRV GLVHPLQDFLyQ
pleural y a través de la cavidad peritoneal.
DE DISEMINACIÓN EN EL ORGANISMO
3.1 DISEMINACIÓN SOBRE SUPERFICIES EPITELIALES
/DGLVHPLQDFLyQYLUDOHQODVVXSHU¿FLHVHSLWHOLDOHVHVFODUDPHQWH
GLIHUHQWHVLHVWiQFXELHUWDVSRUXQDFDSDGHOtTXLGRWDOFRPRRFXUUH
HQHOWUDFWRUHVSLUDWRULRRGLJHVWLYRRVLHVDFXELHUWDQRH[LVWHWDO
como se observa en la piel.
En el primer caso, la diseminación viral desde el foco inicial de
infección hacia células distantes se ve facilitada, mientras que en el
VHJXQGRODGLVHPLQDFLyQVHHIHFW~DSRUFRQWLJLGDG(OORVHWUDGXFHSRUHMHPSORHQHOGLIHUHQWHSHUtRGRGHLQFXEDFLyQGHDPERVD pocos días en el caso de las infecciones respiratorias causadas por
LQÀXHQ]DSDUDLQÀXHQ]DDGHQRYLUXVUKLQRYLUXVRSV, HMPV, etc.,
83
Capítulo 5 / Patogenia de las infecciones virales
1
Infección
de la
mucosa
2
Mucosa
Macrófagos LT subepiteliales
Células de Langerhans
Migración de
las CDs y
diseminación
del HIV
Célula
dendrítica
mieloide
inmadura
3
Replicación
del HIV y
Rta. inmune
Célula
dendrítica
mieloide
madura
LT CD4+
activado
Ganglio
linfático
Figura 5.10. Rol de las CDs en la infección por HIV y su posterior diseminación. /DV&'V TXHLQFOX\HQDODVFpOXODVGH/DQJHUKDQV
HQORVHSLWHOLRV\HQODVPXFRVDV\DODVPLHORLGHVLQPDGXUDVHQODVXEPXFRVD FRQVWLWX\HQXQDGHODVSULPHUDVFpOXODVHQHQIUHQWDUDO
YLUXV/DV&'VPLHORLGHVLQPDGXUDVPLJUDQKDFLDORVJDQJOLRVOLQIiWLFRVGRQGHSXHGHQPDGXUDUFRPRUHVXOWDGRGHODLQIHFFLyQYLUDORGH
FLWRTXLQDVVHFUHWDGDV/DV&'VSUHVHQWDQORVDQWtJHQRVYLUDOHVDORVLT CD4+ HLQLFLDQVXSDUWLFLSDFLyQHQODUHVSXHVWDLQPXQHDGDSWDWLYD
/DVSDUWtFXODVYLUDOHVDVRFLDGDVDODV&'VSXHGHQTXHGDUSURWHJLGDVGHODGHJUDGDFLyQLQWUDFHOXODUGXUDQWHODPLJUDFLyQKDFLDHOJDQJOLR
OLQIiWLFR\GXUDQWHVXHVWDGtDDTXt$OJXQDVVXESREODFLRQHVGH&'VSXHGHQLQIHFWDUVH/DLQIHFFLyQGHORVLT CD4+ acontece mediante
eventos de trans-infección o cis-infección de las CDs (YpDVHOD¿JXUD RODVLQWHVWLQDOHVSURGXFLGDV±SRUHMHPSOR±SRUURWDYLUXVRSRUHO
FRQWUDULRE XQSHUtRGRGHLQFXEDFLyQPXFKRPiVSURORQJDGRSDUD
producir las lesiones verrucosas por HPV. Las bases patogénicas
TXH LQWHUYLHQHQ HQ OD ORFDOL]DFLyQ YLUDO H[FOXVLYDPHQWH FLUFXQVcripta a un epitelio determinado no se conocen totalmente. Entre
los factores que intervienen, deben señalarse la termosensibilidad
GHDOJXQRVYLUXVDƒ& FRPRRFXUUHFRQORVrinovirus, aunque
UHFLHQWHPHQWHVHGHPRVWUyTXHSXHGHQLQIHFWDUHOiUEROUHVSLUDWRULR
EDMR)LJXUD ODOLEHUDFLRQXQLGLUHFFLRQDOGHYLULRQHVKDFLD
ODVXSHU¿FLHH[WHUQDGHODVFpOXODVHSLWHOLDOHVSRODUL]DGDV\ODPDduración viral producida recién cuando las células de la capa basal
VHDSUR[LPDQDODVXSHU¿FLHORFXDOOLPLWDODGLVHPLQDFLyQDWHMLGRV
subyacentes, tal como se observa con los papilomavirus.
3.2 INVASIÓN SUBEPITELIAL Y DISEMINACIÓN LINFÁTICA
Al atravesar un epitelio y su membrana basal, un determinado viUXVTXHGDH[SXHVWRDFpOXODVIDJRFtWLFDV KLVWLRFLWRV \DOVLVWHPD
OLQIiWLFR/DHQWUDGDGHXQYLUXVDXQKLVWLRFLWRSXHGHGDUOXJDUD
su destrucción por disminución del pH y por las enzimas liberadas
al fagosoma al producirse la fusión lisosomal. Sin embargo, cierWRVYLUXVSXHGHQUHSOLFDUHQPDFUyIDJRVFRPRVHGHVFULELUiPiV
adelante.
/DUHGGHFDSLODUHVOLQIiWLFRVTXHEDxDQODVVXSHU¿FLHVHSLWHliales, transporta las partículas virales hacia los ganglios regionales
donde son procesadas por los macrófagos / CDs residentes en los
VHQRVPDUJLQDOHV(OGHVHQODFHGHGLFKDLQWHUDFFLyQHVYDULDEOH puede inactivarse el virus, en cuyo caso los antígenos son presentados a los linfocitos colindantes y, respuesta inmune mediante, la
LQIHFFLyQQRSURJUHVDR HOYLUXVQRHVLQDFWLYDGR\HQWRQFHVVH
produce la infección de macrófagos y linfocitos. Este último patrón
de infección se observa entre los adenovirus, el virus del sarampión, y algunos miembros del grupo de herpesvirus. En estos casos,
HOJDQJOLROLQIiWLFRQRVHFRPSRUWDFRPRXQDEDUUHUDGHFRQWHQFLyQ
de la infección, sino como un trampolín de privilegio para la diseminación de la misma.
7HQLHQGRHQFXHQWDODFLUFXODFLyQGHORVPRQRFLWRV\linfocitos
DWUDYpVGHORUJDQLVPRHVIiFLOPHQWHFRPSUHQVLEOHTXHVLGLFKDV
células son infectadas sin ser dañadas, pueden transportar viriones
a sitios distantes del cuerpo, a la manera de un inocente caballo de
7UR\D (Q HO FDVR SDUWLFXODU GHO HIV, el virus puede unirse a las
moléculas '&6,*1TXHVHHQFXHQWUDQHQODVXSHU¿FLHGHODV&'V
presentes en las mucosas y ser transportados en compartimientos
no lisosomales –sin que medie infección celular– desde la puerta
GHHQWUDGDDORVJDQJOLRVOLQIiWLFRVGRQGHSXHGHLQIHFWDUlinfocitos
7CD4+ &&5+XQSURFHVRTXH±FRPRVHPHQFLRQyHQSiUUDIRV
anteriores– es denominado trans-potenciación de la infección o
trans-infección )LJXUD (OYLUXVsarampión utiliza también
'&6,*1 DXQTXHQRHOUHFHSWRU6/$0 SDUDODWUDQVLQIHFFLyQ
desde las CDs a los OLQIRFLWRV7(QPRGRDQiORJRORVvirus Ébola
y dengue pueden utilizar mecanismos similares, para infectar las
FpOXODV GLDQD 7DPELpQ HO HCV interactúa con DC-SIGN y con
/6,*1 &'/ La HYROXFLyQGHXQDLQIHFFLyQYLUDOGHVGHXQDVXSHU¿FLHFRUSRUDO DSDUWLUGHFXDOTXLHUHSLWHOLR VHYHtQWLPDPHQWHYLQFXODGDDOD
SUHVHQFLDRQRGHXQDUHVSXHVWDLQÀDPDWRULDORFDO/DPLVPDSXHGH
inducir daño tisular o bien circunscribir la infección.
3.3 DISEMINACIÓN SANGUÍNEA E INVASIÓN TISULAR
La entrada de un virus al torrente sanguíneo se conoce como viremia. Puede producirse luego de la multiplicación viral en el sitio de
LQIHFFLyQ LQLFLDO WDO HV HO FDVR GH VDUDPSLyQ R SROLR R FRPR FRQsecuencia de su introducción directa al ser inoculado por picaduras
GHDUWUySRGRV FRPRVHREVHUYDFRQORVDUERYLUXV RSRUWUDQVPLVLyQ
LDWURJpQLFD FRPR SXHGH RFXUULU SRU HMHPSOR FRQ HBV o +&9 R
DFFLGHQWDOPHQWHSRUHOXVRGHDJXMDVFRQWDPLQDGDV SRUHMHPSORFRQ
HIV, HBV o +&9 VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
84
cis-infección (3)
trans-infección (1, 2)
Endocitosis
LT CD4+
1
Sinapsis
infecciosa
Fusión
CD4
CXCR4
CCR5
CD
Brotación
Exocitosis
3
Replicación
del HIV
2
Transferencia
vía exosomas
Figura 5.11. Trans-infección y cis-infección de las células dendríticas. /D WUDQVLQIHFFLyQ SXHGH RFXUULU PHGLDQWH GRV YtDV OD
VLQDSVLVLQIHFFLRVD\ ODWUDQVIHUHQFLDGHSDUWtFXODVDVRFLDGDVDH[RVRPDV(QODVLQDSVLVLQIHFFLRVDOD&'UHJXUJLWDODVSDUWtFXODVDORV
LT CD4+LQWHUYLQLHQGRHQHOSURFHVRODPROpFXOD'&6,*1(QODH[RFLWRVLVODVSDUWtFXODVGHO+,9HQGRFLWDGDVVHLQFRUSRUDQDORVFXHUSRVHQGRVyPLFRVPXOWLYHVLFXODUHVVLHQGRHOLPLQDGDVHQDVRFLDFLyQFRQH[RVRPDV8QFXHUSRPXOWLYHVLFXODUHVXQDRUJDQHODHQGRFtWLFD
TXHFRQWLHQHYHVtFXODVFRPRUHVXOWDGRGHODEURWDFLyQGHPHPEUDQDVHQGRVyPLFDVKDFLDODOX]GHOFRPSDUWLPLHQWR/DVSDUWtFXODVYLUDOHV
H[RFLWDGDVSXHGHQLQJUHVDUDORVLT CD4+SUREDEOHPHQWHPHGLDQWHODXQLyQ\IXVLyQGHPHPEUDQDV8QDWHUFHUDYtD PXHVWUDODFLV
LQIHFFLyQGHODV&'V(QHOODVHSURGXFHODLQIHFFLyQGHODVPLVPDV FRQVtQWHVLVde novoGHSDUWtFXODV ORFXDOHVFUtWLFRSDUDODWUDQVPLVLyQ
del +,9SRUSHUtRGRVSURORQJDGRV
La primera entrada de un virus a la sangre se conoce como viremia primaria )LJXUD (OORDFRQWHFHOXHJRGHODUHSOLFDFLyQ
viral en órganos tales como el hígado, el bazo, la médula ósea, el
músculo y/o el endotelio vascular. El título de virus circulante en
ODYLUHPLDSULPDULDHVKDELWXDOPHQWHEDMR(QJHQHUDOpVWHHVXQ
evento que no se traduce clínicamente. La diseminación viral hacia
yUJDQRVDGLVWDQFLDDWUDYpVGHOÀXMRVDQJXtQHRRFXUUHHQXQRRGRV
minutos. Una vez que el virus alcanza el órgano blanco de replicación se producen nuevos ciclos de multiplicación viral que permiten la reinvasión del torrente sanguíneo: es la viremia secundaria.
/DPLVPDHVIiFLOPHQWHGHWHFWDEOHSRUVXPD\RUFXDQWtD
Una vez en la sangre, los virus pueden circular libres en el plasPDRELHQDVRFLDGRVDGLIHUHQWHVFpOXODV 7DEOD (QHVWH~OWLPR
caso, los virus encuentran cierta protección frente a los mecanismos de defensa del hospedero.
La magnitud y duración de la viremia son el resultado del baODQFH¿QDOHQWUHDTXHOORVIDFWRUHVTXHWLHQGHQDODPDQWHQFLyQGH
la multiplicación viral o a su limitación. La posterior localización
viral en los órganos blanco depende de la actividad fagocítica del
sistema reticuloendotelial y de la capacidad para adherirse y multiplicarse en las células del endotelio vascular.
Entre las fuentes de producción de virus para la mantención
GHODYLUHPLDSXHGHQPHQFLRQDUVH HOHQGRWHOLRYDVFXODU ODV
FpOXODV UHWtFXORHQGRWHOLDOHV ODV FpOXODV DG\DFHQWHV DO VLVWHPD
UHWtFXORHQGRWHOLDO ODVFpOXODVVDQJXtQHDV\ ORVWHMLGRVGHVde los cuales los virus son eliminados hacia la circulación por vía
OLQIiWLFD
La eliminación viral de la circulación sanguínea es también deSHQGLHQWHGHXQQ~PHURFRQVLGHUDEOHGHIDFWRUHV HOWDPDxRGH
ODVSDUWtFXODVYLUDOHV IDFWRUHVVpULFRVFRPRanticuerpos y comSOHPHQWR ODFDUJDQHWDGHODVSDUWtFXODV HQDOJXQRVYLUXVOD
LQDFWLYDFLyQWpUPLFDJUDGXDO\ ODQDWXUDOH]DGHODVSURWHtQDVGH
VXSHU¿FLHGHORVYLUXV
Se ha demostrado que los virus de mayor tamaño se eliminan
PiVUiSLGDPHQWHGHODFLUFXODFLyQWHQLHQGRHVSHFLDOUHOHYDQFLDHQ
GLFKRSDSHOODVFpOXODVUHWtFXORHQGRWHOLDOHVGH.SIIHU/DSUHVHQcia de anticuerpos y complemento contribuye –mediante su opsonización– a la eliminación viral por células del sistema retículo-endotelial, teniendo en cuenta que los macrófagos poseen receptores
SDUD)F\ODIUDFFLyQ&GHOcomplemento. A su vez, los anticuerSRVQHXWUDOL]DQWHVSXHGHQSDUWLFLSDUHQODPRGL¿FDFLyQHVWUXFWXUDO
de los viriones, en su agregación, en el bloqueo de su unión a los
receptores, en la liberación de su genoma, etc.
La invasión viral tisular se produce por mecanismos que no se
conocen en su totalidad, aunque la patogenia de aquélla en el SNC
\HOKtJDGRHVODTXHPHMRUKDVLGRHVWDEOHFLGD
3.3.1 Invasión viral al SNC
Puede ocurrir cuando la viremia es de adecuada magnitud y duración. Sin embargo, éstos son requisitos necesarios aunque no siemSUHVX¿FLHQWHVSDUDSURGXFLUOD
(QHO61&ODVFpOXODVGHOHQGRWHOLRFDSLODUVHHQFXHQWUDQ¿UPHPHQWHXQLGDVHQWUHVtFRQH[FHSFLyQGHODVXELFDGDVHQHOSOH[RFRURLdeo, donde el epitelio es fenestrado. La infección de ese epitelio o el
SDVDMHSDVLYRDWUDYpVGHGLFKDVIHQHVWUDFLRQHVSHUPLWHHOLQJUHVRYLUDO
al líquido cefalorraquídeo. Vehiculizado en éste, ciertos virus pueden
infectar las células ependimarias, y a partir de allí invadir las células
QHUYLRVDVVXE\DFHQWHV WDOHVHOFDVRGHORVDUERYLUXVRHOYLUXVSDURWLGLWLV /DORFDOL]DFLyQYLUDOHQFpOXODVFDSLODUHVPHQtQJHDVWDPELpQ
SHUPLWHODLQYDVLyQGHFpOXODVQHXUDOHVDWUDYpVGHOSDVDMHDOOtTXLGR
FHIDORUUDTXtGHR )LQDOPHQWH DOJXQRV YLUXV SXHGHQ LQJUHVDU DO 61&
directamente después de localizarse en vasos sanguíneos cerebrales o
de la médula espinal o bien desde terminaciones nerviosas periféricas
YpDVHGLVHPLQDFLyQQHXUDO Como consecuencia de la invasión al SNC pueden observarse
PHQLQJLWLV SRUHMHPSORSURGXFLGDVSRUYLUXV(&+2R&R[VDFNLH PHQLQJRHQFHIDOLWLV FRPRVHREVHUYDFRQSDURWLGLWLV\YLUXVSROLR o HQFHIDOLWLV SURGXFLGD SRU LQYDVLyQ GLUHFWD H LQGHSHQGLHQWH GHO
cerebro a través de capilares cerebrales, como se demostró en infecciones por retrovirus o en algunos casos de SROLR Capítulo 5 / Patogenia de las infecciones virales
85
REVHUYDHQODLQIHFFLyQH[SHULPHQWDOLQWUDYHQRVDGHSULPDWHVFRQ
virus SROLR /DSUHVHQFLDGHUHFHSWRUHVFHOXODUHVSDUDYLUXVHQORV
hepatocitos permite también la entrada de virus que se multiplican
en ellos, induciendo el desarrollo de KHSDWLWLV hepatitis A, B, C y
(¿HEUHDPDULOOD+&09(%9HWF $OJXQRVYLUXVVHUiQHQWRQFHVOLEHUDGRVDOFRQGXFWRELOLDU SRUHMKHSDWLWLV$\KHSDWLWLV( R
ELHQWUDQVSRUWDGRVQXHYDPHQWHDOWRUUHQWHVDQJXtQHR hepatitis B y
KHSDWLWV& )LQDOPHQWHDOJXQRVYLUXVSXHGHQUHSOLFDUHQPDFUyIDJRVKHSiWLFRV\DSDUWLUGHDOOtLQYDGLUHOWRUUHQWHVDQJXtQHRRELHQ
infectar KHSDWRFLWRV ¿HEUHDPDULOOD Véase el capítulo 24.1 para
analizar la modulación inmunológica de las infecciones por virus
hepatotrópicos primarios.
Figura 5.12. Infección de células epiteliales tráqueo-bronquiales humanas por rhinovirus. &RORFDOL]DFLyQGHFLWRTXHUDWLQD
WHxLGRPHGLDQWH,),FRQLVRWLRFLDQDWRGHÀXRUHVFHtQDHQFRORUYHUGH \DQWtJHQR93GHODFiSVLGHGHUKLQRYLUXV WHxLGRFRQ$OH[DÀXRU HQ URMR HQ FpOXODV EDVDOHV /D H[SUHVLyQ GH DQWtJHQRV
YLUDOHVVHREVHUYDWDQWRHQFpOXODVTXHH[SUHVDQFLWRTXHUDWLQD
LQGLFDGDV FRQ ÀHFKDV FRPR HQ DTXHOODV TXH FDUHFHQ GH GLFKR
PDUFDGRU VHxDODGDV FRQ SXQWDV GH ÀHFKDV (O FRORU DPDULOOR UHVXOWDGHODFRORFDOL]DFLyQGHODFLWRTXHUDWLQD\HODQWtJHQR93
'H -DNLHOD % et al. Am J Respir Cell Mol Biol. 5HSURGXFLGRFRQDXWRUL]DFLyQ
Las células endoteliales participan en la patogenia de la infecFLyQGHO61&\DVHDDWUDYpVGHOSDVDMHSDVLYRWUDQVHQGRWHOLDOGH
OHXFRFLWRV\PRQRFLWRVTXHWUDQVSRUWDQYLUXV FRPRVHREVHUYDHQ
las infecciones producidas por sarampión, parotiditis, togavirus y
OHQWLYLUXV RELHQFRPRVLWLRDFWLYRGHODUHSOLFDFLyQYLUDO VHJ~QVH
demostró en infecciones por HQWHURYLUXVWRJDYLUXV\EXQ\DYLUXV 3.3.2 Invasión viral hepática
La SDWRJHQLDGHODLQYDVLyQKHSiWLFDHVWitQWLPDPHQWHYLQFXODGDD
ODLQWHUDFFLyQHQWUHHOYLUXVLQIHFWDQWH\ODVFpOXODVPDFURIiJLFDV
VLQXVRLGDOHV FpOXODVGH.SIIHU $VtSXHGHQREVHUYDUVHFXDWURVLWXDFLRQHVGLVtPLOHV ODVFpOXODVGH.SIIHUQRFDSWDQORVYLUXV ORVPDFUyIDJRVFDSWDQORVYLUXV\SURGXFHQVXLQDFWLYDFLyQ ORV
PDFUyIDJRVFDSWDQORVYLUXV\ORVWUDQV¿HUHQDKHSDWRFLWRV\ ORV
YLUXVUHSOLFDQHQFpOXODVPDFURIiJLFDV\RHQGRWHOLDOHV/DIDOWD
GHFDSWDFLyQYLUDOSRUSDUWHGHORVPDFUyIDJRVKHSiWLFRVIDYRUHFH
la viremia persistente. Sin embargo, la mayoría de los virus que
producen viremia son inactivados por dichas células. En algunos
casos, se produce la transferencia viral pasiva hacia los hepatocitos. Si éstos no son permisivos para un virus dado, éste no replicaUiDXQTXHSRGUiVHUHOLPLQDGRSRUHOFRQGXFWRELOLDU WDOFRPRVH
3.3.3 Diseminación virémica a otros órganos o tejidos
/DGLVHPLQDFLyQYLUpPLFDDyUJDQRV\WHMLGRV )LJXUD SXHGH
RFXUULUDGHPiVDVLWLRVWDQGLVtPLOHVFRPRODVJOiQGXODVVDOLYDOHV
PDPDULDVODSLWXLWDULDRODWLURLGHVWLPRSiQFUHDVWHVWtFXORVULxRnes, suprarrenales, tracto respiratorio, músculos, articulaciones o
piel. A su vez, algunos virus pueden atravesar la barrera placentaria
y causar infecciones en el producto de la concepción. La patogenia
GHODVLQIHFFLRQHVYLUDOHVHQGLFKRVFRPSDUWLPHQWRVVHGHVFULELUi
individualmente en capítulos posteriores. A continuación, sólo se
PHQFLRQDUiQDOJXQRVFRPHQWDULRVGHHMHPSORVLOXVWUDWLYRV
/D SUHVHQFLD GH YLUXV HQ ODV JOiQGXODV VDOLYDOHV SXHGH R QR
LU DFRPSDxDGD GH FDPELRV LQÀDPDWRULRV FRPR VH REVHUYD HQ OD
infección por virus parotiditis o HCMV, respectivamente. La repliFDFLyQGHHVWH~OWLPRWDPELpQHQWHMLGRJODQGXODUPDPDULRH[SOLFD
VXH[FUHFLyQDWUDYpVGHODOHFKHPDWHUQD
Entre los virus que se han visto asociados a pancreatitis se pueden mencionar: &R[VDFNLH % rubéola y parotiditis. La infección
de las células beta conduce ocasionalmente a hiperglucemias en el
KRPEUH6LQHPEDUJRVXIUHFXHQFLDUHDOVHGHVFRQRFH(OSiQFUHDV
puede también participar en la infección persistente por HBV.
La invasión renal habitualmente involucra infección de las células epiteliales tubulares. Los virus que replican en esas células
SXHGHQ VHU D VX YH] H[FUHWDGRV SRU RULQD (VWH KHFKR SXHGH VHU
aprovechado para su diagnóstico mediante técnicas para detección
GHDQWtJHQRVRiFLGRVQXFOHLFRV(QWUHORVYLUXVTXHVHH[FUHWDQSRU
orina debe mencionarse los virus BK, HCMV, sarampión y Junín.
6LQHPEDUJRHOFRPSURPLVRUHQDOHQODVLQIHFFLRQHVYLUDOHVQRHVWi
habitualmente asociado a la infección directa de células, sino al deSyVLWRGHFRPSOHMRVLQPXQHVHQORVJORPpUXORV'LFKDVLWXDFLyQVH
ha descripto en la hepatitis B, la hepatitis C y la rubéola, entre otras.
/D SDUWLFLSDFLyQ GHO iUERO UHVSLUDWRULR FRPR UHVXOWDGR GH OD
diseminación virémica se observa frecuentemente en el curso de
algunas infecciones generalizadas como las producidas por viruela
\D HUUDGLFDGD sarampión, HCMV, varicela-zóster en inmunocomprometidos, rubéola, etc.
Los cuadros anatomopatológicos pueden corresponder a neumonitis intersticiales, neumonías o bronquitis.
Las orquitis virales se asocian frecuentemente al virus parotiditis, aunque también se ha observado en relación a infecciones
por &R[VDFNLH%
Las miositis virales en el hombre son generalmente causadas
por togavirus, &R[VDFNLH%\YLUXVLQÀXHQ]D$VXYH]VHKDGHmostrado la participación de &R[VDFNLH%LQÀXHQ]D\HU\WKURYLUXV
SDUYRYLUXV KXPDQR%HQSDFLHQWHVFRQGDxRPLRFiUGLFR
El compromiso articular en las infecciones virales puede deEHUVH D OD SUHVHQFLD GH YLUXV LQIHFFLRVR FRPR VH REVHUYD HQ HO
FXUVRGHODLQIHFFLyQUXEHyOLFD RDOGHSyVLWRGHLQPXQRFRPSOHMRV
FRPRSRUHMHPSORHOTXHVHSURGXFHHQHOFXUVRGHODLQIHFFLyQ
con +%9 (OHU\WKURYLUXV%HVHODJHQWHFDXVDOGHEURWHVGHHULWHPDLQIHFFLRVR WDHQIHUPHGDG DFRPSDxDGRVGHDUWULWLV\FULVLV
DQpPLFDVDSOiVLFDV(QODrubéola, así como en la infección por el
SDUYRYLUXV%RSRUFLHUWRVDOIDYLUXVODDUWULWLVHVXQDPDQLIHVWDción característica. La artritis no es inusual luego de las infecciones
por HIV, HCV, HCMV y EBV.
En ciertas infecciones virales, la aparición de H[DQWHPDVHQOD
SLHOSXHGHDWULEXLUVHDOGHSyVLWRGHLQPXQRFRPSOHMRVDXQTXHWDP-
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
86
Libres
en plasma
(QWHURYLUXV
Asociados a células
Eritrocitos
9LUXVGHOD¿HEUHSRU
garrapatas de Colorado
Linfocitos
Monocitos
Plaquetas*
+&09
9LUXHOD
LCM
7RJDYLUXV
(SVWHLQ%DUU
+,9
'HQJXH
+%9
++9
+&9
+&9
++9
+,9
++9
5XEpROD
Parotiditis
+%9
+&9
+,9
+7/9
LCM
*%9&
Tabla 5.3. Transporte de virus en sangre: algunos ejemplos. +%9YLUXVKHSDWLWLV%+&9YLUXVKHSDWLWLV&++9YLUXVKHUSHVKXPDQR WLSRV~ +7/9YLUXVGHOD/HXFHPLD7KXPDQD/&0YLUXVGHODFRULRPHQLQJLWLVOLQIRFLWDULD*%9&YLUXV*% LQLFLDOHVGHXQ
FLUXMDQRFX\RVXHURHVWDEDLQIHFWDGRSRUHVWHYLUXV WLSR& +,9+&9\ODFHSDSDWyJHQD;-GHYLUXV-XQtQLQIHFWDQPHJDFDULRFLWRVOR
FXDOVHSXHGHDVRFLDUDHYHQWRVGHWURPERFLWRSHQLDSRUGLYHUVRVPHFDQLVPRV
bién puede detectarse virus infeccioso en algunos casos. En otras
virosis, la participación de la inmunidad celular en el desarrollo del
H[DQWHPDQRKDVLGRGH¿QLWLYDPHQWHHVWDEOHFLGD
(QWUHORVYLUXVTXHSUREDEOHPHQWHSURGXFHQH[DQWHPDSRUGHSyVLWRGHLQPXQRFRPSOHMRVVHSXHGHQPHQFLRQDUDOYLUXVGHQJXH\
al HBV, este último en el estadio prodrómico de la enfermedad. Se
KDGHPRVWUDGRODSUHVHQFLDGHYLUXVHQODVOHVLRQHVH[DQWHPiWLFDV
causadas por UXEpRODYLUXV(&+2\\SRU&R[VDFNLH$
$$\%DXQTXHQRVHSURGXFHOLEHUDFLyQGHGLFKRVDJHQWHV
DOH[WHULRU2EYLDPHQWHHOORLPSOLFDTXHODREWHQFLyQGHPXHVWUDV
FRQ ¿QHV GLDJQyVWLFRV QR GHEH HIHFWXDUVH D SDUWLU GHO H[DQWHPD
La SDWRJHQLDGHOH[DQWHPDVDUDPSLRQRVRSDUHFHUtDHVWDUSULQFLSDOmente mediado por una respuesta de inmunidad celular, ya que la
OHVLyQ PiFXORSDSXODU GH OD SLHO QR VH REVHUYD HQ SDFLHQWHV FRQ
VLJQL¿FDWLYR Gp¿FLW GH OD UHVSXHVWD OLQIRFLWR 7GHSHQGLHQWH /RV
focos de replicación del virus sarampión en la epidermis quedan
UHVWULQJLGRVD]RQDVSUy[LPDVDORVYDVRVVDQJXtQHRV\QRVHOLEHUD
YLUXVDOH[WHULRU
Por el contrario, la presencia de virus en piel en lesiones vesiFXORVDV KHUSHVVLPSOH[YDULFHOD]yVWHU IDFLOLWDVXGLVHPLQDFLyQ
DOH[WHULRU(QHVWRVFDVRVHVSRVLEOHDLVODUHOYLUXVHQODVOHVLRQHV
5HFXpUGHVHTXHODORFDOL]DFLyQFXWiQHDGHOYLUXVGHOKHUSHVVLPSOH[HQODVOHVLRQHVUHFXUUHQWHVRGHOYLUXVYDULFHOD]yVWHUHQORV
episodios de zóster, no se deben a la diseminación virémica sino al
WUDQVSRUWHGHYLUXVSRUYtDQHUYLRVD YpDVHHOHStJUDIHGHOD)LJXUD
\HOtWHP (O HPSOHR GH DQLPDOHV GH H[SHULPHQWDFLyQ KD SHUPLWLGR GLlucidar fehacientemente la participación de algunos órganos en la
patogénesis de ciertas virosis. A continuación se mencionan dos
HMHPSORVLOXVWUDWLYRV
(OHIHFWRGHXQDLQIHFFLyQYLUDOHQODKLSy¿VLV\HOWLPRIXHHVWXGLDGRHQUDWRQHVLQRFXODGRVH[SHULPHQWDOPHQWHFRQDUHQDYLUXV
Se ha observado que ratones persistentemente infectados con el virus LCM tienen afectada la producción de hormona de crecimiento
sin que medie daño histológico aparente. A su vez, la infección con
virus Junín de células tímicas en ratones recién nacidos se asocia
a persistencia viral en el SNC. En estos animales, la imposibilidad
de sus OLQIRFLWRV 7 GH LQGXFLU XQD UHVSXHVWD HIHFWRUD HQ HO 61&
FRQWUDVWDFRQODPHQLQJRHQFHIDORPLHOLWLV7GHSHQGLHQWHTXHVHREVHUYDKDELWXDOPHQWHHQUDWRQHVODFWDQWHVGHDGtDVGHHGDG
3.3.4 Diseminación viral transplacentaria
/D WUDQVPLVLyQ YLUDO WUDQVSODFHQWDULD YHUWLFDO HV XQ HYHQWR FLUFXQVFULSWR D SRFRV YLUXV HQ HO VHU KXPDQR 7DEOD . Se desconoce el mecanismo patogénico de la invasión fetal, aunque la
localización viral previa en los vasos placentarios parecería ser un
paso necesario. Habitualmente se pueden detectar focos localizados de infección placentaria en la rubéola o en la enfermedad citoPHJiOLFD6LPLODUHVKDOOD]JRVIXHURQGHVFULSWRVDQWHULRUPHQWHHQ
la infección por viruela. El espectro de manifestaciones clínicas en
el feto es variable. En los primeros meses de gestación, el feto es
incapaz de montar una respuesta inmune. En contraposición, hacia
la mitad del embarazo, pueden detectarse IgM, IgG, IgA, linfociWRV7células NK e LQWHUIHUyQHQWHMLGRVLQIHFWDGRVFX\RJUDGRGH
participación en la limitación o eventual agravamiento de las infecciones virales aún se desconoce. Sin embargo, el feto muestra una
VLJQL¿FDWLYDFDSDFLGDGSDUDUHSDUDU\FRPSHQVDUHOGDxRKtVWLFR
(VSRUHOORTXHVLHOYLUXVQRHVPX\FLWRFtGLFRHOIHWRVREUHYLYLUi
Caso contrario, el resultado de la infección es la muerte fetal y el
aborto. Las consecuencias de la infección intrauterina son dependientes del momento de la infección, del agente etiológico y de la
respuesta del hospedero.
Como resultado de la infección rubeólica puede producirse un
efecto teratogénico en el producto de la concepción o inducirse el
DERUWR([LVWHDSUR[LPDGDPHQWHXQGHULHVJRGHRFXUUHQFLDGH
malformaciones congénitas cuando la infección se produce en los
tres primeros meses del embarazo. Dado que la organogénesis ocurre
KDVWDODVVHPDQDVGLFKDVPDOIRUPDFLRQHVVRQLPSUREDEOHVPiV
87
Capítulo 5 / Patogenia de las infecciones virales
Figura 5.13. La expresión de la cápside del virus rubéola induce la formación de zonas electrón-densas entre mitocondrias.
&pOXODV+(.75&%WUDQVIHFWDGDVFRQHOJHQGHODFiSVLGHGHUXEpRODHQIRUPDHVWDEOHHLQGXFLEOHIXHURQSURSDJDGDVHQSUHVHQFLD
RDXVHQFLDGHOLQGXFWRUGR[LFLFOLQD GR[ GXUDQWHKRUDV $ Western blotGHOLVDGRVFHOXODUHVXWLOL]DGRVSDUDGHWHFWDUODH[SUHVLyQGHOD
cápside viral mediante de DQWLFXHUSRVHVSHFt¿FRV %( &pOXODVSURSDJDGDVHQDXVHQFLD % RSUHVHQFLD &( GHOLQGXFWRUGXUDQWHKV
DQWHVGHOD¿MDFLyQSDUD0(/DVFpOXODVQRLQGXFLGDV QRH[SUHVDQODFiSVLGHGHUXEpROD H[KLEHQPRUIRORJtDQRUPDOGHODVPLWRFRQGULDV
(QODVFpOXODVLQGXFLGDVVHREVHUYDODIRUPDFLyQGHSODFHVHOHFWUyQGHQVDVHQWUHPLWRFRQGULDVDG\DFHQWHV/DEDUUDLQGLFDQP'H
%HDWFK0'et al. J ViroO5HSURGXFLGRFRQDXWRUL]DFLyQ
HCMV cepa Toledo
IgG materna
ANTICUERPOS
NEUTRALIZANTES
ALTO
TÍTULO
Virus en STB
y en macrófagos
BAJO
TÍTULO
Virus en CTB
Figura 5.14. Infección transplacentaria por citomegalovirus humano (HCMV). 5HSOLFDFLyQGHO+&09HQH[SODQWRVGHSODFHQWDGHSHQGLHQWHGHOWtWXORGHDQWLFXHUSRVQHXWUDOL]DQWHVPDWHUQRV67%6LQFLFLRWURIREODVWR&7%&LWRWURIREODVWR0Ɏ0DFUyIDJR9&9LOOXVcore
FHQWURGHODYHOORVLGDG ¿E)LEUREODVWRVGHOHVWURPD'H0DLGMLet al. Am J Pathol. 5HSURGXFLGRFRQDXWRUL]DFLyQ
DOOiGHHVWHPRPHQWRDXQTXHVHSURGX]FDHQWRQFHVODLQIHFFLyQGHO
feto. En la infección rubeólica congénita hay una interferencia en
HOSURFHVRGHIRUPDFLyQGHyUJDQRVYLWDOHV FRUD]yQFHUHEURRMRV
RtGRVHWF FRQODFRQVLJXLHQWHDIHFWDFLyQIXQFLRQDOGHORVPLVPRV
3DUDGyMLFDPHQWHDXQTXHSXHGHGHWHFWDUVHDOYLUXVrubéola en múltiSOHVyUJDQRVODVFpOXODVLQIHFWDGDVVRQHVFDVDV\HVWiQDJUXSDGDVHQ
focos. Aunque el mecanismo íntimo de lesión de los órganos fetales
no ha sido establecido, se han observado en estudios in vitro con
células de embrión humano, rupturas cromosómicas e inhibición de
la mitosis normal. Se ha postulado la participación de la replicasa
YLUDO3HQODLQGXFFLyQGHHYHQWRVDSRSWyWLFRVPHGLDGRVSRUVX
XQLyQDODSURWHtQDUHJXODWRULDGHODFLWRTXLQHVLV &LWURQ.TXLQDVD lo cual deviene en la detención del ciclo celular luego de la fase S,
generando un estado de tetraploidía que podría promover la muerte
celular programada mediada por FDVSDVDV 7DPELpQ VH KDQ GRFXPHQWDGRDOWHUDFLRQHVPRUIROyJLFDVHQODVPLWRFRQGULDV IRUPDFLyQ
de estructuras electrón-densas que se enfrentan –entre otras locali]DFLRQHV±HQWUHODPHPEUDQDH[WHUQDPLWRFRQGULDO\ODGHOUHWtFXOR
88
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
HQGRSOiVPLFR¿JXUD DJUXSDPLHQWRPLWRFRQGULDODOUHGHGRUGH
ORVFRPSOHMRVGHUHSOLFDFLyQYLUDO\GHVSROLPHUL]DFLyQGHORV¿ODmentos de actina. Estas alteraciones muy probablemente desempeñen un rol en la teratogénesis.
El HCMV es el agente etiológico de la primera causa munGLDOGHLQIHFFLRQHVFRQJpQLWDV$SUR[LPDGDPHQWHXQGH
WRGRV ORV QDFLGRV YLYRV H[KLEHQ LQIHFFLyQ FRQJpQLWD SRU +&09
\ XQ SRUFHQWDMH YDULDEOH GH HOORV SDGHFH VtQWRPDV DO
nacer, aunque las secuelas neurosensoriales y psicomotoras pueGHQWDPELpQREVHUYDUVHXOWHULRUPHQWHHQXQGHORVQHRQDWRV
DVLQWRPiWLFRV/DLQIHFFLyQFRQJpQLWDSRU+&09HVODFDXVDPiV
importante que puede conducir a un daño del desarrollo del SNC,
que incluye retardo mental, pérdida de la audición y de la visión. El
UHFLpQQDFLGRVLQWRPiWLFRH[KLEHIUHFXHQWHPHQWHODWUtDGDLFWHULFLD
hepato-esplenomegalia y petequias, aunque puede observarse tamELpQPLFURFHIDOLDYHQWULFXORPHJDOLD\FDOFL¿FDFLRQHVLQWUDFUDQHDles. La infección congénita puede ocurrir en el transcurso de la primoinfección materna o –con mucho menor frecuencia– como consecuencia de una reactivación viral asociada a inmunosupresión
SRUHMHPSORHQSDFLHQWHVFRQWUDVSODQWHGHPpGXODyVHDRULxyQ Los anticuerpos anti-HCMV maternos modulan la transmisión
YHUWLFDOVHJ~QVXWtWXORDFWLYLGDGQHXWUDOL]DQWH\DYLGH]%DMRVWttulos de anticuerpos –frecuentemente dirigidos contra epítopes de
proteínas que no generan anticuerpos neutralizantes– la facilitan,
DO SURPRYHU HO SDVDMH YLUDO DO FLWRWURIREODVWR PHGLDQWH WUDQVFLWRsis de las vesículas endocíticas a través del sinciciotrofoblasto utilizando el UHFHSWRU QHRQDWDO SDUD )F /RV YLULRQHV DVRFLDGRV VRQ
luego capturados por macrófagos, desde donde se propagan hacia
HO HVWURPD )LJXUD (Q FRQWUDSRVLFLyQ HOHYDGRV WtWXORV GH
,J*QHXWUDOL]DQWHVGHDOWDDYLGH]VHXQHQDODJOLFRSURWHtQDJ%
GHHQYROWXUDYLUDOIRUPDQGRFRPSOHMRVTXHVRQWUDQVSRUWDGRVHQ
cavéolas, luego captadas por macrófagos en el citotrofoblasto sin
LQIHFWDUORV SURGXFWLYDPHQWH véase ítem 5.1 DVRFLiQGRVH HOOR D
protección. El HCMV promueve la degradación de receptores para
el factor de crecimiento derivado de SODTXHWDV Platelet Derived
Growth Factor Į \ ȕ HQ ¿EUREODVWRV \ FpOXODV GH P~VFXOR OLVR
Dicho factor induce la diferenciación de estas últimas, promovienGR HO FDPELR GH VX IHQRWLSR FRQWUiFWLO D XQR VHFUHWRU GHO SURSLR
3'*)/DGHJUDGDFLyQGHVXVUHFHSWRUHVFRQGXFHDGHIHFWRVHQHO
desarrollo del SNC, aparato cardiovascular y órganos epiteliales
del feto mediante falla en la diferenciación, migración y/o prolifeUDFLyQFHOXODU\DOWHUDFLRQHVHQHOGHSyVLWRGHPDWUL]H[WUDFHOXODU
de un gran espectro de células mesenquimatosas, gliales y migraWRULDV7DPELpQVHKDSRVWXODGRTXHHOGDxRKtVWLFRGHO61&SRGUtD
atribuirse parcialmente a otros factores, tales como la infección
HQGRWHOLDO TXH VH DVRFLD D ODV YDVFXOLWLV TXH FRQGLFLRQDQ HO ÀXMR
sanguíneo, la alteración de la maduración de células neuronales y
JOLDOHV\DODSURSLDUHVSXHVWDLQÀDPDWRULD
/DLQIHFFLyQFRQJpQLWDSRUHU\WKURYLUXV SDUYRYLUXV KXPDQR
%KDVLGRIHKDFLHQWHPHQWHGRFXPHQWDGDODLQFLGHQFLDGHODLQIHFFLyQSULPDULDGXUDQWHHOHPEDUD]RVHHVWLPDHQHOGHORV
HPEDUD]RV\ODVXEVLJXLHQWHWUDQVPLVLyQWUDQVSODFHQWDULDGHO
7HQLHQGRHQFXHQWDODLQWHQVDYLUHPLDPDWHUQD a copias
JHQyPLFDVPOGHVXHUR \HOUHTXHULPLHQWRYLUDOSRUODVFpOXODV
en división, se ha postulado que el resultado de dicha infección
FRQJpQLWDVHDVRFLDUtDWRGDYtDPiVIUHFXHQWHPHQWHFRQDERUWRVHVSRQWiQHRVRPXHUWHIHWDOTXHFRQDQRUPDOLGDGHVItVLFDV(OrecepWRUFHOXODUSDUDHOYLUXVHVHOJOREyVLGR3HOTXHHVWiSUHVHQWHHQ
trofoblasto, células progenitoras de la serie eritroide, miocardiocitos, células endoteliales y megacariocitos. La infección de células
susceptibles pero no permisivas del trofoblasto promueve eventos
apoptóticos mediados por caspasas, que se asocian a la muerte fetal. La grave anemia fetal debido a la infección de células eritroides
SURJHQLWRUDV±HVSHFLDOPHQWHHQODIDVHKHSiWLFDGHODHULWURSR\HVLV
IHWDOTXHDFRQWHFHHQWUHODV\VHPDQDVGHJHVWDFLyQ±VHDVRcia a falla cardíaca y al consiguiente hidrops fetalis no inmune.
$VLPLVPR OD LQIHFFLyQ GH FpOXODV PLRFiUGLFDV GHVHQFDGHQD XQD
PLRFDUGLWLVTXHDJUDYDODIDOODGHOyUJDQR7DPELpQSXHGHQRFXUULU
anomalías neurológicas. El riesgo de un desenlace desfavorable
SDUDHOSURGXFWRGHODFRQFHSFLyQHVPi[LPRVLODLQIHFFLyQSULPDria materna ocurre en los dos primeros trimestres de la gestación,
aunque puede acaecer también en el último trimestre.
La transmisión del +,9GHODPDGUH QRWUDWDGDFRQDQWLUUHWURYLUDOHV DOKLMR LQGHSHQGLHQWHPHQWHGHODYtD RFXUUHHQHO
GHORVFDVRVGHSHQGLHQGRGHIDFWRUHVGHPRJUi¿FRVJHRJUi¿FRV\HSLGHPLROyJLFRVGHODVFRKRUWHVHVWXGLDGDV3DUDHOORVH
UHFRQRFHQWUHVSRVLEOHVYtDVGHFRQWDJLRODLQWUDXWHULQD WUDQVSODFHQWDULD ODTXHRFXUUHGXUDQWHHOPRPHQWRGHOSDUWR FRQQDWDO \ODTXHWLHQHOXJDUSRVSDUWRDWUDYpVGHODDOLPHQWDFLyQOiFWHD
$XQTXHODPD\RUtDGHODVLQIHFFLRQHVPDGUHKLMRSRUHIV aconWHFHQDOPRPHQWRGHDWUDYHVDUHOFDQDOGHSDUWR a XQ
RFXUUHSRUYtDWUDQVSODFHQWDULD6HSRVWXODTXHHQODWUDQVPLVLyQYLUDODOIHWRLQWHUYLHQHQIDFWRUHVYLUDOHV WURSLVPRYLUDOFDPbios en el gen env PDWHUQRV HVWDGRLQPXQHDEXVRGHGURJDV
nivel de DQWLFXHUSRV \YLQFXODGRVDOHPEDUD]R LQWHJULGDGGHOD
SODFHQWD YLULRQHV HQ HO ÀXLGR DPQLyWLFR WUDQVIHUHQFLD GH FpOXlas maternas o DQWLFXHUSRVHWF /DWUDQVPLVLyQWUDQVSODFHQWDULD
puede ocurrir a través de células endoteliales CD4+ o de células
de Hofbauer CD4+ FpOXODVGHHVWLUSHPDFURIiJLFDTXHDGHPiVGH
'&6,*1WDPELpQH[SUHVDQORVFRUUHFHSWRUHVSDUDHIV &&5\
&;&5 SUHVHQWHVHQHOFHQWURGHODVYHOORVLGDGHVFRULyQLFDV/D
presencia de la molécula DC-SIGN en células de placenta permite la infección en trans trans-infección GHFpOXODVTXHH[SUHVDQ
CD4 o receptores para quimioquinas. Las células trofoblásticas
pueden ser blanco de la infección viral y/o pueden ser utilizadas por el virus para transportarse mediante transcitosis
a través de la barrera placentaria. La transmisión vertical del
HIV por ambos mecanismos puede ser promovida o inhibida por
factores vinculados al fenotipo viral y al microambiente celular,
LQÀXLGRSRUcitoquinas y quimioquinas. La transmisión del HIV
HVWi DVRFLDGD D OD VHOHFFLyQ GH YDULDQWHV JHQRWtSLFDV SXGLHQGR
VHUDXQPLQRULWDULDVHQODPDGUH TXHHYDGHQODpresión de selección de la respuesta inmune materna. Estudios in vitro documenWDURQTXHHOSDVDMHWUDQVSODFHQWDULRHVWiPRGXODGRSRUODDFWLYDción celular producida por el contacto intercelular, lo que regula
los niveles de 5$17(6\0,3ȕDVtFRPRSRU71)ĮH,/
los que disminuyen o aumentan, respectivamente, la producción
viral en el trofoblasto.
3.4 DISEMINACIÓN NEURAL
<DVHKDPHQFLRQDGRTXHODGLVHPLQDFLyQYLUDODO61&QRVyORVH
SURGXFHDWUDYpVGHORVYDVRVVLQRWDPELpQDWUDYpVGHOSDVDMHSRU
ODEDUUHUDKHPDWRHQFHIiOLFDHQODVPHQLQJHV\HQHOSOH[RFRURLdeo. La diseminación viral puede ocurrir también a través de los
nervios periféricos. En este caso, los virus pueden ser transportaGRVSRUXQDGHODVVLJXLHQWHVFXDWURYtDV DWUDYpVGHORVD[RQHV
DWUDYpVGHODVFpOXODVGH6FKZDQQ GHVSOD]iQGRVHSRUORVHVSDFLRVLQWHUD[yQLFRV\R DWUDYpVGHORVOLQIiWLFRVSHULQHXUDOHV
(QHOKRPEUHORVYLUXVKHUSHVVLPSOH[\UDELDVHGHVSOD]DQD
WUDYpVGHD[RQHV/DGLVHPLQDFLyQSRUHVWDYtDHVXQSURFHVROHQWR
VHKDGHWHUPLQDGRH[SHULPHQWDOPHQWHHQUDWRQHVTXHODYHORFLGDG
GHWUDQVSRUWHGHSDUWtFXODVGHKHUSHVVLPSOH[HVGHDPPSRU
KRUD(OOHQWRWUDQVSRUWHGHSDUWtFXODVYLUDOHV VyORSRUYtDD[yQLFD para alcanzar el encéfalo, la riqueza de la inervación tisular y la
GLVWDQFLDD[RQDODUHFRUUHUGHWHUPLQDQHOSHUtRGRGHLQFXEDFLyQGH
ODUDELD KDELWXDOPHQWHDOUHGHGRUGHXQPHVDXQTXHSXHGHYDULDU
HQWUHXQDVHPDQD\XQDxR (OWUDQVSRUWHUHWUyJUDGRDWUDYpVGHORVD[RQHVVHSURGXFHSRU
DFFLyQGHODVPROpFXODVGHGLQHtQDDVRFLDGDVDORVPLFURW~EXORV
éstas transportan las partículas virales desde las terminales sensoULDOHVKDFLDHOQ~FOHRQHXURQDO YtDD[RQDOUHWUyJUDGD 'HPDQHUD
inversa, en la reactivación los componentes de la estructura viral
FiSVLGH JOLFRSURWHtQDV GH HQYROWXUD HWF VRQ WUDQVSRUWDGRVSRU
YtD D[RQDO DQWHUyJUDGD D WUDYpV GH ORV PLFURW~EXORV DVRFLDGRV D
proteínas de la familia de las quinesinas, mediante la unión directa
FRQHVWDVSURWHtQDVGHOFLWRHVTXHOHWRRYLDMDQGRGHQWURGHHQGRVRPDV )LJXUD 89
Capítulo 5 / Patogenia de las infecciones virales
TRANSPORTE ANTERÓGRADO
Quinesina
Vesícula
sináptica
Mitocondria
HSV
Microtúbulos
Dineína
HSV
Cuerpo celular
Axón
TRANSPORTE RETRÓGRADO
Figura 5.15. Transporte axonal del virus herpes simplex en neuronas. /XHJRGHODLQIHFFLyQGHODVQHXURQDVVHQVRULDOHVODVFiSVLGHV
YLUDOHVVRQWUDQVSRUWDGDVHQVHQWLGRUHWUyJUDGRKDFLDHOQ~FOHRFHOXODUDWUDYpVGHORVPLFURW~EXORVSUREDEOHPHQWHPHGLDQWHODVPROpFXODV
GHGLQHtQD/XHJRGHODUHDFWLYDFLyQYLUDOODVFiSVLGHVFRQWHQLHQGRHO'1$JHQyPLFRYLUDO\ODVJOLFRSURWHtQDVGHODHQYROWXUDYLUDOVRQ
WUDQVSRUWDGDVHQIRUPDLQGHSHQGLHQWHHQVHQWLGRDQWHUyJUDGRDWUDYpVGHORVPLFURW~EXORVSUREDEOHPHQWHSRUODVPROpFXODVGHTXLQHVLQD
4. TRANSMISIÓN
DE VIRUS AL EXTERIOR DEL ORGANISMO
La secuencia de eventos para la mantención de un virus determinado en la naturaleza comprende la liberación viral de la célula, la
salida del hospedero, el transporte a través del medio ambiente en
una forma viable y la apropiada entrada en un nuevo hospedero
susceptible.
$OJXQRVYLUXVVRQOLEHUDGRVGHODVFpOXODVDO¿QDOGHOFLFORUHplicativo, otros no completan este ciclo, y un tercer grupo no egreVDQH¿FLHQWHPHQWH
La transmisión a un nuevo hospedero es dependiente de varios
IDFWRUHV FDQWLGDGGHYLUXVGLVHPLQDGRRYHKLFXOL]DGR HVWDELOLGDGYLUDOHQHOPHGLRDPELHQWH SUHVHQFLDGHvectores transmiVRUHV LPSUHVFLQGLEOHVHQHOFDVRGHDUERYLUXV GLVSRQLELOLGDG
GHKRVSHGHURVVXVFHSWLEOHV\ FRQVWLWXFLyQJHQpWLFDGHOYLUXV\
el hospedero. A continuación se comentan brevemente sólo los dos
primeros factores.
Las probabilidades de transmisión son mayores si el número
GHYLULRQHVHVHOHYDGR3RUHMHPSORHVVDELGRTXHFDGDPLOLOLWUR
GHVDQJUHSXHGHFRQWHQHUKDVWDDSUR[LPDGDPHQWH7 partículas de
'DQH LQIHFWDQWHV GHO+%97HQLHQGRHQFXHQWDTXHVRQQHFHVDULDV
VyOR YLULRQHV SDUD LQIHFWDU D XQ FKLPSDQFp VXVFHSWLEOH
QRLQPXQH GHNJGHSHVRHOORLPSOLFDTXHVyORFRQ
—/GHVDQJUHSRGUtDORJUDUVHWDOHIHFWR3RUHOORFDQWLGDGHVD~QLQYLVLEOHVGHGLFKRÀXLGRSXHGHQFRQWDPLQDUDJXMDV\VHUVX¿FLHQWHV
SDUDWUDQVPLWLUHOYLUXVHQSREODFLRQHVKXPDQDVYXOQHUDEOHV SRU
HMHPSORXVXDULRVGHGURJDVLOtFLWDVSRUYtDHQGRYHQRVD 'HPDQHUDDQiORJDODSUHVHQFLDGH9 partículas de roWDYLUXVSRUJUDPRGHPDWHULDIHFDOH[FUHWDGD YLUXFRSULD FRQVWLtuyen una fuente importante de virus para asegurar la transmisión
fecal-oral a susceptibles. En la transmisión del virus rabia, se ha
GHPRVWUDGRTXHODVPRUGHGXUDVGH]RUURVVRQPiVLQIHFFLRVDVTXH
ODVSURGXFLGDVSRUSHUURV\DTXHFRQWLHQHQYHFHVPiVYLUXVTXH
ORV~OWLPRVHQVXVJOiQGXODVVDOLYDOHV YV DLUDWyQ / g de
JOiQGXODVDOLYDOUHVSHFWLYD La transmisión del HCMV a través de leche materna se ve faYRUHFLGDSRUHOYROXPHQGHOÀXLGRTXHHVLQJHULGRSRUHOODFWDQWH
DSHVDUGHREVHUYDUVHXQWtWXOREDMRGHYLUXVSRUPLOLOLWURGHOHFKH
'LIHUHQWHV YLUXV SRVHHQ GLVWLQWD VXVFHSWLELOLGDG DO PHGLR H[WHUQRWHPSHUDWXUDGHVHFDFLyQS+HWF$PRGRGHHMHPSOREDVWH
recordar que los rhinovirus mantienen su infectividad casi intacta
DOFDERGHKRUDVOXHJRGHGHSRVLWDUVHDWUDYpVGHDHURVROHVRSRU
PHGLR GH PDQRV FRQWDPLQDGDV HQ REMHWRV GLYHUVRV (OOR LPSOLFD
TXHVXWUDQVPLVLELOLGDGQRHVWiFLUFXQVFULSWDDODGLVHPLQDFLyQDHrógena sino que también acaece a través de utensilios contaminados. Un estudio efectuado mediante aislamiento viral a partir de
FRVWUDV GHPRVWUy TXH HO YLUXV GH OD YLUXHOD HQIHUPHGDG \D HUUDGLFDGD GH OD 7LHUUD HV FDSD] GH SHUVLVWLU YLDEOH HQ FRQGLFLRQHV
QDWXUDOHVGXUDQWHDOPHQRVDxRV(VWDYLDELOLGDGYLUDOHVPX\
VXSHULRUDODREVHUYDGDSRUHMHPSORHQFDGiYHUHVGHLQGLYLGXRV
infectados con +,9 PDQWHQLGRVD ž & GtDVXQ SDU GH VHPDQDV o en aguas contaminadas con el virus hepatitis A a temperatura
DPELHQWH DPHVHV Los virus pueden transmitirse a otro hospedero a partir de las
siguientes fuentes: secreciones respiratorias, saliva, heces, orina,
secreciones genitales, leche, sangre o piel.
En determinados casos, la replicación del virus ocurre en órganos que no le son útiles, a los efectos de mantener el ciclo en la
QDWXUDOH]DSRUHMHPSORHVHOFDVRGHODPXOWLSOLFDFLyQYLUDOHQHO
SNC observada en infecciones por virus polio o por arbovirus, o
en la orquitis por virus parotiditis o por &R[VDFNLH%RHQODmioFDUGLWLVSRUpVWH~OWLPRDJHQWH )LJXUD 8QHMHPSORH[WUHPR\
IDVFLQDQWHDODYH]IXHGHVFXELHUWRSRU'DQLHO&DUOHWRQ*DMGXVHN
HQODWULEX)RUHGHODLVODGH*XDP1XHYD*XLQHD(VWHLQYHVWLJDdor pudo establecer la relación entre una enfermedad neurológica siempre letal –conocida como kuru y sólo observada en dicha
población– y sus rituales canibalísticos. El agente posteriormente
aislado sólo se transmitía –luego de un período de incubación proORQJDGRGHKDVWDDxRV±SRULQJHVWDGHHQFpIDORVGHIDPLOLDUHV
HMHPSORGHLQIHFFLyQOHQWDGHO61& /DSUHVHQFLDGHXQDJHQWH
infeccioso fue demostrada mediante inoculación de homogeneizados de encéfalos humanos a primates no-humanos, también luego
de un prolongado período de incubación. Estos hallazgos permitieURQHYLWDUQXHYRVFDVRVGHNXUXHQQDFLGRVDSDUWLUGH DOPR-
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
90
A
B
Figura 5.16. Formación de sincicios in vitro. A.,QIHFFLyQGHFpOXODV3+FRQYLUXVVLQFLFLDOUHVSLUDWRULRB.,QIHFFLyQGHFpOXODV*+267
con +,9*HQWLOH]DGHOD'UD*DEULHOD7XUN'HSWR0LFURELRORJtD3DUDVLWRORJtDH,QPXQRORJtD)DFXOWDGGH0HGLFLQD8%$
GL¿FDUVHORVULWRVFDQLEDOtVWLFRVGHODWULEX OHYDOLHURQD*DMGXVHN
HOSUHPLR1REHOGH)LVLRORJtDR0HGLFLQDHQ\DEULHURQODV
puertas a los asombrosos descubrimientos del neurólogo Stanley B.
3UXVLQHU SUHPLR1REHOGH)LVLRORJtDR0HGLFLQDHQ TXLHQ
propuso el término priónSDUDGH¿QLUDSURWHtQDVLQIHFFLRVDVTXH
VHSURSDJDQHQDXVHQFLDGHiFLGRQXFOHLFRDVRFLDGRDHOODVFRPR
agente etiológico de infecciones lentas degenerativas del SNC.
5. EFECTOS
DE LA INFECCIÓN VIRAL SOBRE LAS CÉLULAS
/DQDWXUDOH]DLQWUtQVHFDGHORVYLUXVORVFRQYLHUWHHQSDUiVLWRVLQtracelulares obligatorios para su replicación ya que necesitan de la
maquinaria celular de biomoléculas y procesos metabólicos.
(OUHVXOWDGRGHODLQWHUDFFLyQHVSHFt¿FDHQWUHXQYLUXV\XQD
célula determinada puede ser evaluado en función de los procesos
de replicación viral y del efecto producido en la célula hospedera.
(QFRQWUDVWHFRQODUHODWLYDVHQFLOOH]SDUDUHFRQRFHU\FXDQWL¿FDU
biomoléculas virales, el estudio de los efectos biomoleculares proGXFLGRVHQODFpOXODHVGL¿FXOWRVR\HQPXFKRVFDVRVQRKDQVLGR
dilucidados aún. Sin embargo, en algunos casos es posible observar
a la luz del microscopio óptico y electrónico las alteraciones morfológicas que inducen algunos virus en ciertas células.
El resultado de la infección viral puede detectarse en muchos
casos mediante la observación al microscopio óptico del efecto
citopático del virus. Es una forma de detectar la replicación viral.
La acción citopática (ACP) viral puede demostrarse en cultivos
celulares in vitro YpDVHHOFDStWXORSRUHMHPSORIRUPDFLyQGH
SODFDV RHQWHMLGRVin vivo. Como resultado de la ACP pueden observarse redondeamiento celular, formación de sincicios o de cuerpos de inclusión y muerte celular por necrosis y/o apoptosis.
Las manifestaciones tempranas de la ACP en cultivos celulares se
producen por el edema celular asociado con alteración de la permeabiOLGDGGHODPHPEUDQD(OORVHDVRFLDDFDPELRVHQHOUHWtFXORHQGRSOiVmico, polirribosomas y mitocondrias que constituyen las bases del reGRQGHDPLHQWRFHOXODU(QODVHWDSDV¿QDOHVVHSURGXFHODPDUJLQDFLyQ
FURPDWtQLFDKDFLDHOERUGHGHOQ~FOHR\VXFRQGHQVDFLyQ SLFQRVLV Habitualmente, las células mueren por necrosis, una respuesta patolóJLFDTXHLPSOLFDDXPHQWRGUDPiWLFRGHOWDPDxRFHOXODUTXHFRQGXFH
a la lisis. El proceso necrótico es iniciado por un daño celular que produce el desequilibrio osmótico, fundamentalmente asociado al ingreso
de Ca++FRQODFRQVLJXLHQWHLQKLELFLyQGHFLHUWRVSURFHVRV VtQWHVLVGH
$73 \HVWLPXODFLyQGHRWURV SURWHyOLVLV /DOLVLVFHOXODUHVHOUHVXOWDGRGHSURFHVRV interferencia
GHODELRVtQWHVLVGHPDFURPROpFXODVFHOXODUHV DOWHUDFLyQGHOD
IXQFLyQ GH OD PHPEUDQD SODVPiWLFD \ OLEHUDFLyQ GH HQ]LPDV
hidrolíticas degradativas desde las membranas lisosomales.
Algunos virus SRU HMHPSOR YLUXV VLQFLFLDO UHVSLUDWRULR paUDLQÀXHQ]D+&09+,9KHUSHVVLPSOH[VDUDPSLyQHQWUHRWURV pueden producir la fusión de membranas celulares como resultaGRGHORFXDOVHIRUPDXQDPDVDFLWRSODVPiWLFDTXHSXHGHFRQWHner múltiples núcleos: son los sincicios gigantes. La formación de
sincicios in vitro )LJXUD$\% QRLPSOLFDQHFHVDULDPHQWH
su ocurrencia en todos los sustratos celulares, ni tampoco in vivo,
DXQTXHWDPELpQVHREVHUYDQHQDOJXQRVFDVRV YpDVHHOtWHP
0HFDQLVPRVGLUHFWRVGHOHVLyQ (QRWUDVLQIHFFLRQHVYLUDOHVVHIRUPDQiUHDVFHOXODUHVFX\DWLQFLyQHVWiDOWHUDGDVRQSURGXFLGDVSRUORVFXHUSRVGHLQFOXVLyQ(OORV
pueden corresponder a acúmulos cristalinos de partículas virales
como se observa en las inclusiones intranucleares de poliomavirus
\KHUSHVYLUXVRSXHGHQUHSUHVHQWDUIiEULFDVGHVtQWHVLV\HQVDPEODMH
de componentes subvirales como se observa en los cuerpos acidó¿ORVLQWUDFLWRSODVPiWLFRVGHQHXURQDVLQIHFWDGDVSRUHOYLUXVUDELD
FXHUSRVGH1HJULYpDVHOD¿JXUDGHOFDStWXOR (QRWUDVRFDsiones corresponden simplemente a depósitos de antígenos virales
VLQWHWL]DGRVHQH[FHVRFRPRVHYLVXDOL]DFRQDOJXQRVGHORVFXHUSRV
de inclusión formados en células infectadas.
Algunos virus pueden inducir la DSRSWRVLVGHODVFpOXODVTXH
infectan DXQDTXHOODVGHODUHVSXHVWDLQPXQH , o inhibir dicho proceso. 8QPLVPRYLUXVSXHGHSRVHHUSURWHtQDV XRWUDVPROpFXODV SUR
y anti-apoptóticas, las que se pueden tornar operativas en diferentes
91
Capítulo 5 / Patogenia de las infecciones virales
A. Célula epitelial
1
~
F
O
H
R
B. Neurona sensorial
HCF
HCF
Zhangfei
VP-16
HCF
VP-16
Oct-1
Oct-1
TAATGARAT
miRNAs
LATs
Núcleo
Infección lítica
(productiva)
TAATGARAT
Infección latente
(no productiva)
Figura 5.17. Infección lítica en células epiteliales y latente en neuronas sensoriales por herpes simplex. A. En la infección lítica, la
SURWHtQD93 Į7,) IRUPDXQFRPSOHMRFRQODSURWHtQDFHOXODU+&) Host Cellular Factor \FRQHOIDFWRUWUDQVFULSFLRQDOFHOXODU2FWTXH
UHFRQRFHVHFXHQFLDVRFWDPpULFDV7$$7*$5$7SUHVHQWHVHQORVSURPRWRUHVGHJHQHVLQPHGLDWRWHPSUDQRVGHO'1$YLUDO±XELFDGRFRPR
HSLVRPDHQHOQ~FOHR±SURPRYLHQGRVXWUDQVFULSFLyQB.(QODVQHXURQDVODSURWHtQDFHOXODUGHUHVSXHVWDDOHVWUpVGHQRPLQDGD=KDQJIHL
LQKLEHD93 SUREDEOHPHQWHPHGLDQWHODSDUWLFLSDFLyQGHRWUDVSURWHtQDV HQXQPRGR+&)GHSHQGLHQWHLPSLGLHQGRODIRUPDFLyQGHO
FRPSOHMRWHUQDULR+&)932FW(ODFWLYDGRUFHOXODU2FWSUHVHQWHHQHOQ~FOHRQHXURQDOQRVHXQHD93
PRPHQWRVGHODLQIHFFLyQGHXQDFpOXODRH[SUHVDUVHGLIHUHQFLDOPHQte en diversas estirpes celulares. Este tema se desarrolla en detalle en
HOFDStWXORDFRQWLQXDFLyQVyORVHPHQFLRQDQXQSDUGHHMHPSORV
Algunas cepas del virus LQÀXHQ]DWLSR$H[SUHVDQXQDSURWHtQDGHQRminada 3%)TXHLQGXFHODapoptosis mitocondria-dependiente de
células de estirpe monocítica, lo que contribuye a la virulencia viral.
Dicha proteína estuvo presente en todos los eventos de pandemia por
LQÀXHQ]DREVHUYDGRVHQHOVLJOR;;\ORHVWiHQFDVLWRGDVODVFHSDV
GHRULJHQDYLDU$VXYH]LQÀXHQ]DH[SUHVDRWUDSURWHtQDQRHVWUXFWXUDOGHQRPLQDGD16TXHLQKLEHODDFWLYLGDGSURDSRSWyWLFDDQWLYLUDO
inducida por el sistema Interferón. Asombrosamente, los transcriptos
/$7V 51$GHSRODULGDGDQWLPHQVDMHUR GHKHUSHVVLPSOH[LQKLEHQ
la apoptosis de aquellas neuronas en las que el virus permanece laWHQWHGXUDQWHODYLGDGHOLQGLYLGXRSHUVLVWHQWHPHQWHLQIHFWDGR YpDVH
PiVDGHODQWHHOtWHP Como resultado de la interacción virus-célula pueden presenWDUVHVLWXDFLRQHV LQIHFFLyQYLUDOSURGXFWLYDDVRFLDGDRQRD
OLVLVFHOXODU LQIHFFLyQYLUDOQRSURGXFWLYDFRQUHSOLFDFLyQYLUDO
EORTXHDGD\ LQIHFFLyQFHOXODUFRQEDMD\FRQWLQXDSURGXFFLyQ
de virus.
5.1. INFECCIÓN PRODUCTIVA
En muchas infecciones virales se produce la multiplicación del
agente hasta alcanzar elevados títulos en células permisivas, con
eventual inhibición de la maquinaria biosintética celular que reVXOWDHQODOLVLVGHDTXpOODV6HREVHUYDWDOHIHFWRSRUHMHPSORHQ
la infección de motoneuronas por poliovirus. Sin embargo, la in-
fección productiva de células permisivas con ciertos virus –aun en
elevados títulos– no se acompaña necesariamente de lisis celular.
/DSHUPLVLYLGDGFHOXODULPSOLFDQRVyORODH[LVWHQFLDGHOrecepWRUHVSHFt¿FRSDUDHOYLUXVVLQRWDPELpQGHXQPHGLRLQWUDFHOXODU
propicio que permita la prosecución de los procesos de replicación
JHQyPLFDWUDQVFULSFLyQ\H[SUHVLyQGHVXVJHQHV
$Vt SRU HMHPSOR VH KD GHPRVWUDGR HQ WHMLGRV KXPDQRV XQD
elevada concentración de RNAm para el receptor del virus polio en
hígado, pulmón y corazón, mientras que sorprendentemente este
PHQVDMHURVHKDOODHQEDMDFRQFHQWUDFLyQHQHOFHUHEUR'DGRTXH
el hígado, el pulmón y el corazón no son considerados sitios de
replicación habituales del virus polio, estas observaciones sugieren
TXHODSHUPLVLYLGDGKDFLDHOYLUXVQRHVWiPHUDPHQWHYLQFXODGDFRQ
ODH[SUHVLyQGHOUHFHSWRUYLUDO véase el ítem 1.1.3 La falta de permisividad celular para un virus puede ser moGL¿FDGDSRUODFRLQIHFFLyQFRQRWURDJHQWH SRUHMHPSORFRPRVH
observa entre los agentes adeno-asociados en presencia de adenoYLUXV En las infecciones productivas, los cambios necróticos observados en las células infectadas comienzan a ocurrir frecuentemente
DOUHGHGRUGHOPRPHQWRGHPi[LPDVtQWHVLVGHODVSURWHtQDVHVWUXFWXUDOHVGHOYLUXV6LQHPEDUJRDGHPiVGHORVHIHFWRVSURPRYLGRV
por la acumulación de virus en el interior celular, pueden observarVHWDPELpQFDPELRVFLWRSiWLFRVWHPSUDQRVDWULEXLGRVDXQHIHFWR
Wy[LFRGLUHFWRGHGHWHUPLQDGDVSURWHtQDVYLUDOHV$VtSRUHMHPSOR
ODSURWHtQDGHOD¿EUDSHQWyQGHORVDGHQRYLUXVRXQDSURWHtQDGHO
W~EXORGHODVXSHU¿FLHGHOYLUXVYDFFLQLDSXHGHQSURPRYHUSRUVt
mismas dichos efectos.
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
92
miR-H3 y miR-H4
HSV-1
miR-H2
miR-H6
miR-I y miR-II
HSV-2
miR-III
ICP34.5
/
ICP0
/
ICP4
ICP34.5
/
ICP0
Control de la
replicación viral
y establecimiento
y mantención
de la latencia
en neuronas
Figura 5.18. Actividad de microRNAs (miRNAs) virales que regulan la expresión de genes de los virus herpes simplex 1 (HSV-1)
y herpes simplex 2 (HSV-2) durante la latencia. /DVSURWHtQDVYLUDOHV,&3 XQDFWLYDGRUWUDQVFULSFLRQDOLQPHGLDWRWHPSUDQR H,&3
RWURIDFWRUWUDQVFULSFLRQDOYLUDOQHFHVDULRSDUDODH[SUHVLyQGHODPD\RUtDGHORVJHQHVGHOFLFOROtWLFR QRVHH[SUHVDQHQODVQHXURQDV
VHQVRULDOHVORTXHLPSLGHHOFLFORSURGXFWLYRHQHOODVFRPRFRQVHFXHQFLDGHODLQKLELFLyQSRUPL51$VHVSHFt¿FRV/DLQKLELFLyQGHODSURWHtQD,&3 XQDSURWHtQDFODYHHQODUHSOLFDFLyQYLUDO\QHXURYLUXOHQFLDGHO+69\+69 SRUPL5,\PL5,,GHO+69 RSRUPL5+\
PL5+GHO+69 SHUPLWHODVREUHYLGDGHODVQHXURQDVXQDYH]TXHVHSURGXMRODLQIHFFLyQDJXGDGHODVPLVPDV
Coxsackie
DAF
Superficie
apical
Quinasa c-Abl
Actina
GTPasa Rac
Actina
CAR
Unión
estrecha
Cavéola
Figura 5.19. Ingreso del virus Coxsackie a la célula. (OYLUXVXWLOL]DLQLFLDOPHQWHHOUHFHSWRU'$)OXHJRGHXQDVHxDOL]DFLyQLQWUDFHOXODU
PHGLDGDSRUVXHQWUHFUX]DPLHQWRFLWRSODVPiWLFRSURPXHYHXQUHRUGHQDPLHQWRGHOFLWRHVTXHOHWRGHDFWLQDORTXHWUDQVSRUWDDODSDUWtFXOD
YLUDOXQLGDD'$)KDVWDODVXQLRQHVHVWUHFKDVGRQGHSRGUiLQWHUDFFLRQDUFRQHOUHFHSWRU&$5DOOtSUHVHQWH/XHJRGHODHQGRFLWRVLVPHdiada por receptor, &R[VDFNLHHVLQWHUQDOL]DGRHQFDYpRODV(OYLUXVQRSXHGHDFFHGHUper seDODVXQLRQHVHVWUHFKDVLQWHUFHOXODUHVSDUD
DOFDQ]DUORVUHFHSWRUHV&$5
Capítulo 5 / Patogenia de las infecciones virales
93
Figura 5.20. Vista espacial de la molécula CD155 (receptor celular) anclada en las proteínas de cápside del virus polio. VP1,
93\93HVWiQFRORUHDGRVHQD]XOYHUGH\URMRUHVSHFWLYDPHQWH'H=KDQJ3et al. Proc Natl Acad Sci USA5HSURGXFLGRFRQDXWRUL]DFLyQ
En contraposición a lo observado en las infecciones productivas, algunos virus pueden infectar células no totalmente permisivas
RDXQQRSHUPLVLYDV SHURVXVFHSWLEOHV (QHVWRVFDVRVHOFLFORGH
multiplicación viral queda detenido en alguna de sus etapas: ello da
lugar a infecciones abortivas.
5.2. INFECCIÓN NO PRODUCTIVA
El EORTXHRGHODUHSOLFDFLyQYLUDO en las infecciones no productivas puede asociarse a muerte o sobrevida celular. El genoma viral puede perderse, o bien puede integrarse como DNA al genoma
celular o permanecer como episoma. La integración del genoma
viral al celular puede alterar las propiedades de crecimiento de la
célula y producirse la transformación de las mismas. Esto ocurre
SRU HMHPSORHQODtransformación de OLQIRFLWRV7KXPDQRVDOVHU
LQIHFWDGRVSRUORVYLUXV+7/9DJHQWHHWLROyJLFRGHOHXFHPLDV
OLQIRPDV7GHODGXOWR(QGLFKDVFpOXODVLQIHFWDGDVVHGHWHFWDQD
FRSLDVHQIRUPDGHJHQRPDLQWHJUDGRSURYLUDOGHPRGRPRQRFORQDOXROLJRFORQDO1RH[LVWHQVLWLRVSUHIHUHQFLDOHVGHintegración de
ORVDSUR[LPDGDPHQWHSDUHVGHEDVHVGHOSURYLUXVGHO+7/9
HQFpOXODVPDOLJQDVSURYHQLHQWHVGHGLIHUHQWHVSDFLHQWHVFRQOHXFHPLD7ORTXHVXJLHUHTXHODWXPRULJpQHVLVSRUGLFKRDJHQWHHVWi
PiV UHODFLRQDGD FRQ OD H[SUHVLyQ GH OD SURWHtQD WUDQVDFWLYDGRUD
7D[TXHFRQHYHQWRVGHmutagénesis insercional. Los patrones de
la integración del genoma proviral de los diversos UHWURYLUXVHVWiQ
relacionados con la estructura de las respectivas integrasas virales.
En otros casos de infección no productiva, se evidencia una
HVFDVDH[SUHVLyQGHOJHQRPDYLUDOHVORTXHRFXUUHHQODVLQIHFciones latentes.
5.2.1. Infección latente
8QDLQIHFFLyQODWHQWHHVWiFDUDFWHUL]DGDSRUHYHQWRVJHQHUDOHVD ocurre en una célula que no replica, o bien el genoma viral se repliFDFRQMXQWDPHQWHFRQHO'1$FHOXODUVLQSHUWXUEDUHOFLFORFHOXODU
E ODH[SUHVLyQGHJHQHVYLUDOHVGHOFLFOROtWLFRHVWiDXVHQWHRHVLQH¿FLHQWHF ODH[SUHVLyQGHDQWtJHQRVYLUDOHVHQODFpOXODLQIHFWDGD
HVWiHOLPLQDGDRUHVWULQJLGD\G HOJHQRPDYLUDOSHUVLVWHLQWDFWR
de modo de mantener la total capacidad para promover un ciclo de
infección productiva, que asegure el inicio de la diseminación viral
a un nuevo hospedero. En otros términos, en las infecciones laten-
tes se documenta una ausencia de progenie viral FRPRVtRFXUUH
FRQ ODV FpOXODV SURGXFWLYDPHQWH LQIHFWDGDV DXQTXH HO JHQRPD
viral mantiene la capacidad para ser reactivado y generar una
infección productiva como resultado de ciertos estímulos.
/DV LQIHFFLRQHV ODWHQWHV PHMRU FRQRFLGDV VRQ ODV SURGXFLGDV
por herpesvirus. Se ha demostrado que el genoma del virus herpes
VLPSOH[VHPDQWLHQHODWHQWHFRPRSOiVPLGRH[WUDFURPRVyPLFR
HQQHXURQDVGHJDQJOLRVVHQVRULDOHVH[LVWLHQGRFRSLDVGH'1$
YLUDO SRU QHXURQD HQ DXVHQFLD GH SURWHtQDV YLUDOHV GHWHFWDEOHV Los procesos reguladores virales y celulares no han sido dilucidaGRVWRWDOPHQWH6HKDREVHUYDGRTXHHO'1$GHOJHQRPDYLUDOHVWi
KLSHUPHWLODGRORFXDOUHGXFHODH[SUHVLyQJHQpWLFD6HKDSRVWXODGRTXHHOKHUSHVVLPSOH[ sintetiza productos proteicos capaces de
regular la formación de eucromatina o heterocromatina, lo que a su
vez participa en la regulación de la relación infección lítica/latente.
La transcripción del genoma viral del +69 GXUDQWH OD LQfección viral latente en las neuronas de los ganglios sensoriales
GHOKRPEUHHVWiFLUFXQVFULSWDDODUHJLyQFRUUHVSRQGLHQWHDOJHQ
LQPHGLDWRWHPSUDQR,&3 Infected Cell Protein GRQGHVyOR
HVDFWLYRHOSURPRWRUGHXQRVWUDQVFULSWRVGH51$QRFRGL¿FDQtes, asociados a latencia denominados /$7V Latency Associated
Transcripts QRKDELpQGRVHGHWHFWDGR KDVWDHOPRPHQWR ODVtQWHVLV GH SURWHtQD DOJXQD YLUDO ([LVWHQ DO PHQRV WUHV PROpFXODV
/$7TXHHVWiQDVRFLDGDVDOHVWDEOHFLPLHQWR\PDQWHQFLyQGH
la latencia, mediante la inhibición de la apoptosis neuronal.
'HULYDQGHXQWUDQVFULSWRSULPDULRGHNEPHGLDQWHsplicing
FRUWH \ HPSDOPH GLIHUHQFLDO /D SRODULGDG GH ODV PROpFXODV
/$7HVRSXHVWDDODGHO51$PGH,&3/DVPROpFXODV/$7VRQ
predominantemente no poliadeniladas y se detectan en el núcleo
de la célula latentemente infectada. En la infección latente de
ODV QHXURQDV VHQVRULDOHV KDELWXDOPHQWH JDQJOLR WULJpPLQR SDUD
+69\JDQJOLRVVDFURVSDUD+69 ODH[SUHVLyQGHORVJHQHV
LQPHGLDWRWHPSUDQRV HVWi LQKLELGD \D TXH HO WUDQVDFWLYDGRU YLUDO93 WDPELpQ GHQRPLQDGR Į7,) Trans-Inducing Factor QR HV IXQFLRQDOPHQWH DFWLYR (VWXGLRV H[SHULPHQWDOHV TXH SHUmitieron la construcción de virus quiméricos del +69 FRQWHniendo /$7VGHO+69SURPRYLHURQHYHQWRVGHUHDFWLYDFLyQin
vivo correspondiente al fenotipo +69 VLWLRHVSHFt¿FR HQODV
neuronas trigeminales, demostrando el rol crucial de estos transcriptos también en la reactivación. Habitualmente, en las células
94
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
HSLWHOLDOHV93\ODSURWHtQD+&) Host Cellular Factor GHULYDGD GHO KRVSHGHUR IRUPDQ XQ FRPSOHMR TXH XQLGR DO IDFWRU
GHWUDQVFULSFLyQ2FW TXH¿VLROyJLFDPHQWHUHFRQRFHVHFXHQFLDV
RFWDPpULFDVHQHOJHQRPDFHOXODU VHXQHQDORVJHQHVDOIDLQPHdiato-tempranos del virus -que también contienen dichas secuencias nucleotídicas- para comenzar la transcripción de RNAm del
FLFOROtWLFR(QODVQHXURQDVVHQVRULDOHVGLFKRFRPSOHMR93
+&) 2FW QR HV DFWLYR PHUFHG D OD SUHVHQFLD GH OD SURWHtQD=KDQJIHLTXHLPSLGHVXOOHJDGDDOQ~FOHR LQWHUDFWXDQGRFRQ
93HQXQPRGR+&)SDUFLDOPHQWHGHSHQGLHQWH \SRUHQGHOD
WUDQVFULSFLyQGHORVJHQHVLQPHGLDWRWHPSUDQRVGHOYLUXV )LJXUD
=KDQJIHLLQKLEHODXQLyQGHOIDFWRUWUDQVFULSFLRQDO/XPDQ
D+&)TXHSURPXHYHODORFDOL]DFLyQQXFOHDUGHpVWH~OWLPR
/RV WUDQVFULSWRV /$7 GHO +69 \ +69 IXQFLRQDQ FRPR
SUHFXUVRUHV GH PLFUR51$V YLUDOHV PL51$V XQDV PROpFXODV GH QXFOHyWLGRV TXH LQKLEHQ OD H[SUHVLyQ GH 51$P
EODQFRPHGLDQWHODVLPLOLWXGGHVXVHFXHQFLD YpDVHHOFDStWXlo "Mecanismos de GHIHQVD 'LFKRV PL51$V FXPSOHQ XQ URO
esencial en la infección aguda y en la latencia. Los miRNA designados miR-I y miR-II del HSV-2 (y miR- H3 y miR-H4 del
HSV-1), funcionan como una "llave de encendido / apagado" del
factor de neurovirulencia ICP34.5 SURWHtQDYLUDOTXHLQKLEHOD
DXWRIDJLDQHXURQDOSURPRYLGDSRUODSURWHtQDFHOXODU%HFOLQD
así como también limita la respuesta inmune innata mediada por
la actividad de la 3.5 $VLPLVPR miR-III +69 y miR-H2
+69 UHVSHFWLYDPHQWHVLOHQFLDQHO51$PRLQKLEHQODVtQWHVLV GHO WUDQVDFWLYDGRU ,&3 2WUR miRNA no derivado de los
WUDQVFULSWRV /$7 GHO +69 PL5+ LQKLEH OD H[SUHVLyQ GHO
51$PGHRWURDFWLYDGRUFUtWLFRSDUDHOFLFOROtWLFRYLUDO,&3
¿JXUD (VWDSURWHtQDHV±DVXYH]±EODQFRGHODLQPXQRYLJLlancia por parte de los OLQIRFLWRV7&'+ en los intentos de reactiYDFLyQYLUDODWUDYpVGHJUiQXORVFLWRWy[LFRVFRPRODgranzima B
\SUREDEOHPHQWHWDPELpQOD$ VLQDFWLYDFLyQGHODVcaspasas. De
ORH[SXHVWRVHLQ¿HUHTXHODlatencia del HSV-1 es dependiente
de 3 factores: 1) el programa de ODWHQFLDGHOYLUXV OD¿VLRlogía neuronal; y 3) la inmunovigilancia de los linfocitos CD8+
mediante FLWRTXLQDV 71)ĮH,)1Ȗ \JUiQXORVTXHHMHUFHQ
un efecto no citolítico.
Otros virus que producen infecciones latentes forman parte
también de la familia Herpesviridae, tales como: citomegalovirus
humano, virus Epstein-Barr, virus YDULFHOD]yVWHU++9HHV-7
y ++97RGRVHOORVH[KLEHQSURJUDPDVSDUWLFXODUHVGHlatencia
HQFpOXODVHVSHFt¿FDV\SXHGHQVHUUHDFWLYDGRVDQWHGLYHUVRVHVWtPXORV SRUHMHPSORODinmunosupresión para producir el zóster por
virus varicela-zóster, o el sarcoma de Kaposi asociado al ++9 3XHGH GDUVH HO FDVR GH TXH H[LVWD HQ XQ KRVSHGHUR XQD LQIHFFLyQSURGXFWLYDHQXQDGHWHUPLQDGDHVWLUSHFHOXODU\VLPXOWineamente una infección latente en otra, lo que ocurre durante la
infección productiva por HIV en macrófagos, OLQIRFLWRV7 CD4+
activados, células foliculares dendríticas, etc. versus lo observado
en algunos linfocitos T CD4+ de memoria, infectados. Estos últimos constituyen un reservorio estable de infección, resistente aun a
ODDGPLQLVWUDFLyQGHODWHUDSLDDQWLUUHWURYLUDOFRPELQDGD HQLQJOpV
Highly Active Antiretroviral Therapy R +$$57 6LQ HPEDUJR
dada la activa replicación del HIV en las células inicialmente
PHQFLRQDGDVQRGHEHFRQVLGHUDUVHTXHHOSDFLHQWHGHVDUUROOD
una infección latente a nivel del organismo, considerado como
un todo.
5.3. INFECCIÓN VIRAL CON ESCASA
Y CONTINUA PRODUCCIÓN VIRAL
(Q HVWD FDWHJRUtD VH XELFD SRU HMHPSOR OD infección persistente
producida por el virus LCM en el ratón. Se ha demostrado que
este virus promueve fascinantes mecanismos de evasión viral a la
respuesta inmune, modulando tanto los procesos de transcripción
y replicación viral, como la vigilancia inmunológica mediada por
la interacción entre células dendríticas y OLQIRFLWRV7 véanse los
capítulos 7 y 25.1 6. ALGUNOS
ASPECTOS DE LA RELACIÓN VIRUS-CÉLULA
6.1. CONCEPTOS INTRODUCTORIOS
La adherencia del virión a los receptores celulares es mediada por
estructuras especializadas: "las proteínas de adherencia", presentes
en múltiples copias en el virión. En algunos virus, se produce una
PRGL¿FDFLyQFRQIRUPDFLRQDOGHGLFKDVSURWHtQDVFRPRFRQVHFXHQcia de su interacción con el microambiente celular local, lo cual
SHUPLWLUi VX DGVRUFLyQ \ SRVWHULRU SHQHWUDFLyQ véase el capítulo
2 8QDYH]HQHOLQWHULRUFHOXODUORVYLUXVSXHGHQSURSDJDUVHHQ
HOODVLQSURPRYHUFDPELRVYLVLEOHVDOPLFURVFRSLRySWLFR DXVHQFLD
GHHIHFWRFLWRSiWLFR RELHQSURPRYHUOHVLRQHVFHOXODUHVDVRFLDGDV
DVXSUHVHQFLD PHFDQLVPRGLUHFWR RDODUHVSXHVWDLQPXQHRQR
LQPXQHGHOKRVSHGHURIUHQWHDODLQIHFFLyQ PHFDQLVPRLQGLUHFWR 6.2. ¿CÓMO INGRESA UN VIRUS A UNA CÉLULA?
¿QUÉ HACE EN ELLA?
El encuentro ocurre inicialmente como resultado del azar.
6LJXLHQGRXQDIyUPXODPiWHPiWLFDODSUREDELOLGDGGHTXHVHSURduzca una infección por una partícula dada resulta de la ecuación
>[email protected]>[email protected]>[email protected] libres y VR la de receptores unidos a virus.
/RVYLUXV±YHUGDGHURVPDHVWURVGHOFDPXÀDMH\HOHQJDxR–
GHEHQLQJUHVDUDODFpOXODFDXViQGROHHOPHQRUGDxRSRVLEOHGHMDQdo el mínimo rastro de su ingreso a la misma para no ser detectados
por el sistema inmune. La tarea esencial es propagarse desde una
célula infectada hacia otra no infectada. Para ello debe procederse
al empaquetado del RNA o DNA viral y de las proteínas accesorias,
ORJUDUXQDDGHFXDGDSURWHFFLyQSDUDSHUVLVWLUHQHOPHGLRH[WUDFHlular e introducir la información genética viral a una nueva céluOD&RPRXQFDEDOORGH7UR\DHOLQWUXVRHQFXHQWUDODFyPSOLFH
asistencia" de la víctima, para lo cual el virus utiliza la información adquirida durante años de co-evolución con su hospedero. La
PD\RUtDGHORVYLUXVD'1$ DH[FHSFLyQGHORVSR[YLUXV WLHQHQ
SRUREMHWLYRODUHSOLFDFLyQGHGLFKRJHQRPDHQHOQ~FOHRSRUHO
FRQWUDULRORVYLUXVD51$ DH[FHSFLyQGHORVRUWKRP\[RYLUXV\
ORVLULGRYLUXV ORKDFHQHQHOFLWRVRO3DUDVXSURSDJDFLyQORVYLUXV
deben cumplir con un programa de "etapas múltiples", donde cada
XQDGHEHVHUUHDOL]DGDHQXQWLHPSR\OXJDUHVSHFt¿FRV/DVHWDSDV
LQLFLDOHVGHXQLyQGHODVXSHU¿FLHYLUDODPROpFXODVGHVXSHU¿FLH
FHOXODUWLHQHQOXJDUFRQGLIHUHQWHD¿QLGDG$OJXQDVPROpFXODVFHlulares de adherencia sólo permiten la unión inicial de las partícuODV FRQFHQWUiQGRODVVREUHODFpOXOD VLQSURPRYHUODSURVHFXFLyQ
GHOFLFORGHPXOWLSOLFDFLyQ2WUDVPROpFXODV los receptores HQ
cambio, funcionan como disparadoras de dicho ciclo, activando
FDPELRVHQODHVWUXFWXUDPHWDHVWDEOHTXHFRQVWLWX\HDOYLUXV
DFWLYDQGRYtDVGHVHxDOL]DFLyQLQWUDFHOXODUORTXHIDYRUHFHOD
fusión y penetración. En esta instancia, una etapa crucial en el ingreso a la célula es el desnudamiento viral, seguido frecuentemente
por la endocitosis y el transporte del genoma al interior celular. El
SURJUHVRHQHVWDHWDSDGHXQLyQDODFpOXOD\GHVQXGDPLHQWRHVWi
UHJXODGRSRUODVVHxDOHVVXEUHSWLFLDVRSLVWDVTXHGHMDODFpOXOD
SDUDHOLQJUHVRODH[SRVLFLyQDORVUHFHSWRUHVODH[SRVLFLyQDXQ
S+iFLGR\ODUHLQPHUVLyQDXQPHGLRDPELHQWHUHGXFWRU3DUDSRder responder a dichas señales, algunos de los componentes virales
SRUHMHPSORODVJOLFRSURWHtQDVGHHQYROWXUD H[LVWHQHQXQDIRUPD
PHWDHVWDEOHIiFLOPHQWHPRGL¿FDEOHVLQJDVWRGHHQHUJtD
/RVYLUXVSXHGHQXWLOL]DUPiVGHXQUHFHSWRU0iVD~QDOJXQRVYLUXVD51$SXHGHQPRGL¿FDUFRQFLHUWDIDFLOLGDGORVOLJDQGRV
GH VX VXSHU¿FLH SDUD OD XWLOL]DFLyQ GH GLIHUHQWHV UHFHSWRUHV DQWH
la ausencia del UHFHSWRUSULQFLSDO XQDJHQXLQDDGDSWDFLyQYLUDO DXQTXHHOORQRVLHPSUHRFXUUHHQIRUPDLQPHGLDWD$VtSRUHMHPplo, la KHPDJOXWLQLQD + + y + SUHVHQWH HQ XQD GH ODV GRV
clases de espículas glicoproteicas que posee el virus LQÀXHQ]Dtipo
A adaptado a la especie humana –y por ende presente en los virus
actualmente causantes de HSLGHPLDV VXEWLSRV+1\+1 ±VH
adsorbe preferentemente a receptores celulares del tracto respi-
95
Capítulo 5 / Patogenia de las infecciones virales
LCM
Unión a
A-DG
Virus
Junín
Unión a
TfR1
A
B
SV40
C
Actina
Dinamina
Clatrina
CAVEOSOMA
Caveolina
Transporte
por microtúbulos
ENDOSOMA
R.E
Figura 5.21. Vías endocíticas utilizadas por virus. A.'HSHQGLHQWHGHFROHVWHUROHLQGHSHQGLHQWHGHGLQDPLQD\FDYHROLQDB. DepenGLHQWHGHFODWULQD\GLQDPLQDC.'HSHQGLHQWHGHFROHVWHURODFWLQDFDYHROLQD\GLQDPLQD/&09LUXVGHODFRULRPHQLQJLWLVOLQIRFLWDULDĮ'*
ĮGLVWURJOLFDQR7I5Transferrin receptor5(5HWtFXORHQGRSOiVPLFR$GDSWDGRGH5RMHN-0 .XQ]6Cell Microb
5HSURGXFLGRFRQDXWRUL]DFLyQ
UDWRULR VXSHULRU TXH FRQWLHQHQ iFLGR VLiOLFR XQLGR D UHVLGXRV GH
ĮJDODFWRVD(QFDPELRHOYLUXVLQÀXHQ]Dtipo A VXEWLSR+1
adaptado a las aves, se une preferentemente a receptores que conWLHQHQiFLGRVLiOLFRXQLGRDUHVLGXRVGHĮJDODFWRVDSUHVHQWH
tanto en el intestino de las mismas como en el tracto respiratorio
LQIHULRUGHODHVSHFLHKXPDQD/DHVSHFL¿FLGDGGHOVLWLRGHXQLyQ
de la hemaglutinina a uno o a otro UHFHSWRUHVWiUHSUHVHQWDGDSRU
VyORGRVDPLQRiFLGRVHQODVSRVLFLRQHV\GHDTXpOOD $VS
HQDPEDVSDUDLQÀXHQ]DDGDSWDGRDOKRPEUHR*OX\*O\
para LQÀXHQ]DDGDSWDGRDODVDYHV 6LELHQQRVHKDREVHUYDGRXQD
WUDQVPLVLyQLQWHUKXPDQDH¿FLHQWHGHLQÀXHQ]DDYLDU SRUHOsubtipo
+1 KDVWDH[LVWHD~QHOULHVJRSRWHQFLDOGHGLVHPLQDFLyQ
pandémica de dicho virus como eventual resultado de mutaciones
en posiciones aminoacídicas críticas de la hemaglutinina viral.
/RVUHFHSWRUHVSXHGHQYDULDUVHJ~QVXFRPSRVLFLyQ SURWHtQDV
JOLFROtSLGRV D]~FDUHV XELFXLGDG SURPLVFXRV R UHVWULQJLGRV D
FLHUWDVHVWLUSHVFHOXODUHV \GHQVLGDGFHOXODU/RVPLVPRVFRQVWLWXyen uno de los principales determinantes del tropismo celular y de
KRVSHGHUR/RVYLUXVSXHGHQXWLOL]DUP~OWLSOHVUHFHSWRUHVVLPXOWineamente o –en otros casos– sucesivamente para ingresar a la céOXOD FRPRRFXUUHFRQ+,9KHUSHVVLPSOH[&R[VDFNLHRKHSDWLWLV
&>[email protected] (QHOFDVRGHOHIV es conocido que la
interacción inicial con moléculas de adherencia tales como las de
unión a manosa pertenecientes a la familia de receptores lectínicos
tipo C, '&6,*1 Dendritic Cell –SSHFL¿FIntercellular adhesion
molecule [ICAM-3] Grabbing Nonintegrin R/6,*1 Liver and
Lymph node SSHFL¿F Intercellular adhesion molecule [ICAM-3]
Grabbing Nonintegrin SHUPLWHODXQLyQDODFpOXODSHURQRSURmueve cambio alguno en la estructura viral. La interacción subsiJXLHQWHGHODJOLFRSURWHtQDJSGHODHQYROWXUDYLUDOFRQHOreceptor CD4 permite un cambio conformacional de aquélla, que a su
vez posibilita la interacción con los correceptores &&5RCXCR4.
Esta interacción promueve un cambio espacial de la glicoproteína
YLUDOGHWUDQVPHPEUDQDJSTXHHQWRQFHVDGTXLHUHODFRQIRUPDción adecuada para la fusión con la membrana celular. En modo
VHPHMDQWHODLQWHUDFFLyQLQLFLDOGHODJOLFRSURWHtQDGHHQYROWXUDJ&
GHOKHUSHVVLPSOH[FRQSURWHRJOLFDQRVKHSDUiQVXOIDWRVSHUPLWHOD
subsiguiente interacción entre otras glicoproteínas virales de super¿FLH\UHFHSWRUHVFHOXODUHVFRPR+9( Herpes Virus Entry QHFtinas o integrinas. Los virus &R[VDFNLH%FRQVWLWX\HQXQDPXHVWUD
de la estrategia magistral de algunos virus para alcanzar el recepWRU DGHFXDGR HQ XQD FpOXOD D SHVDU GH REVWiFXORV DSDUHQWHPHQWH
LQVDOYDEOHV SDUD ORJUDUOR )LJXUD 3DUD HQWUDU D OD FpOXOD
&R[VDFNLH % GHEH LQWHUDFWXDU FRQ HO UHFHSWRU &$5 CoxsackieAdenovirus Receptor HO TXH HVWi SUHVHQWH HQ ODV XQLRQHV HVWUHFKDVLQWHUFHOXODUHV SROREDVRODWHUDO SRUORTXHODLQWHUDFFLyQFRQ
DTXHOORVYLUXVTXHOOHJDQDODFpOXODSRUHOSRORDSLFDOHVWiLPSHdida. &R[VDFNLH%LQWHUDFFLRQDLQLFLDOPHQWHHQODVXSHU¿FLHDSLFDO
GHODFpOXODFRQUHFHSWRUHV'$) Decay Accelerating Factor, una
glicoproteína WLSR,GHPHPEUDQD ORFXDO±WUDVVXHQWUHFUX]DPLHQto– dispara una señalización intracelular mediada por la tirosina
TXLQDVDF$EOTXHPHGLDQWHODDFWLYDFLyQGHOD*73DVD5DFSURmueve un reordenamiento del citoesqueleto de actina, y permite la
WUDQVIHUHQFLD GH ODV SDUWtFXODV XQLGDV HQ HO SROR DSLFDO FRQ '$)
hasta las uniones estrechas intercelulares en el polo basolateral.
Ello posibilita la interacción de &R[VDFNLHFRQ&$5receptor que
promueve los cambios conformacionales al virus que permiten su
introducción al citoplasma a través de una endocitosis mediada por
FDYpROD YpDVHPiVDGHODQWH 8QGHVSOD]DPLHQWRODWHUDOVHPHMDQWH
–imagine el lector un verdadero evento surfístico– ocurre con HIV.
En este caso –como en el del virus SDSLORPDKXPDQR +39 ±WLHQH
XQUROFUXFLDOHOPRYLPLHQWRGHGLIXVLyQODWHUDO GHVSOD]DPLHQWR VREUHODVXSHU¿FLHFHOXODU
El receptor para el virus SROLR &' FRQVLVWHHQWUHVGRPLQLRVH[WUDFHOXODUHVXQRGHWUDQVPHPEUDQD\RWURLQWUDFHOXODU6X
estructura proteica espacial permite su inclusión entre los miembros de la superfamilia de las inmunoglobulinas. Sólo las formas
alfa y delta del UHFHSWRU TXHWLHQHQHOGRPLQLRGHWUDQVPHPEUDQD son funcionales. Sorprendentemente, el RNAm de estos receptores
VHH[SUHVDHQDOWRJUDGRHQHOKtJDGRSXOPyQ\FRUD]yQSHURQRHQ
el cerebro. Dado que esos tres órganos no son considerados sitios
habituales de replicación del virus SROLRVHLQ¿HUH±FRPRVHPHQcionó al comienzo de este capítulo– que el tropismo viral no es sólo
determinado por la mera distribución celular de su receptor. Los
DPLQRiFLGRVXELFDGRVHQODSRVLFLRQHV *O\ 6HU *OQ /HX *OX *OQ \ 6HU GHOreceptor determinan
ODHVSHFL¿FLGDGGHKRVSHGHURSDUDHVWHYLUXV VyORHQKXPDQRV\
FKLPSDQFpVH[SHULPHQWDOPHQWHLQRFXODGRV (OYLUXVSROLRLQWHUDFW~DDWUDYpVGHXQDUHJLyQHVWUHFKD\KXQGLGDGHODVXSHU¿FLHGH
VXFiSVLGH GHQRPLQDGDFDxyQ FRQHVWHreceptor, promoviendo un
96
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
cambio en aquélla que permite la eliminación de la proteína interna
93\H[SRQHODSRUFLyQKLGURIyELFDGH93HQODVXSHU¿FLHYLUDO
ORTXHDXPHQWDODD¿QLGDGSRUODPHPEUDQDFHOXODU )LJXUD Ello gatilla la formación de un poro constituido por moléculas de
93DQFODGDVHQODELFDSDOLStGLFD VHLJQRUDVLHVGHODPHPEUDQD
FHOXODURGHORVHQGRVRPDV DVRFLDGDVDOreceptor. Este evento es
UHVSRQVDEOHGHOSDVDMHGHO51$YLUDODOFLWRVRO PHWDIyULFDPHQWH
LPDJLQHHOOHFWRUHOPRYLPLHQWRGHH[WUXVLyQGHXQDFUHPDDWUDYpV
GHXQDPDQJDSDVWHOHUD Si bien la interacción inicial entre los ligandos y los receptores
FHOXODUHVHVGpELO FRQVWDQWHGHD¿QLGDGHQHORUGHQPLOLPRODU OD
multiplicación de dichas interacciones torna al proceso de unión
XQHYHQWRGHDOWDDYLGH]\SUiFWLFDPHQWHLUUHYHUVLEOH(QHOFDVR
GHORVRUWKRP\[RYLUXV\ORVSDUDP\[RYLUXVVXVJOLFRSURWHtQDVGH
HQYROWXUDLQWHUDFW~DQFRQUHVLGXRVGHiFLGRVLiOLFR iFLGR1DFHWLO
QHXUDPtQLFR HQ OD FpOXOD /D SUHVHQFLD GH XQD HQ]LPD FRQ DFWLvidad de QHXUDPLQLGDVDHQODVXSHU¿FLHGHHVWRVYLUXVSURPXHYH
la prosecución del ingreso a la célula, mediante la destrucción de
dicho receptor, facilitando la liberación de las partículas.
/DVLQWHUDFFLRQHVHQWUHODVVXSHU¿FLHVYLUDOHV\FHOXODUHVSXHGHQWHQHUFRPRVXVWUDWRDSURWHtQDVSUHVHQWHVHQDPEDVVXSHU¿FLHV
o a proteínas y carbohidratos. Los virus envueltos lo hacen medianWH JOLFRSURWHtQDV OD DQWHV PHQFLRQDGDhemaglutinina de LQÀXHQ]DFRQiFLGRVLiOLFRJOLFRSURWHtQDVGHHQYROWXUDFRPRJSGHO
+,9FRQ&'ODJOLFRSURWHtQD'GHOKHUSHVVLPSOH[FRQ+9($
JSGHO(%9FRQ+/$'5HWF PLHQWUDVTXHORVYLUXVGHVQXGRV
ORKDFHQDWUDYpVGHSURWHtQDVGHODFiSVLGH SRUHMHPSORODVGHO
KH[yQGHORVDGHQRYLUXVFRQHOreceptor CAR, o la hendidura de la
FiSVLGH>[email protected] y enterovirus –incluyendo el virus polio– con el UHFHSWRUHVSHFt¿FRHWF (OSDSHO
de los carbohidratos en el ingreso a la célula es destacado, ya que
FLHUWRV YLUXV SXHGHQ XQLUVH D UHVLGXRV GH iFLGR VLiOLFR PLHQWUDV
otros lo hacen a gliscosaminoglicanos o a glicolípidos. El proteoJOLFDQRGHKHSDUiQVXOIDWRHVODPROpFXODUHFRQRFLGDSRUP~OWLSOHV
DJHQWHV DGHPiV GHO DQWHULRUPHQWH PHQFLRQDGR KHUSHV VLPSOH[ como HPV, dengue, SDUDP\[RYLUXVWLSRYLUXVDGHQRDVRFLDGRV
etc. Las interacciones con los carbohidratos celulares habitualmente sirven para la unión de virus, pero no promueven cambios en la
estructura viral. En algunos casos, las interacciones virus-célula
RFXUUHQ HQWUH FDUERKLGUDWRV GH OD VXSHU¿FLH YLUDO OLJDQGRV FRQ
OHFWLQDVGHODVXSHU¿FLHFHOXODUFRPRVHREVHUYDHQWUHORVUHVLGXRV
de manosa de las glicoproteínas del HIV, HCV, dengue, Ébola, y
HCMV, con DC-SIGN y /6,*1(OYLUXV69\ORVpoliomaYLUXVLQWHUDFFLRQDQFRQJDQJOLyVLGRV8QEROVLOORVXSHU¿FLDOGHOD
SURWHtQDSULQFLSDO93GHODFiSVLGHGHORVpoliomavirus reconoce
HOGLVDFiULGRiFLGRVLiOLFRĮJDODFWRVDXQLGRDGLFKRVJDQJOLysidos.
6LELHQH[LVWHQVLPLOLWXGHVHQWUHODRUJDQL]DFLyQJHQyPLFDHVtructura y manifestaciones clínicas causadas por los arenavirus del
1XHYR\9LHMR0XQGRHVWRVSDWyJHQRVXWLOL]DQQRVyORGLIHUHQWHV
moléculas receptoras sino también distintas vías de internalización
FHOXODU YpDVHPiVDGHODQWH $VtORVDUHQDYLUXVGHO9LHMR0XQGR
XWLOL]DQDODPROpFXODGHĮGLVWURJOLFDQR Į'* ±XQreceptor ceOXODUSDUDSURWHtQDVGHODPDWUL]H[WUDFHOXODU±PLHQWUDVTXHORVGHO
Nuevo Mundo emplean al UHFHSWRUGHWUDQVIHUULQD 7I5 (VWH
último desempeña un rol preponderante en el metabolismo celular
GHOKLHUURH[SUHViQGRVHHQFpOXODVGHOHQGRWHOLRYDVFXODU\FpOXODV
GHOVLVWHPDLQPXQH )LJXUD Sorprendentemente, el EBV adapta su composición de glicoproteínas de envoltura para "acomodarse" a los receptores presentes en linfocitos B y en células epiteliales. Dado que los /%H[KLEHQPROpFXODVGHOFRPSOHMRPD\RUGHKLVWRFRPSDWLELOLGDGGHFODVH
,, '5 HQ VX VXSHU¿FLH (%9 LQWHUDFFLRQD FRQ HOODV H[KLELHQGR
HO WUtPHUR J+ J/ \ JS VLHQGR HVWD ~OWLPD OD PROpFXOD TXH VH
une a la &0+,,'HELGRDTXHODVFpOXODVHSLWHOLDOHVQRH[SUHVDQ
CMH-II, las variantes de EBV con tropismo por dichas células,
QRH[KLEHQHQVXVXSHU¿FLHJS(VWHFDPELRPROHFXODUSHUPLWH
que las variantes surgidas luego de la reactivación de la latencia en
los linfocitos B, tengan tropismo por las células epiteliales de un
QXHYRKRVSHGHUR'HPDQHUDDQiORJDHQHOQXHYRKRVSHGHURODV
variantes que se producen en las células epiteliales y que contienen
ODVJOLFRSURWHtQDVGHHQYROWXUDSXHGHQLQIHFWDULB, y así iniciar
la latencia viral en dichas células.
)LQDOPHQWH HO UHFHSWRU FHOXODU SDUD HO HU\WKURYLUXV SDUYRYLUXV %HVHODQWtJHQR3XQJOXFRHV¿QJROtSLGRTXHVHHQFXHQWUD
en la membrana de células eritroides y actúa como antígeno de
grupo sanguíneo. El UHFHSWRU 3 HVWi WDPELpQ SUHVHQWH HQ plaquetas, hígado, miocardio fetal, pulmón, riñón, endotelio, sinovia y
HQFpOXODVGHODVYHOORVLGDGHVWURIREOiVWLFDVGHOWHMLGRSODFHQWDULR
En este último WLSRFHOXODUODH[SUHVLyQGHOUHFHSWRUH[KLEHQLYHOHVPi[LPRVHQHOSULPHUWULPHVWUHGHOHPEDUD]RHQODVFpOXODVGH
ODVYHOORVLGDGHVWURIREOiVWLFDVGHFOLQDQGRVXEVLJXLHQWHPHQWHSDUD
VHU LQGHWHFWDEOH KDFLD HO ¿QDO GH OD JHVWDFLyQ (VWR ~OWLPR WLHQH
importantes implicancias en la transmisión vertical de la infección
SRUHU\WKURYLUXV%&DEHGHVWDFDUTXHHVWHYLUXVWDPELpQSXHGH
LQJUHVDUDFpOXODVGHOLQDMHQRHULWURLGHDWUDYpVGHODLQWHUDFFLyQ
con DQWLFXHUSRV \ UHFHSWRUHV )F SRU XQ SURFHVR FRQRFLGR FRPR
potenciación viral.
Curiosamente, aquellas interacciones moleculares que tornan
HVWDEOHVDODSDUWtFXODYLUDOIUHQWHDOHVWUpVGHODPELHQWHH[WUDFHlular, deben ser deshechas para posibilitar la propagación viral: la
HQYROWXUDGHEHVHUHOLPLQDGDODFiSVLGHDELHUWD\HOJHQRPDGHVcondensado.
Una vez que se produce la interacción entre receptores y ligandos, el resultado promovido es la internalización de la partícula
viral a la célula ya sea por fusión de membranas o mediante endociWRVLV(VWH~OWLPRPHFDQLVPRUHJDODDORVYLUXVXQYLDMHJUDWXLWR
DOFLWRSODVPD(OORWLHQHYDULDVYHQWDMDVD QRTXHGDQUDVWURVGH
glicoproteínas en la membrana celular que puedan ser detectadas
SRUHOVLVWHPDLQPXQHE VHDWUDYLHVDHVWUXFWXUDVDOWDPHQWHRUJDQL]DGDVSUHVHQWHVHQHOFLWRSODVPD\ODVEDUUHUDVGHOFLWRHVTXHOHWR
\F HODPELHQWHDFtGLFRIDYRUHFHHOGHVQXGDPLHQWRYLUDO/DVSDUtículas son habitualmente depositadas en estructuras endosómicas,
o en lisosomas, RE, u ocasionalmente en el aparato de Golgi. Sin
HPEDUJRHOULHVJRGHFRQGXFLUDXQYLUXVDXQFDOOHMyQVLQVDOLGD
como es la vía muerta de los lisosomas donde se podría producir
la degradación viral, ha hecho que los virus hayan desarrollado un
VLVWHPDGH¿QDUHJXODFLyQGHVXGHFDSVLGDFLyQHQIXQFLyQGHOVHQVDGRGHODDFLGH]DPELHQWDO HQHQGRVRPDVWHPSUDQRVR
HQHQGRVRPDVWDUGtRV (ODGYHQLPLHQWRGHODYLGHRPLFURVFRStD
permitió monitorear el destino de las partículas virales en el inteULRUFHOXODUDOXWLOL]DUFRPSXHVWRVÀXRUHVFHQWHVFRQMXJDGRVDOD
SDUWtFXODYLUDODOSURGXFLUVHVXDFLGL¿FDFLyQ\IXVLyQDODVPHPbranas celulares.
¢&yPR\SRUTXpLQJUHVDQDODFpOXODORVYLUXV" Éstos deEHQKDFHUVDEHUDODFpOXODDFHUFDGHVXSUHVHQFLDHQODVXSHU¿cie de las mismas. Para ello, es necesario promover alguna señal.
Esto se logra a veces mediante el entrecruzamiento de receptores,
otras, mediante el agrupamiento de ciertas moléculas en la super¿FLH 'H HOOR VXUJHQ VHxDOHV LQWUDFHOXODUHV HQ ODV TXH SDUWLFLSDQ
TXLQDVDV WLURVLQD\VHULQWUHRQLQDTXLQDVDV3,3TXLQDVDVHWF IRVIDWDVDV \ *73DVDV TXH DFWLYDQ GLYHUVDV YtDV GH VHxDOL]DFLyQ
Por dicha razón, muchos virus utilizan moléculas como las integrinas como receptores para disparar vías de señalización. En el
FDVRGHORVDGHQRYLUXVODSURWHtQDGHOSHQWyQ MXQWRDODGHOKH[yQ
FRQVWLWX\HQWHVGHODFiSVLGH LQWHUDFW~DFRQHOreceptor CAR y con
LQWHJULQDV OR TXH PHGLD OD IRVIRULODFLyQ GH OD 3,3 TXLQDVD TXH
PHGLDQWHODDFWLYDFLyQGHOD*73DVD5$&\&GFSURPXHYHODSRlimerización de actina y la endocitosis viral mediada por clatrina.
(QHOFDVRGH69ODVHxDOL]DFLyQLQWUDFHOXODUHVPHGLDGDSRU
quinasas, las que sólo si son funcionales permiten el ingreso del
mismo. Otros virus utilizan glicoproteínas de membrana tipo I y
JDQJOLyVLGRV XQLGRVDODVXSHU¿FLHH[WHUQDGHODPHPEUDQDFHOXODU FRPRUHFHSWRUHVGHELGRDTXHVXDJUXSDPLHQWRVHDVRFLDDOD
IRUPDFLyQGHEDOVDVOLStGLFDV GHOLQJOpVlipid rafts: microdomiQLRVGHPHPEUDQDHQULTXHFLGRVHQFROHVWHURO TXHDFWLYDQWLURVLQD
TXLQDVDV GHO ODGR FLWRVyOLFR GH OD PHPEUDQD (Q PRGR DQiORJR
97
Capítulo 5 / Patogenia de las infecciones virales
A
B
Ete
6
1
Eta
A
5
2
C
Em
Núcleo
Mt
3
4
Eta
Mt
)LJXUD,PiJHQHVÀXRUHVFHQWHV\VLWLRVGHIXVLyQGHSDUWtFXODVLQGLYLGXDOHVGHOYLUXVLQÀXHQ]DHQFpOXODV&+2$ Imagen
REWHQLGDPHGLDQWHPLFURVFRStDGHOX]UHÀHMDGD\FRQWUDVWHGHLQWHUIHUHQFLDGLIHUHQFLDO ',& GHXQDFpOXOD&+2 L]TXLHUGD HLPiJHQHVÀXRUHVFHQWHVGHYLUXVWHxLGRVFRQXQFRORUDQWHOLSRItOLFR ','ƍGLRFWDGHFLOƍƍWHWUDPHWLOLQGRGLFDUERFLDQLQD DOFDERGHPLQ FHQWUR \
PLQ GHUHFKD OXHJRGHLQLFLDGDODLQIHFFLyQ/DOtQHDEODQFDGHPDUFDORVOtPLWHVGHOQ~FOHRB. /RVVLWLRVGHIXVLyQGHSDUWtFXODVYLUDOHV
LQGLYLGXDOHVVHLQGLFDQFRQHVWUHOODVURMDV/RVERUGHVGHOQ~FOHRHVWiQLQGLFDGRVFRQXQDOtQHDJUXHVDJULV\RWUD¿QDEODQFDUHVSHFWLYDPHQWH/RVQ~FOHRVRYRLGHVVHYLVXDOL]DQFHUFDGHOFHQWURGHODVFpOXODVURGHDGRVGHHVWUXFWXUDVYHVLFXODUHVTXHH[KLEHQDOWRFRQWUDVWH
/DVHVWUHOODVTXHDSDUHQWDQHVWDUGHQWURGHOQ~FOHRSUREDEOHPHQWHLQGLTXHQHYHQWRVGHIXVLyQSRUHQFLPDRSRUGHEDMRGHOPLVPRC.
0RGHORGHYtDHQGRFtWLFDGHWUDQVSRUWHYLUDOKDFLDORVHQGRVRPDVWDUGtRV(OYLUXVHVLQWHUQDOL]DGR\WUDQVSRUWDGRDXQHQGRVRPDWHPSUDQR
(WH HQXQPRGRDFWLQD $ GHSHQGLHQWH (WDSD,GHOGHVSOD]DPLHQWR (OFRPSDUWLPLHQWRHQGRFtWLFRTXHFRQWLHQHHOYLUXVGHMDHO(WH
D~QFRQS+H[WUDFHOXODU(VWRSXHGHRFXUULU\DVHDPHGLDQWHXQWUDQVSRUWDGRUYHVLFXODUGHSDUWtFXODVYLUDOHVTXHEURWDGHO(WHRDWUDYpV
GHODUHJLyQWXEXODUHQULTXHFLGDHQPHPEUDQDHQGRVyPLFDTXHGHMDOD]RQDGHUHFLFODGRGHHQGRVRPDVSDUDFRQIRUPDUXQDHVWUXFWXUD
HQGRFtWLFDPiVYHVLFXODUFRQWHQLHQGRYLUXV8QDXRWUDVRQWUDQVSRUWDGDVDODUHJLyQSHULQXFOHDUPHGLDQWHHOWUDQVSRUWHHQPLFURW~EXORV
0W DVRFLDGRVDGLQHtQD HWDSD,,GHVSOD]DPLHQWR 'LFKDVIRUPDFLRQHVPDGXUDQDHQGRVRPDVPDGXURV (P FDPELDQGRHOPRWRUXQLGR
DODPHPEUDQD WUDQVLFLyQGHODHWDSD,,DOD,,, 'LFKR(PPDGXUDD~QPiVFDPELDQGRVXS+D/DPD\RUDFLGL¿FDFLyQSURPXHYHHO
FDPELRDHQGRVRPDVWDUGtRV (WD GRQGHHOS+HVLJXDOD VHJXQGDDFLGL¿FDFLyQ \JDWLOODODIXVLyQHQWUHpVWH\ODHQYROWXUDYLUDO$\%
,PiJHQHVREWHQLGDVGHODSXEOLFDFLyQGH/DNDGDP\DOL0et al. Proc Natl Acad Sci86$/DLPDJHQ&HVXQDDGDSWDFLyQ
GHODPLVPDSXEOLFDFLyQ5HSURGXFLGRFRQDXWRUL]DFLyQ
DOJXQRV PLHPEURV GH OD IDPLOLD GH ODV 6UF TXLQDVDV DXQTXH QR
GLFKDTXLQDVD HVWiQDVRFLDGDVDEDOVDVOLStGLFDVGHOODGRFLWRVyOLFR
GHODPHPEUDQDSODVPiWLFD\VHDFWLYDQDQWHVXGREOHDFHWLODFLyQ
/DSHQHWUDFLyQYLUDO LQJUHVRGHVXJHQRPD\GHODVSURWHtQDV
DFFHVRULDVDWUDYpVGHXQDPHPEUDQDFHOXODU RFXUUHGHPRGRGLverso según se trate de virus envueltos o desnudos: los primeros lo
hacen mediante fusión, mientras los segundos lo pueden hacer luego de la endocitosis mediada por receptor, o directamente a través
de la formación de poros en la misma.
La penetración de los virus envueltos y desnudos ocurre merced a cambios cooperativos generalmente irreversibles en sus resSHFWLYDV VXSHU¿FLHV HQYROWXUD y FiSVLGH TXH VRQ JDWLOODGRV SRU
ODXQLyQDUHFHSWRUHVFHOXODUHVRSRUHOEDMRS+(QHOFDVRGHORV
YLUXVHQYXHOWRVODIXVLyQHVWiDVRFLDGDDODSUHVHQFLDGHJOLFRSURteínas de tipo I o WLSR,,HQODVXSHU¿FLHYLUDO/DVSULPHUDV FRPR
las hemaglutininas de LQÀXHQ]D VH IRUPDQ FRPR KRPRWUtPHURV
unidos por sus respectivas colas, las que luego de unirse al recepWRUH[SRQHQXQDUHJLyQKLGURIyELFDTXHSURPXHYHODIXVLyQ(OOR
ocurre debido a que si bien en el R.E. se sintetiza un precursor oligomérico estable, al atravesar el sistema de secreción celular, son
FOLYDGDVPHGLDQWHSURWHyOLVLVORTXHOHFRQ¿HUHXQDFRQIRUPDFLyQ
metaestable y con capacidad de fusión. Este estado metaestable
permite una conversión cooperativa a una conformación de menor
energía. Dicha nueva conformación espacial de la espícula de envoltura -al unirse al UHFHSWRUH[SRQHODUHJLyQKLGURIyELFDTXHVH
ancla en la membrana celular. La energía libre liberada es utilizada
SDUDSURPRYHUODDSUR[LPDFLyQIRFDOL]DGDHQWUHODHQYROWXUDYLUDO\
la membrana celular e inducir la fusión. Las glicoproteínas tipo II,
FRPRODVTXHH[KLEHQORVÀDYLYLUXV SRVHHQFDSDFLGDGIXVLRQDQWH
)RUPDQKHWHURGtPHURVFRQRWUDVSURWHtQDVGHPHPEUDQD/XHJRGH
la unión al receptor, y promovida la endocitosis mediada por éste,
ante un descenso del pH en los compartimientos endosomales, se
disocian dichos heterodímeros y se reasocian las glicoproteínas
con capacidad de fusión como homotrímeros activos con capacidad de fusión de membranas.
Ciertos virus envueltos como los herpesvirus y diversos retrovirus incluyendo HIV, pueden fusionar sus glicoproteínas de enYROWXUDDODPHPEUDQDFLWRSODVPiWLFDVLQGHSHQGHQFLDGHOS+OR
cual habitualmente genera una infección productiva de la célula.
3RU HO FRQWUDULR RWURV YLUXV HQYXHOWRV UHTXLHUHQ GH XQ S+ iFLGR
SDUDODIXVLyQGHVXVPHPEUDQDVGHSHQGLHQGRGHOUDQJRHVSHFt¿FR GH FDGD XQR OD IXVLyQ SXHGH WHQHU OXJDU HQ ORV HQGRVRPDV
98
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
WHPSUDQRVRWDUGtRV&LHUWRVYLUXVUHTXLHUHQDGHPiVGHOS+DSURpiado para fusionar sus membranas, la actividad de proteasas enGRVRPDOHV FDWHSVLQDV SDUDSURPRYHUODSHQHWUDFLyQ coronavirus
asociado al SARS, eEROD /D HQGRFLWRVLV PHGLDGD SRU receptor
dependiente de clatrina si bien es habitualmente utilizada por la
PD\RUtDGHORVYLUXVQRFRQVWLWX\HXQDYtDH[FOX\HQWHSDUDHOLQgreso de un virus determinado. Estudios in vitro realizados con
LQÀXHQ]DGHPRVWUDURQTXHXQGHODVSDUWtFXODVORKDFHQSRU
HVWD YtD \ XQ PHGLDQWH FDYpRODV GHO ODWtQ SHTXHxD FXHYD
LQGHQWDFLRQHVGHODPHPEUDQDULFDVHQFROHVWHUROHV¿QJROtSLGRV
caveolina y factores de señalización, en cuyo interior el pH es neuWUR 6RUSUHQGHQWHPHQWHODHQGRFLWRVLVGHSHQGLHQWHGHFODWULQDVH
REVHUYyVyORHQJUDGRPtQLPR DVRFLDGDDIRVLWDVSUHIRUPDGDV
URGHDGDVSRUFODWULQD3DUHFHUtDTXHH[LVWHXQDYtDGHVHxDOL]DFLyQ
de transmembrana desde el receptor unido al virus hacia el interior
celular que promueve la acumulación de clatrina subyacentemente
al sitio donde se encuentran dichos receptores unidos al ligando
viral. Desde las vesículas endocíticas los virus son transportados a
poblaciones seleccionadas de endosomas. En el caso de LQÀXHQ]D
ORKDFHPHGLDQWHHQGRVRPDVGHWUDQVSRUWHUiSLGRDWUDYpVGHOVLVWHPDGHPLFURW~EXORVKDFLDOD]RQDSHULQXFOHDU )LJXUD GRQGH
se promueve la fusión de membranas y la liberación del contenido.
(VWHSURFHVRHVFRPSOHMR\DTXHVHKDGHPRVWUDGRODSDUWLFLSDFLyQ
GHDGDSWDGRUHVFRIDFWRUHV\SURWHtQDVGHDQFODMHQHFHVDULDVSDUD
la formación de las vesículas y su transporte. Entre las quinasas,
cumplen un rol primordial aquellas relacionadas con el ciclo y el
FUHFLPLHQWRFHOXODUHOWUi¿FRLQWUDFHOXODUDWUDYpVGHPHPEUDQDV
\HOFLWRHVTXHOHWR8QSRUFHQWDMHPLQRULWDULRGHODVSDUWtFXODVGH
LQÀXHQ]DDVtFRPRHOYLUXV/&0 XQDUHQDYLUXV SXHGHQLQJUHVDU
a la vía mediada por endosomas mediante mecanismos clatrinaLQGHSHQGLHQWHV )LJXUD$ Los virus desnudos penetran habitualmente mediante endocitosis independientemente del pH FRPRORVDGHQRYLUXV\ORV
SROLRPDYLUXV DXQTXHen algunos casos pueden penetrar directamente a través de la membrana FLWRSODVPiWLFD FRPRORKDFH
SROLR (QHOFDVRGHORVSLFRUQDYLUXV HQWUHORVTXHVHHQFXHQWUD
SROLR ODLQWHUDFFLyQHQWUHHOFDxyQGHODFiSVLGH\HOreceptor
celular promueve la pérdida de la proteína precursora VP4, con
DQFODMHGH93 TXHH[SRQHUHVLGXRVGHiFLGRPLUtVWLFR HQODELcapa lipídica, la que forma un canal de transmembrana, a través
de la cual ingresa el genoma viral. Los DGHQRYLUXVGHOVHURWLSR
ingresan a la célula luego de interactuar con el receptor CAR y
HOFRUUHFHSWRUĮ9LQWHJULQDPHGLDQWHXQSURFHVRGHSHQGLHQWHGH
actina denominado macropinocitosis, aunque el proceso de endoFLWRVLVRFXUUHDWUDYpVGHODVIRVLWDVUHFXELHUWDVGHFODWULQD )LJXUD
% /DPDFURSLQRFLWRVLVHVRWUDGHODVYtDVHQGRFtWLFDVFRQRcidas. Es utilizada en un modo receptor-independiente para la capWDFLyQFHOXODUGHÀXLGRV\PDFURPROpFXODV/RVYLUXVTXHLQJUHVDQLQHVSHFt¿FDPHQWHSRUGLFKDYtD FRPRSRUHMHPSOR+,9>[email protected] )LJXUD \células dendríticas,
vaccinia, adenovirus, miembros de la familia Picornaviridae y
RWUDV IDPLOLDV DFWLYDQ YtDV GH VHxDOL]DFLyQ TXH JDWLOODQ FDPELRV
GHSHQGLHQWHV GH DFWLQD HQ OD PHPEUDQD FLWRSODVPiWLFD TXH SURmueven una invaginación central, rodeada por dos protrusiones
ondulantes laterales. Como resultado, se forma una gran vacuoOD GH D —P macropinosoma TXH URGHD D ODV SDUWtFXODV
Subsiguientemente, se produce a su través la descarga de virus o de
QXFOHRFiSVLGHVDOFLWRVRO
([LVWHRWURPHFDQLVPRGHLQJUHVRDODFpOXODFODWULQDLQGHSHQGLHQWHHVHOPHGLDGRSRUFDYpRODVGHOFXDOH[LVWHQWUHVYDULDQWHV
GHSHQGLHQWHV GH FDYHROLQD GH FROHVWHURO R GH GLQDPLQD /DV
cavéolas participan en el transporte de lípidos como colesterol, las
JOLFRSURWHtQDVGHDQFODMHtipo I y de componentes de las balsas lipídicas. Asimismo, las cavéolas median el transporte de factores
VpULFRVHQFpOXODVHQGRWHOLDOHVPHGLDQWHWUDQVFLWRVLV(O69OXHgo de una fase inicial de desplazamiento lateral, ingresa a través
GHFDYpRODVODVTXHPHGLDQWHODDFFLyQFRRUGLQDGDGHDSUR[LPDGDPHQWHTXLQDVDVGHODYtDGHVHxDOL]DFLyQGHLQWHJULQDV\GH
regulación de actina, permiten la liberación de las partículas desde
A
B
C
D
Figura 5.23. Ingreso del HIV a macrófagos mediante macropinocitosis. 0DFUyIDJRVH[SXHVWRVGXUDQWHPLQXWRVDODFHSD
+,9NLAD8 con tropismo para el correceptor &&5\OXHJRSURFHVDGRV
SDUDHOHVWXGLRSRU0(A.0DFUyIDJRLQIHFWDGRB. 0D\RUDXPHQWR
GHODLPDJHQGHOFXDGUR$VHREVHUYDQSDUWtFXODVYLUDOHVXQLGDVD
ODPHPEUDQDFHOXODU\GHQWURGHJUDQGHVYHVtFXODVLQWUDFHOXODUHV
C y D 3DUWtFXODV GHO +,9 HQ IRVLWDV UHFXELHUWDV GH FODWULQD 'H
0DUpFKDO9et al. J Virol 5HSURGXFLGRFRQDXWRUL]DFLyQ
el caveosoma al RE, utilizando la vía de translocación reversa de
sustratos hacia dicha organela, que se usa habitualmente para la
GHJUDGDFLyQGHSURWHtQDVHQHO5( )LJXUD& (QPRGRVHPHMDQWH±DXQTXHVLQSDUWLFLSDFLyQGHO5(±(&+2HVWDPELpQ
transportado al interior celular.
([LVWHQHYLGHQFLDVTXHODVGRVRUJDQHODVTXHSDUWLFLSDQHQOD
HQWUDGDGHYLUXVDODFpOXOD HQGRVRPDV\FDYpRODV HVWiQLQWHUFRQHFWDGDV¿VLROyJLFDPHQWHVHJ~QORVXJLHUHHOFRPSDUWLUDOJXQDVGH
sus quinasas en la señalización, y el transporte de sustratos entre
ambas. Dado que se ha comprobado la activación compensatoria
de una de dichas vías ante la inhibición de la otra, es comprensible
que ciertos virus como LQÀXHQ]DR69SXHGDQXWLOL]DUGLYHUVDV
vías, lo que les permite acceder a un amplio espectro de células
ante diferentes condiciones.
Un viaje a lo desconocido: el virus tiene un pase libre para
viajar en la célula. Una vez en el interior celular, los virus deben
HQFRQWUDUVXGHVWLQR¢&yPRORHQFXHQWUDQORVYLUXVHQHOLQWHULRU
FHOXODU"$OLQWHUDFWXDUHOYLUXVFRQXQreceptor celular, se produce
un diálogo bidireccional entre la célula hospedera y la "visita"
viral. Como resultado, ocurren cambios conformacionales en la estructura de éste y señales intracelulares, mediadas por los diversos
UHFHSWRUHV GHIDFWRUGHFUHFLPLHQWRHSLGpUPLFRGHquimioquinas,
LQWHJULQDV JDQJOLyVLGRV HWF TXH SUHSDUDQ D OD FpOXOD SDUD UHFLbir al "visitante", facilitando su ingreso y promoviendo a veces el
bloqueo de mecanismos de defensa. Algunos virus encuentran su
GHVWLQR HQ HO PHGLR GLVFUHWDPHQWH iFLGR GH ORV HQGRVRPDV WHPpranos o tardíos, otros en el RE, otros en el Golgi, y unos pocos
en el compartimiento post-secretorio. La información genética
GHEHVHUH[SUHVDGDSDUDSHUPLWLUVXSURSDJDFLyQHQHOKRVSHGHUR\
DVHJXUDUODFDGHQDGHSHUSHWXDFLyQHQODQDWXUDOH]D/DVFiSVLGHV
TXHDUULEDQDOFLWRVRO HVH[FHSFLRQDOHOFDVRHQTXHHOJHQRPDOR
KDFHGHVQXGRFRPRVHPHQFLRQyDQWHULRUPHQWHFRQYLUXVSROLR no pueden atravesarlo por mera difusión, teniendo en cuenta su
frecuente considerable tamaño, las "vastas" distancias a recorrer y
ODFRQJHVWLyQGHOWUi¿FRFLWRVyOLFR3RUHOORHVKDELWXDOTXHODV
FiSVLGHV DSURYHFKHQ OD H[LVWHQFLD GH SURWHtQDV GHO FLWRHVTXHOHWR
\GHOWUDQVSRUWHFHOXODU/DVFiSVLGHVVHWUDQVSRUWDQSRUGRVVLVWH-
99
Capítulo 5 / Patogenia de las infecciones virales
Endosoma
tardío
A
Influenza
B
C
D
Herpes
simplex
Adenovirus
HBV
B 19
Figura 5.24. Transporte de partículas virales y cápsides al núcleo. &RQ¿QHVGLGiFWLFRVODLPDJHQQRHVWiHQHVFDOD6HREVHUYDQ
SRVLEOHVYtDVGHHQWUDGDA.(OYLUXVLQÀXHQ]D XQ51$YLUXV HVWUDQVSRUWDGRSRUHQGRVRPDVWDUGtRVDOD]RQDSHULQXFOHDUGRQGHOD
DFLGL¿FDFLyQGHOLQWHULRUGHDTXpOORV\OXHJRGHODSURSLDSDUWtFXOD SRUDFWLYDFLyQGHOFDQDOLyQLFRSURWHLFRYLUDO0 SHUPLWHODIXVLyQGHOD
KHPDJOXWLQLQDGHHQYROWXUDDODPHPEUDQDHQGRVRPDOFRQOLEHUDFLyQGHODVULERQXFOHRSURWHtQDV 513V DOFLWRVROVXEVLJXLHQWHLQWHUDFFLyQ
FRQODLPSRUWLQDĮHLQJUHVRDOQ~FOHRDWUDYpVGHOSRURQXFOHDU HOGLiPHWURGHODV513VHVPHQRUTXHHOGHGLFKRSRUR B. Las cápsides
GHOYLUXVKHUSHVVLPSOH[ XQ'1$YLUXVHQYXHOWR OOHJDQKDVWDHOSRURQXFOHDUGRQGHXQYpUWLFHFDSVtGLFRHVDELHUWRSDUDSHUPLWLUHOSDVR
GHO'1$YLUDODOQ~FOHRGHMDQGRODFiSVLGHYDFtDDQFODGDC. El DGHQRYLUXV XQ'1$YLUXVGHVQXGR OOHJDDOSRURQXFOHDUGRQGHODFiSVLGH
LQWHUDFW~DFRQODSURWHtQD&$11XS\FRQODFRODERUDFLyQGHODKLVWRQD+HVGHVHQVDPEODGDOLEHUDQGRHO'1$YLUDODOTXHHVWiXQLGR
FRYDOHQWHPHQWHXQDSURWHtQD LQGLFDGDFRQODHVWUHOODURMD DWUDYHVDQGRDPEDVPROpFXODVHOSRURD./RVYLUXVPiVSHTXHxRVFRPRHO
HU\WKURYLUXV SDUYRYLUXV %RODFiSVLGHGHOYLUXVKHSDWLWLV%H[KLEHQXQGLiPHWURLQIHULRUDOGHOSRURQXFOHDUSRUORTXHSXHGHQSDVDUD
VXWUDYpV(OGHVQXGDPLHQWRRFXUUHHQHOQ~FOHR
PDVHQHVWHPHGLRD SRUYHVtFXODVHQGRFtWLFDVTXHSDVLYDPHQWH
ODVSRUWDQ\E SRUYHUGDGHUDVEDOVDVFRPRVRQODVmoléculas de
dineína y su adaptador la dinamina, dependientes del sistema de
microtúbulos. Asociadas a ellas, pueden ir a su destino frecuente,
HOQ~FOHRFRPRRFXUUHFRQFDVLWRGRVORVYLUXVD'1$7DPELpQ
un virus a RNA como LQÀXHQ]DDOFDQ]DGLFKDRUJDQHODPHGLDQWHOD
DVRFLDFLyQHQWUHODVULERQXFOHRSURWHtQDVYLUDOHV TXHSURWHJHQD
FDGDXQRGHORVIUDJPHQWRVGHO51$YLUDO \ODLPSRUWLQDȕ )LJXUD
/Dactina puede tener dos roles diferentes y contrapuestos:
D VHUXQREVWiFXORPiVHQHOFLWRVRODPRGRGHEDUUHUDSRUORTXH
YLUXVFRPR69SURPXHYHQVXSURSLDGLVRFLDFLyQGHORV¿ODPHQtos actínicos, mediante la activación de señales dependientes de
WLURVLQDTXLQDVDV\E SURSXOVDUYHVtFXODVHQGRFtWLFDVFRQWHQLHQGR
ODVFiSVLGHVHQHOFLWRVRO\WDPELpQIDYRUHFHUODEURWDFLyQIRFDOLzada del virus en la membrana celular. Para que el genoma llegue
al núcleo mediante la unión de las cápsides o virus al complejo del poro nuclear, se pueden promover al menos 4 estrategias
)LJXUD D TXHODFiSVLGHRYLUXVVHDWDQSHTXHxDR PHQRUD
QP TXHDWUDYLHVHGLFKRSRUR +%9RHU\WKURYLUXV%UHVSHFWLYDPHQWHGHVHQVDPEOiQGRVHHOSULPHURHQHOODGRQXFOHDUGHOD
FDQDVWDGHOSRURQXFOHDU E TXHODVFiSVLGHVVHXELTXHQHQHOODGR
citosólico del poro nuclear y luego de abrirse un vértice, permitan
HOSDVDMHGHO'1$DOQ~FOHRGHMDQGROLEHUDGDVFiSVLGHVYDFtDVHQ
HOFLWRVRO KHUSHVVLPSOH[ F TXHHOYLUXVGHVQXGRVHXELTXHHQ
HOODGRFLWRVyOLFRGHOSRURQXFOHDUDQFODGRDODSURWHtQD1XS
&$1GHVHQVDPEODQGRVXSURSLDFiSVLGHSRUODLQWHUDFFLyQFRQOD
KLVWRQD+\ODVLPSRUWLQDVȕ\IDFLOLWDQGRHOSDVDMHGHO'1$DO
Q~FOHRXQLGRFRYDOHQWHPHQWHDXQDSURWHtQDYLUDO DGHQRYLUXV \
G TXHOXHJRGHODIXVLyQGHODPHPEUDQDGHHQYROWXUDYLUDOFRQODV
del compartimiento endosómico, las ribonucleoproteínas liberadas
DOFLWRVRO DODVTXHVHDVRFLDQFDGDXQRGHORVIUDJPHQWRVGHO51$
YLUDO LQWHUDFW~HQ±FRPRVHPHQFLRQyDQWHULRUPHQWH±FRQODLPSRUWLQDȕ LQÀXHQ]D &RQODH[FHSFLyQGHORVOHQWLYLUXVFRPRHIV,
los UHWURYLUXVQRXWLOL]DQHOFRPSOHMRGHOSRURQXFOHDUSDUDLQJUHVDUDOQ~FOHR6yORSXHGHQLQJUHVDUVXFRPSOHMRGHSUHintegración
cuando las células carecen de membrana nuclear, como ocurre durante la mitosis, lo que limita su infectividad a células en división.
En contraposición, +,9ORJUDHOSDVDMHDWUDYpVGHOSRURQXFOHDU
PHUFHGDODSUHVHQFLDGHSURWHtQDV ODGHPDWUL]ODLQWHJUDVD\
YSU \DXQDFRUWDUHJLyQGHWULSOHKpOLFHGHO'1$SURYLUDO
Parafraseando a Ari Helenius, el hecho que se produzca el enVDPEODMH GH ODV SDUWtFXODV YLUDOHV WHQLHQGR HQ FXHQWD OD OLPLWDGD
información viral y la habitual múltiple compartimentación celular
de dicho evento, implican un "testamento" singular de los designios estructurales del virus y una medida de la generosa asistencia
de la célula.
Los virus envueltos habitualmente egresan mediante brotación
y secreción. Los virus desnudos habitualmente lo hacen mediante
OLVLVDXQTXHWDPELpQSXHGHQHQFRQWUDUVHHMHPSORVGRQGHVRQHOLminados de la célula mediante brotación al interior de organelas,
FRQHOLPLQDFLyQGHODHQYROWXUDH[WHUQD FRPRRFXUUHFRQORVURWDYLUXV RELHQDOHYLWDUORVSURFHVRVGHDXWRIDJLDJDQDQGRDFFHVRD
RUJDQHODVH[RFLWDGDVFRPRRFXUUHFRQpolio.
/D H[LVWHQFLD GH YLUXV TXH FRQWLHQHQ JOLFRSURSWHtQDV GH IXsión, permite que al estar ancladas en la membrana se produzca
la fusión con células vecinas, dando origen a sincicios. Ello deviene en la posibilidad de transmitir la información genética viral
a otra célula sin recurrir al habitual mecanismo de diseminación,
TXHUHTXLHUHODIRUPDFLyQ\HJUHVRGHYLULRQHVDOH[WHULRUFHOXODU
Sorprendentemente, el virus varicela-zóster se disemina entre individuos como partícula viral libre, mientras que en un organismo
determinado lo hace mediante la fusión de membranas contiguas,
sin que se formen viriones para alcanzar dicho cometido.
En años recientes, se descubrió que la polarización de los linIRFLWRV PHGLDQWH ORV ¿ODPHQWRV GH DFWLQD SHUPLWH OD WUDQVPLVLyQ
GH+7/9HQWUHGLFKDVFpOXODV/DHVWUXFWXUDUHVXOWDQWHVHGHQR-
100
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
mina sinapsis infecciosa o sinapsis virológica. A diferencia de la
que ocurre para la presentación antigénica, no requiere moléculas
de histocompatibilidad. En dicha estructura se focaliza una cantiGDGGHSDUWtFXODVSDUDKDFHUH¿FLHQWHODWUDQVPLVLyQKDFLDODFpOXOD
diana. Dicho evento ocurre también para la transmisión de los herpesvirus, así como del HIV entre OLQIRFLWRV8QHMHPSORVLQJXODU
lo constituye la sinapsis virológica entre las células dendríticas y
los OLQIRFLWRV7ORFXDOSHUPLWHVXLQIHFFLyQHQtrans. Este evento
es posible merced a la acción de lectinas tipo C como DC-SIGN y
probablemente otras, que unen la partícula del HIV y la internalizan en vesículas endocíticas, sin promover la infección de la célula
dendrítica. Mediante la "regurgitación" de las mismas al cabo de
KRUDV±GtDV\DOHQFRQWUDUVHODJSGHOHIV con el receptor CD4,
se promueve la infección de los OLQIRFLWRVTXHH[SUHVDQGLFKRPDUcador. Las CD inmaduras y maduras envían las partículas virales
a través de la vía endolisosomal hacia la sinapsis &'OLQIRFLWR7
CD4+. Subsiguientemente, hay una segunda fase de transferencia
desde las células dendríticas inmaduras mediante la síntesis viral
de novo. Los eventos de trans-infección mediados por CD han sido
WDPELpQREVHUYDGRVFRQKHUSHVYLUXVÀDYLYLUXV YLUXVGHQJXH ¿ORYLUXV eEROD \RWURV(OORVLJQL¿FDTXHHVWRVYLUXVKDQHQFRQtrado un resquicio –verdadero talón de Aquiles– en la respuesta
¿VLROyJLFDGHOKRVSHGHURSDUDPRQWDUODUHVSXHVWDLQPXQHLQLFLDO
mediante la presentación antigénica. Es posible que esta estrategia
WHQJDHVSHFLDOVLJQL¿FDGRHQDTXHOORVYLUXVTXHSURPXHYHQLQIHFFLRQHVODWHQWHVFRPRKHUSHVVLPSOH[RYDULFHOD]yVWHUHQORVTXH
la transmisión entre la célula neural y el epitelio debe realizarse a
través de uniones estrechas entre ambas estirpes celulares.
)LQDOPHQWH H[LVWHQ IDFWRUHV TXH UHVWULQJHQ OD H[SUHVLyQ GH
virus en una determinada célula. Ello no sólo puede deberse a la
DXVHQFLDGHUHFHSWRUHV\RIDFWRUHVGHWUDQVFULSFLyQ7DPELpQSXHde ocurrir el empaquetamiento de moléculas que editan el RNA
viral y que pueden actuar durante la transcripción inversa, impidiendo la síntesis de genomas "normales". Es el caso de la moléFXOD$32%(&*ODTXHKDVLGRDVRFLDGDDGLFKDUHVWULFFLyQ6LQ
embargo, virus como +,9SXHGHQVRUWHDUHVWDGL¿FXOWDGLQKLELHQGR
ODPLVPDPHGLDQWHODSURWHtQD9LI véase el ítem 6.3.1 Bases genéticas y moleculares de la virulencia 6.3. MECANISMOS DIRECTOS DE LESIÓN CELULAR
En términos generales, los efectos de la infección viral en una célula pueden ser mediados por FXDWURPHFDQLVPRV PRGL¿FDFLyQ
GHPROpFXODVFHOXODUHV DGLFLyQGHPDFURPROpFXODVHVSHFt¿cas virales a una estructura o complejo celular; 3) desarreglo o
reorganización de estructuras celulares; y/o 4) construcción de
nuevas estructuras celulares infectadas.
La lesión de la membrana celular puede ocurrir por alteración de la permeabilidad o por inducción de sincicios.
/D V FDXVD V GH alteración de la permeabilidad de las
membranas infectadas con el consiguiente aumento del sodio y
GLVPLQXFLyQGHOSRWDVLRLQWUDFHOXODUVRQGLYHUVDVHQDOJXQRVFDVRV
HOOR HVWi DVRFLDGR D OD H[SUHVLyQ GH SURWHtQDV YLUDOHV H[SUHVDGDV
HQODVXSHU¿FLHGHODFpOXOD(OHMHPSORPiVUHFRQRFLGRHVHOGHOD
proteína de matriz 0GHLQÀXHQ]D$TXHDQFOiQGRVHHQODELFDSD
OLStGLFDGHODPHPEUDQDFHOXODUIRUPDXQSRURHQHOOD viroporina IXQFLRQDQGRFRPRXQFDQDOGHSURWRQHV(QPRGRDQiORJRGLYHUsas proteínas del +,9 JSGHHQYROWXUDJSGHWUDQVPHPEUDQD9SX\9SU DIHFWDQODSHUPHDELOLGDGGHPHPEUDQDGHGLYHUVDV
HVWLUSHVFHOXODUHVIRUPDQGRDOJXQDVGHHOODVFDQDOHVGHPHPEUDQD
por otra parte Nef afecta la concentración del K intracelular sin
PRGL¿FDUHOS+LQWUDFHOXODU 7DEOD La formación de sincicios celulares se observa ante la infección
SRUGLYHUVRVYLUXVFRPRVHPHQFLRQyHQHOtWHP/DIRUPDFLyQGH
sincicios en las infecciones por virus sincicial respiratorio y paUDLQÀXHQ]DHVWiDVRFLDGDDODLQWHUDFFLyQGHODVUHVSHFWLYDVSURWHtQDV)GHIXVLyQFRQXQDSHTXHxDSURWHtQDFHOXODUFRQDFWLYLGDG
GH *73DVD GHQRPLQDGD 5KR$ TXH IDFLOLWD OD IRUPDFLyQ VLQFLFLDO
HQDVRFLDFLyQFRQODH[SUHVLyQGHODFLWRTXHUDWLQD(VWHHYHQWR
ha sido postulado como un potencial blanco terapéutico. El sincicio promovido por el virus sarampión acaece cuando el péptido de
fusión interactúa con la KHPDJOXWLQLQD + IRUPDQGR XQ FRPSOHMR
fusogénico. El mismo es el responsable de lesiones in vivo con sincicios gigantocelulares en las hepatitis y neumonitis. Los sincicios
producidos en la infección con herpes simplex son promovidos por
ODDFFLyQGHJOLFRSURWHtQDVGHHQYROWXUD J(\J, TXHLQWHUDFW~DQ
FRQ ODV PHPEUDQDV FLWRSODVPiWLFDV LQGXFLHQGR FDPELRV HQ HOODV
TXHLQGXFHQODIRUPDFLyQGHVLQFLFLRVJLJDQWHVPXOWLQXFOHDGRV FRQ
LQFOXVLRQHVLQWUDQXFOHDUHV REVHUYDGRVSRUHMHPSORHQODVOHVLRQHVPXFRFXWiQHDVDVRFLDGDV$VLPLVPRODIRUPDFLyQGHVLQFLFLRV
en las células infectadas con HCMV es principalmente debida a la
LQWHUDFFLyQ HVSHFt¿FD HQWUH OD JOLFRSURWHtQD YLUDO J% XELFDGD HQ
XQDFpOXOD \HOFRPSOHMRIRUPDGRSRUJ+J/ XELFDGRHQODFpOXOD
FRQWLJXD $GHPiVGHODLQWHUDFFLyQHQtrans antes mencionada es
imprescindible la acción de moléculas de origen celular –no idenWL¿FDGDVD~Q±TXHVHH[SUHVDUtDQHQODVXSHU¿FLHGHFLHUWDVHVWLUSHV
FHOXODUHV(VWR~OWLPRH[SOLFDUtDHOKHFKRGHTXH+&09QRSURGXce sincicios en todos los tipos celulares que infecta. HIV induce la
formación de sincicios a través de sus glicoproteínas de envoltura
JS\JS/DIRUPDFLyQGHsincicios por HIV en células in
vitro se utiliza como marcador pronóstico de infección, ya que
aquellas cepas virales formadoras de sincicios se aíslan predomiQDQWHPHQWHHQSDFLHQWHVFRQXQDUiSLGDSURJUHVLyQclínica y en estadios tardíos de la infección. Por el contrario, no es frecuente la
GHWHFFLyQGHHVWHHIHFWRFLWRSiWLFRin vivo. No obstante, se ha reportado el hallazgo de células grandes multinucleadas con detección
LQWUDFLWRSODVPiWLFDGHSHQOHVLRQHVOLQIRHSLWHOLDOHVGHODJOiQGXOD
SDUyWLGD\HQWHMLGROLQIRLGHRKLSHUSOiVLFRGHODQLOORGH:DOGH\HUGH
pacientes con serología positiva para HIV.
La formación de estas células grandes multinucleadas in vivo
permite el transporte intercelular de la progenie evitando la eventual acción de los anticuerpos neutralizantes, siendo éste un meFDQLVPRPiVGHHYDVLyQDODUHVSXHVWDLQPXQHXWLOL]DGRSRUHVWRV
virus.
El FLWRHVTXHOHWR FXHQWD FRQ WUHV VLVWHPDV SULQFLSDOHV TXH
FRQWURODQHOWUi¿FRGHPROpFXODVD HOGH¿ODPHQWRVGHDFWLQD
E HOGHPLFURW~EXORV\F HOGH¿ODPHQWRVLQWHUPHGLRV SURYHHQ
HVWDELOLGDGPHFiQLFDDODFpOXOD /DVSURWHtQDVPRWRUDVGHWUDQVporte llevan las diversas cargas a través de las "calles" de actina
\ODVDXWRSLVWDVGHPLFURW~EXORV'DGDODFRQJHVWLyQGHOWUi¿FR
FLWRVyOLFR PJPO£HTXLYDOHQWHHQYLVFRVLGDGDODDUHQDK~PHGD HVWHVLVWHPDHVFUtWLFRSDUDP~OWLSOHVSURFHVRV¿VLROyJLFRV\
es usufructuado por múltiples virus. Algunos de ellos promueven
DOWHUDFLRQHV VREUH HO FLWRHVTXHOHWR FHOXODU \D VHD PHGLDQWH GHVSROLPHUL]DFLyQGHORV¿ODPHQWRVSRUGLVPLQXFLyQGHOFRQWHQLGR
GHDFWLQDHQORVPLVPRV FRPRRFXUUHFRQKHUSHVVLPSOH[ LQcorporación de componentes del citoesqueleto en estructuras celuODUHVLQIHFWDGDV SRUHMHPSORFLHUWRVUHRYLUXV R LQWHUDFFLyQGH
PROpFXODVYLUDOHV\FRPSRQHQWHVGHOFLWRHVTXHOHWR FRPRRFXUUH
SRUHMHPSORFRQ+,9DOLQWHUDFWXDUFRQORV¿ODPHQWRVGHDFWLQDDO
ingresar o egresar de la célula, y al secuestrar las moléculas motoras dineína y quinesina del sistema de microtúbulos, para el transporte de "larga distancia" de los componentes virales que entran y
VDOHQGHODFpOXOD Los cuerpos de inclusión desplazan componentes celulares de
OXJDUHV HVSHFt¿FRV DOWHUDQGR VX QRUPDO DFWLYLGDG (VWRV FXHUSRV
IUHFXHQWHPHQWH FRQVLVWHQ HQ IiEULFDV GH SURGXFFLyQ YLUDO FRQWHniendo genoma y proteínas virales, así como partículas incompletas y/o viriones y membranas neoformadas. Estos cuerpos se
YLVXDOL]DQSRUHMHPSORHQODLQIHFFLyQSRUUDELD FRUS~VFXORVGH
1HJUL>YpDVHOD¿[email protected] +&09 LQWUDQXFOHDUHV
\RFDVLRQDOPHQWHFLWRSODVPiWLFRV>¿[email protected] KHSDWLWLV& FXHUSRVDFLGy¿ORVFLWRSODVPiWLFRV HWF$OJXQRVYLUXV
a RNA como los reovirus, reemplazan la utilización de membranas
FHOXODUHVSRUODIRUPDFLyQGHFXHUSRVGHLQFOXVLyQ HQHVWHFDVRGHQRPLQDGRVYLURVRPDV SDUDIRFDOL]DUHOFRPSOHMRUHSOLFDWLYRYLUDO
Diversos virus producen daño celular a través de la inhibición de
la síntesis de macromoléculas del hospedero: entre ellos pueden
101
Capítulo 5 / Patogenia de las infecciones virales
Proteínas
Localización
Función
Regulatorias
Tat
Principalmente en el núcleo
(VWLPXODODWUDQVFULSFLyQXQLpQGRVHDODVHFXHQFLD7$5SDUD
SURPRYHUHOLQLFLR\ODHODERUDFLyQGHO51$YLUDO
Rev
Principalmente en el núcleo
5HJXODODSURGXFFLyQGH51$PYLUDODOXQLUVHDODUHJLyQ55(
IDFLOLWDODH[SRUWDFLyQQXFOHDUGHWUDQVFULSWRVGH51$PYLUDO
sin corte y empalme (splicing RFRQXQ~QLFRVLWLRGHsplicing,
SHUPLWLHQGRODVtQWHVLVGHODVSURWHtQDVHVWUXFWXUDOHV
Nef
&LWRSODVPD\PHPEUDQDFLWRSODVPiWLFD
Virión
3RWHQFLDODLQIHFWLYLGDGGHOYLULyQ3XHGHDXPHQWDURGLVPLQXLUOD
UHSOLFDFLyQYLUDOLQKLEHODDSRSWRVLVGHFpOXODVCD4+ infectadas,
\ODSURPXHYHHQlinfocitos CD8+ TXHORVUHFRQRFHQUHGXFH
ODH[SUHVLyQGH&'\&'HQODVXSHU¿FLHFHOXODULQKLEHOD
H[SUHVLyQGHPROpFXODV+/$SULQFLSDOHV $%& \HVWLPXOD
ODGHPROpFXODV+/$(ORTXHDOWHUDHOUHFRQRFLPLHQWRSRUORV
linfocitos T CD8+ y las 1.UHVSHFWLYDPHQWH
Vif
Citoplasma
$XPHQWDODLQIHFWLYLGDGGHOYLULyQDQWDJRQLVWDGHODFLWLGLQD
GHVDPLQDVDFHOXODUDQWLYLUDO$32%(&*DIHFWDHOHQVDPEODMH
GHOYLULyQ\RODVtQWHVLVGH'1$YLUDO
Vpr
Virión
'HWLHQHHOFLFORFHOXODUHQ*IDFLOLWDHOLQJUHVRGHOFRPSOHMRGH
SUHLQWHJUDFLyQDOQ~FOHR
9SX
3URWHtQDLQWHJUDOGHPHPEUDQD
SHULQXFOHDU
0RGXODODOLEHUDFLyQYLUDOIRUPDQGRFDQDOHVLyQLFRVGH
PHPEUDQDLQWHUDFW~DFRQ&'HQHO5(LPSLGLHQGRVX
H[SUHVLyQHQVXSHU¿FLH\SURPRYLHQGRVXGHJUDGDFLyQ
SURWHDVyPLFDGLVUXPSHODLQWHUDFFLyQ&'JOLFRSURWHtQDGH
HQYROWXUD
Vpx
Virión
)DFLOLWDHOLQJUHVRGHOFRPSOHMRGHSUHLQWHJUDFLyQDOQ~FOHR
favorece el escape de la restricción proteasoma-dependiente en
FpOXODVGHQGUtWLFDV
Accesorias
Tabla 5.4. Proteínas auxiliares del HIV.
mencionarse los picornavirus, herpesvirus y SR[YLUXV(QRWURVFDsos, la acumulación selectiva de componentes subvirales posee
un efecto tóxico, tal cual se ha demostrado con proteínas de la
FiSVLGHGHadenovirus.
Los eventos moleculares relacionados con la lesión celular
SRUHIHFWRYLUDOGLUHFWRHVWiQYLQFXODGRVDinteracciones con los
procesos celulares de transcripción, traducción, replicación
del DNA y de maduración de proteínas. En ciertos casos, la inhibición temprana de la síntesis proteica produce alteraciones en
la replicación del DNA celular, pues ello requiere de proteínas de
vida media corta. A su vez, esto altera la función de dicho DNA
como templado para el RNA celular. Como consecuencia, se sintetiza cada vez menos RNAm de la célula hospedera y cesa el aporte de nuevos ribosomas. Sin embargo, la inhibición de la síntesis
proteica obedece a causas no totalmente determinadas, ya que la
disminución de proteínas celulares neoformadas precede a la disminución del RNAm celular. Se ha postulado un mecanismo que
impediría que el RNAm celular localizado en el citoplasma sea
WUDGXFLGR(QUHODFLyQFRQHOORH[LVWHQHYLGHQFLDVTXHVXJHULUtDQ
TXHORVFDPELRVGHSHUPHDELOLGDGGHODPHPEUDQDLQKLEHQPiVOD
traducción de RNAm de la célula hospedera que la de los RNAm
virales. En etapas tardías, la simple acumulación de RNAm virales
alcanza tal magnitud que la competencia con los RNAm celulares
determina el cese de la síntesis proteica celular.
Diversos virus causan alteraciones en los cromosomas celulares. Ello fue inicialmente atribuido a la acción de enzimas lisoVRPDOHV OLEHUDGDV HQ HVWDGLRV ¿QDOHV GH FpOXODV PRULEXQGDV 6LQ
embargo, el DNA puede también fragmentarse como consecuencia
del disparo de eventos apoptóticos, que a través de la activación de
ODFDVSDVDSURPXHYHQODWUDQVIRUPDFLyQ±PHGLDQWHFOLYDMHSURteolítico– de una DNAsa inactiva al estado activo, lo que genera la
fragmentación internucleosómica. Los cuerpos apoptóticos son
FDSWDGRV OXHJR SRU FpOXODV GH HVWLUSH PDFURIiJLFD OR TXH SXHGH
facilitar la diseminación viral a otras regiones del organismo. A su
vez, se han observado translocaciones cromosómicas en ciertos
tumores asociados a virus que pueden indicar el sitio de inserción
del proto-oncogén celular. Así, en el linfoma de Burkitt asociado
al EBV, el oncogén c-myc puede ser translocado frecuentemente
GHVGH HO FURPRVRPD KDFLD HO ORFXV GH OD FDGHQD SHVDGD + GH
LQPXQRJOREXOLQDV XELFDGR HQ HO FURPRVRPD W 'LFKR
evento de translocación es mediado por la proteína celular AID
Activation Induced cytidine Deaminase DO IRUPDU ORV FRUWHV HQ
el DNA bicatenario, tanto del gen de Ig como del oncogén a transORFDU8QHYHQWRGHWUDQVORFDFLyQW HQHOFURPRVRPDVH
observa también en los linfomas No-Hodgkin asociados a la infección persistente por +&9 YpDVHOD¿JXUDHQHOFDStWXOR
En otros casos, la integración del genoma viral puede asociarse a la activación de genes críticos en la oncogénesis: tal es el
caso del genoma a DNA de HBV y de HPV al integrarse en regiones
UHJXODWRULDV FUtWLFDV GHO JHQ FRGL¿FDQWH GH OD ULERQXFOHRSURWHtQD
WHORPHUDVD K7(57 human Telomerase Reverse Transcriptase involucrada en la inmortalización celular, evento imprescindible
para la tumorigénesis. Sin embargo, estudios muy recientes documentaron que no sólo los virus a RNA con transcriptasa inversa
FRPRORVretrovirus +,9R+7/9 pueden integrarse al DNA celular como provirus, sino también pueden hacerlo virus a RNA
no retrovirales, como se observó con el RNA del virus LCM, que
luego de la recombinación ilegítima con el DNA de un retrotransposón denominado ,$3 Intracisternal A Particle SURPRYLy OD
síntesis del DNA complementario del RNA viral, el que se integró
en el genoma celular dentro de un elemento IAP. Este inesperado
hallazgo ha derribado otro dogma de la biología.
<DVHKDPHQFLRQDGRTXHODLQIHFFLyQYLUDOGHXQDFpOXODQR
causa necesariamente su lisis. Así, diversos arenavirus y el HBV
VRQHMHPSORVFOiVLFRVGHYLUXVQRFLWRSiWLFRVin vivo HOHBV no es
102
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
E6
E7
p53
Rb
Inhibición de la
apoptosis
Prosecución del
ciclo celular
Figura 5.25. Principales efectos de las proteínas no estructurales tempranas E6 y E7 de genotipos de alto riesgo oncogénico
del virus papiloma humano. /RVWLSRV\VRQORVPiVIUHFXHQWHPHQWHDVRFLDGRVDWXPRUHVJHQLWDOHV(LQKLEHODapoptosis
FHOXODUPHGLDQWHODLQDFWLYDFLyQSURWHDVyPLFDGHS(SURPXHYHHOSDVDMH*ĺ0GHOFLFORFHOXODUDOVHFXHVWUDUD5EORTXHOLEHUDDO
IDFWRUGHWUDQVFULSFLyQ()QHFHVDULRSDUDGLFKRHYHQWR
FLWRSiWLFRHQLQGLYLGXRVLQPXQRFRPSHWHQWHV En general, los viUXVQRFLWROtWLFRVTXHSURGXFHQHQIHUPHGDGORKDFHQPHGLDQWH
mecanismos inmuno-mediados véase el ítem 6.4 6LQHPEDUJR
DVRPEURVDPHQWHHQODLQIHFFLyQH[SHULPHQWDOGHUDWRQHVODFWDQWHV
con el arenavirus LCM, si bien la producción de la progenie viral
no causa la muerte celular, pueden producirse también alteraciones de algunas funciones "de lujo" celular, como la inhibición
parcial de la síntesis de hormona de crecimiento en células hiSR¿VDULDV, lo que deviene en una menor tiempo de sobrevida de
los ratones infectados. Este efecto resulta de la actividad de una
glicoproteína de envoltura viral que se asocia al tropismo de LCM
por el epitelio glandular, y de la nucleoproteína viral que inhibe la
síntesis de RNAm de la hormona.
Algunos virus como HBV o HPV pueden luego de décadas de
infección persistente, promover también la oncogénesis por meFDQLVPRVTXHLQFOX\HQODLQDFWLYDFLyQGHSURWHtQDVFRGL¿FDGDV
por genes supresores de tumores (como p53 o Rb). Desempeñan
un rol crítico en dicha inactivación las proteínas X del HBV y las
SURWHtQDVWHPSUDQDV(\(GHOHPV.
Como resultado de la infección persistente por HPV, pueden ocurrir lesiones benignas hiperplásicas papilomatosas, o
eventualmente (con la adición de cofactores inherentes al hospedero) desarrollarse lesiones malignas([LVWHQHWDSDVHQHO
GHVDUUROORWXPRUDOD ODLQIHFFLyQLQLFLDOGHOHSLWHOLRPHWDSOiVLFR
HQOD]RQDGHWUDQVLFLyQGHORVHSLWHOLRV ]RQDGHtransformación
FHUYLFDO E ODSHUVLVWHQFLDYLUDOF ODSURJUHVLyQGHORVHSLWHOLRV
SHUVLVWHQWHPHQWH LQIHFWDGRV KDFLD OHVLRQHV SUHFDQFHURVDV \ G OD
invasión a través de la membrana basal del epitelio. Las infeccioQHV SUHFDQFHURVDV VH HVWDEOHFHQ DO FDER GH DxRV HQ PHQRV
GHOGHODVLQIHFFLRQHVQXHYDV(OFiQFHULQYDVRUSXHGHRFXUULU
luego de muchos años, y aun décadas en una minoría de las muMHUHV FRQ OHVLRQHV SUHFDQFHURVDV DOUHGHGRU GH ORV DxRV GH
edad, como consecuencia de la actividad de las proteínas virales
no estructurales (\(TXHSURPXHYHQODLQDFWLYDFLyQGHODV
proteínas supresoras de tumores p53 y Rb (retinoblastoma)
UHVSHFWLYDPHQWH )LJXUD \GHFDPELRVHSLJHQpWLFRVTXH
silencian la transcripción génica mediante la metilación del
DNA viral y celular en sitios ricos en los dinucleótidos CpG.
Otros virus a DNA pueden también asociarse a tumores, tales
como el ya mencionado linfoma de Burkitt, el carcinoma nasofaUtQJHRRHOOLQIRPDLQPXQREOiVWLFR (%9 RHOsarcoma de Kaposi
++9 7DPELpQ VH SXHGHQ DVRFLDU D OD JpQHVLV GH WXPRUHV DO
menos dos virus a RNA, como se observa en un número muy limitado del total de infecciones por el UHWURYLUXV+7/9 OHXFHPLD
7 GHO DGXOWR \ HQ XQ VLJQL¿FDWLYR SRUFHQWDMH GH ODV LQIHFFLRQHV
FUyQLFDVSRUHOYLUXVKHSDWLWLV& carcinoma hepatocelular y cierWRVOLQIRPDV% 6HKDREVHUYDGRTXHHOEBV, el HBV y el HCV
también inducen la inestabilidad cromosómica en los tumores
respectivamente generados, mediante la formación de radicales libres en la célula infectada. En el caso del (%9ODSURWHtQD(%1$
habitualmente presente en todos los tumores asociados a este virus
SRUHMHPSORHOOLQIRPDGH%XUNLWWHOcarcinoma nasofaríngeo o el
OLQIRPDGH+RGJNLQ SURPXHYHHQORVlinfocitos un aumento de la
H[SUHVLyQGHODVXEXQLGDGFDWDOtWLFD1R[GHODHQ]LPD1$'3+
R[LJHQDVDTXHSURGXFHHVSHFLHVUHDFWLYDVGHR[tJHQR 526 (VWDV
ROS causan aberraciones cromosómicas, formación de cortes en el
DNA bicatenario celular y participación de la respuesta de daño al
'1$ )LJXUD 'LFKRGDxRHVVHPHMDQWHDOSURGXFLGRSRUORV
oncogenes celulares c-Myc y Ras que promueven una replicación
aberrante, mediante el aumento del número de replicones activos
y/o por la alteración de la progresión de la horquilla de replicación
GHO'1$/RV526R[LGDQWDPELpQDSURWHtQDV\OtSLGRVDWUDYpV
de los cuales afectan una plétora de vías de señalización entre las
que se incluyen el crecimiento celular, la diferenciación y la apoptosis.
Esta sucinta enumeración de algunos mecanismos de lesión celular muestra el YDULDGR HVSHFWUR GH SDWRJHQLFLGDG TXH GLVWLQWRV
virus pueden ejercer sobre una célula ú órgano determinados.
Ello también ocurre al transpolar dichos efectos al hospedero.
Cabe subrayar, sin embargo, que la patogenicidad in vitro de los virus
no se corresponde inequívocamente con la observada in vivo. Así por
HMHPSORHOYLUXVUDELDQRSURGXFHHIHFWRFLWRSiWLFRHQFXOWLYRVPLHQtras que resulta casi siempre letal in vivo. Por el contrario, muchos
VHURWLSRVGHYLUXV(&+2LQGXFHQHIHFWRFLWRSiWLFRQRWRULRHQGLYHUVDV
Capítulo 5 / Patogenia de las infecciones virales
103
EBV
EBNA-1
Activación de la
subunidad catalítica
Nox 2 de la NADPH
oxigenasa leucocitaria
Generación
de ROS
Respuesta al daño
del DNA celular
Daño oxidativo
del DNA celular
Inestabilidad cromosómica
Tumores asociados a EBV
Figura 5.26. Inestabilidad cromosómica celular promovida por el virus Epstein-Barr. /DSURWHtQD(%1$LQGXFHODDFWLYDFLyQWUDQVFULSFLRQDOGHODVXEXQLGDG1R[GHOD1$'3+R[LJHQDVDOHXFRFLWDULDORFXDOVHDVRFLDDODIRUPDFLyQGHHVSHFLHVUHDFWLYDVGHR[tJHQR
526 \DODUHVSXHVWDDOGDxRGHO'1$FHOXODU&RPRFRQVHFXHQFLDVHSURGXFHODLQHVWDELOLGDGFURPRVyPLFDDVRFLDGDDUXSWXUDVGHO'1$
ELFDWHQDULR\IRUPDFLyQGHFURPRVRPDVGLFpQWULFRV
líneas celulares pero no causan habitualmente lesiones in vivo. El efecto patogénico del virus polio en motoneuronas del asta anterior de la
médula espinal –mediante la inhibición de la maquinaria biosintética
celular– se traduce en la destrucción de las mismas con el consiguiente
impedimento funcional de los músculos inervados polio paralítiFD $VXYH]ORVrinovirus producen la muerte de células del epitelio nasal y del tracto respiratorio inferior lo cual favorece en un
territorio susceptible, la sobreinfección bacteriana. El virus rubéola
puede infectar células embrionarias humanas sin causarles daño aparente, aunque su velocidad de crecimiento puede estar alterada, lo cual
podría inducir un retardo en la morfogénesis y el crecimiento de
diversos órganos. Ciertos rotavirus atípicos son causales de gastroenteritis asociadas a la formación de sincicios gigantes en el epitelio de
las vellosidades intestinales.
Hasta aquí se han descripto algunos mecanismos directos de
lesión celular. Sin embargo, diferentes cepas de un mismo virus
pueden producir en el hospedero un grado diverso de lesión. Ello
depende de determinantes moleculares y genéticos de virulencia
de cada virus.
6.3.1. Bases moleculares y genéticas de la virulencia
&RQHOH[WUDRUGLQDULRDYDQFHGHODVWpFQLFDVGHELRORJtDPROHFXODU
\HOFRQVLJXLHQWHDQiOLVLVGHVHFXHQFLDVJHQyPLFDVYLUDOHVKDVLGR
posible en algunos casos establecer las bases de la virulencia de
FLHUWRVYLUXV 7DEOD (OOHFWRUHVUHIHULGRDORVFDStWXORVHVSHFt¿FRVSDUDXQDYLVLyQPiVJOREDOGHORVHMHPSORVTXHVHLQFOX\HQ
a continuación, así como de los que aquí no se mencionan.
Polio. Al compararse la secuencia nucleotídica de la cepa
parental virulenta de SROLR 3/HyQ FRQ XQD GHULYDGD YDFXQDO6DELQ3Db y una tercera cepa que había revertido a la
YLUXOHQFLDVHREVHUYDURQVyORQXFOHyWLGRVGLIHUHQWHV6HSXGR
determinar que la neurovirulencia de la cepa parental, así como
la de aquella que revirtiera a la virulencia estaba asociada a la
SUHVHQFLDGHFLWRVLQD & HQODSRVLFLyQHQHOH[WUHPR¶GHO
51$ ±UHJLyQ QR FRGL¿FDGRUD GH SURWHtQDV± HQ FRQWUDSRVLFLyQ
FRQHOXUDFLOR 8 REVHUYDGRHQODFHSDYDFXQDO )LJXUD 6H
SRVWXODTXHHOPHFDQLVPRSRUHOFXDOXQDUHJLyQQRFRGL¿FDGRUD
de proteínas induce la neurovirulencia, estaría asociado a dicha
PRGL¿FDFLyQGHODVHFXHQFLDQXFOHRWtGLFDODTXHSRGUtDSURPRver una alteración en la estructura secundaria del RNA viral, que
–a su vez– afectaría su procesamiento posterior con factores celulares iniciadores de la traducción. La presencia de U en lugar
de C en la cepa vacunal Sabin altera la interacción de la región
JHQyPLFDDG\DFHQWHFRQODSURWHtQD37% Polypyrimidine Tract
Binding protein GLVPLQX\HQGRODH¿FLHQFLDGHWUDGXFFLyQGHOD
poliproteína viral en cepas atenuadas, lo cual limitaría la producción viral. Se han descripto otras regiones importantes para la
QHXURYLUXOHQFLD GH ORV VHURWLSRV GH SROLR OD SRVLFLyQ HQ
HOH[WUHPR¶GHODUHJLyQQRFRGL¿FDGRUDGHOVHURWLSRODVHFXHQFLDFRGL¿FDGRUDGHORVDPLQRiFLGRVGHODSURWHtQDGH
ODFiSVLGH93HQHOVHURWLSR\ODSRVLFLyQGHODUHJLyQ
FRGL¿FDGRUDGHODSURWHtQD93HQHOVHURWLSR
Junín. 'H PDQHUD DQiORJD D ORV HVWXGLRV UHDOL]DGRV FRQ OD
vacuna Sabin para polio, investigadores argentinos del grupo de
Víctor Romanowski han comparado la secuencia nucleotídica del
fragmento genómico L de las cepas virulentas de Junín XJ44 y
;-FRQODFHSDYDFXQDODWHQXDGD&DQGLGXWLOL]DGDSDUDSUHvenir la )LHEUH KHPRUUiJLFD DUJHQWLQD $O DQDOL]DU OD VHFXHQFLD
DPLQRDFtGLFD GH ODV SURWHtQDV FRGL¿FDGDV HQ HO IUDJPHQWR / VH
GRFXPHQWDURQmutaciones puntuales en la proteína L caracteUtVWLFDVGHODFHSDYDFXQDO3RUHOFRQWUDULRHORWURJHQFRGL¿FDGR
HQHVWHIUDJPHQWR = VHPDQWXYRFRQVHUYDGRHQWUHWRGDVODVFHSDV
DQDOL]DGDV(VWRSHUPLWHKLSRWHWL]DUTXHHVRVFDPELRVGHDPLQRiFLGRVSRGUtDQHVWDUDVRFLDGRVDOIHQRWLSRDWHQXDGR8QHVWXGLR
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
104
VIRUS
FACTOR
EFECTO
Polio
0XWDFLyQ8&HQODUHJLyQ¶87
1HXURYLUXOHQFLD
Junín
12 cambios de aminoácidos en la proteína L
$WHQXDFLyQHQODFHSDYDFXQDO&DQGLG
Rabia
Arg333 o Lys333 en el sitio antigénico III de la glicoproteína
G
9LUXOHQFLD
Dengue
9DULDQWHVQRFDUDFWHUL]DGDVPROHFXODUPHQWHGH16
&RQWULEXFLyQDODXPHQWRHQODSHUPHDELOLGDG
YDVFXODUĺ)LHEUHKHPRUUiJLFD\FKRTXHSRU
GHQJXH
HBV
0XWDFLRQHV$7\*$HQHO3URPRWRU%iVLFRGHO
&RUH 3%&
Asociado a KHSDWLWLVFUyQLFDDFWLYD\DPD\RU
ULHVJRGHGHVDUUROODU+&&HQORVgenotipos A-D
,QÀXHQ]D
6HULHGHDPLQRiFLGRVEiVLFRV $UJ HQHOVLWLRGHFOLYDMHGH
la KHPDJOXWLQLQDSRUSURWHDVDVFHOXODUHV
3HUPLWHODUHSOLFDFLyQYLUDOHQWHMLGRVSRUIXHUDGHO
WUDFWRUHVSLUDWRULRĺ(QIHUPHGDGPiVJUDYH
Rotavirus
8QLyQGH163DXQUHFHSWRUFHOXODU
(QWHURWR[LQDYLUDOĺ'LDUUHDVHFUHWRULD
Coxsackie B
Proteasa 2A
&OLYDMHGHODGLVWUR¿QDHQPLRFDUGLRFLWRVĺ
miocardiopatía dilatada
Ébola
93FRQ5HQSRVLFLyQGHOGRPLQLRGHXQLyQD,5)
,QKLEH,5)ĺH[WUHPDYLUXOHQFLD
(90% de mortalidad)
7DEOD)DFWRUHVDVRFLDGRVDODPRGL¿FDFLyQGHODYLUXOHQFLDYLUDODOJXQRVHMHPSORV
VHPHMDQWHFRQHOIUDJPHQWR6GHODFHSD&DQGLGSHUPLWLyPDSHDU
las mutaciones de esta cepa vacunal respecto a otras en las regiones
FRGL¿FDQWHVGHODVJOLFRSURWHtQDVGHHQYROWXUD\ODnucleoproteína
GHODFiSVLGHKDELpQGRVHUHSRUWDGRTXHFDPELRVDPLQRDFtGLFRV
HQODJOLFRSURWHtQD*\HQODnucleoproteína N resultan respecWLYDPHQWHHQODSpUGLGDGH\JLURVȕGHODHVWUXFWXUDVHFXQGDULD
HQ OiPLQD SOHJDGD H[KLELGD SRU RWUDV FHSDV SRU OR TXH WDPELpQ
podrían ser considerados marcadores de atenuación.
Rabia. (QHVWHFDVRODSUHVHQFLDGHORVDPLQRiFLGRVEiVLFRV
DUJLQLQDROLVLQDHQODSRVLFLyQGHOVLWLRDQWLJpQLFR,,,HQODJOLcopropteína G se asocia a la virulencia, mientras que su sustitución
SRURWURVDPLQRiFLGRVSURGXFHYDULDQWHVDWHQXDGDV6HGHVFRQRFH
el mecanismo de dicha atenuación aunque se ha postulado una diVHPLQDFLyQ \ SHQHWUDFLyQ DO 61& PiV OHQWD DO QR SRGHU LQYDGLU
FLHUWDV¿EUDVQHUYLRVDV$VLPLVPRHOUHHPSOD]RHQODIRVIRSURWHtQD3YLUDOGHOVLWLRGHXQLyQDODFDGHQDOLYLDQDGHGLQHtQD /&
XQDPROpFXODLQYROXFUDGDHQHYHQWRVGHPRWLOLGDGLQWUDFHOXODU SRtencia la atenuación antes mencionada.
HTLV./DH[SUHVLyQJHQyPLFDGHORVretrovirus es regulada por
HOHPHQWRVXELFDGRVHQODUHJLyQ¶WHUPLQDO Long Terminal Repeat
R/75 (OYLUXVGHODOHXFHPLD7KXPDQD +7/9 DOLJXDOTXH
otros miembros del género Deltaretrovirus +7/9 +7/9 \
+7/9 FRGL¿FDHQORVJHQHVtax y rex proteínas no estructurales
regulatorias que actúan en trans: las proteínas homónimas 7D[\
5H[/DSURWHtQDTax regula la transcripción genómica mientras
5H[SURPXHYHHOSURFHVDPLHQWR\H[SRUWDFLyQQXFOHDUGHO51$YLUDOHYHQWRTXHHVLPSHGLGRSRUODSURWHtQDYLUDOS £XQYHUGDGHUR
<LQ<DQJYLUDO ([LVWHQHYLGHQFLDVTXHDVRFLDQDTax con el iniFLRGHHYHQWRVTXHSURPXHYHQHOGHVDUUROORGHODOHXFHPLD7GHO
adultoDVtFRPRDODSDUDSDUHVLDHVSiVWLFDWURSLFDO(VWDSURWHtQD
VHXQHDRWUDV RDVXVSUHFXUVRUHV TXHWLHQHQFDSDFLGDGGHXQLyQ
DUHJLRQHVGHO'1$SRWHQFLDGRUDVGHODWUDQVFULSFLyQ enhancers activando así la transcripción de diversos genes celulares. Por el
contrario, 7D[ WUDQVVXSULPH OD H[SUHVLyQ GH OD '1$SROLPHUDVD
beta, asociada al proceso de reparación del DNA.
Dado que 7D[HVXQLPSRUWDQWHEODQFRGHODUHVSXHVWDLQPXQH
VXH[SUHVLyQQRHVVLJQL¿FDWLYDHQHWDSDVWDUGtDVGHODLQIHFFLyQ
FRPRRFXUUHHQSDFLHQWHVFRQOHXFHPLD7GHODGXOWRKDELpQGRVH
HVWDEOHFLGRTXHRWUDSURWHtQD FRGL¿FDGDHQODFDGHQDFRPSOHPHQWDULD GHO '1$ SURYLUDO GH +7/9 GHQRPLQDGD HBZ HTLV-1
Basic leucine Zipper HVWiDVRFLDGDDODmantención de la leucemia (Figura 5.28). HBZ es estimulada por 7D[DXQTXHHOHIHFWR
es dependiente del sitio de integración proviral. A su vez, HBZ
LQKLEH HO HIHFWR WUDQVDFWLYGRU TXH HMHUFH Tax sobre los genes
virales. Tax es una proteína que puede interactuar con una miríada
de proteínas celulares, para lo cual posee múltiples sitios con una
estructura intrínsecamente desordenada. Ello permite a la proteína adoptar diferentes conformaciones, actuando cada subregión
de la misma como módulos independientes, interactuando con distintas proteínas según la localización subcelular.
7D[LQWHUDFW~DFRQXQDVHULHGHFRPSRQHQWHVGHYDULDVYtDVGH
VHxDOL]DFLyQFHOXODU 0$3TXLQDVDV-1.SURWHtQDV*$3HWF Entre los múltiples procesos promovidos por 7D[VHGHVWDFDQORV
VLJXLHQWHV ODDFWLYDFLyQ\SUROLIHUDFLyQFHOXODU SRUDXPHQWRGH
la actividad –entre muchos factores– de 1)ț% TXHSRUHMHPSOR
SURPXHYHODH[SUHVLyQGH,/H,/ \()DVtFRPRGHODTXLQDVD3,.\GLVPLQXFLyQGHODGHODIRVIDWDVDVXSUHVRUDGHWXPRUHV
37(1>Phosphatase and Tensin homolog deleted on chromosome
10] ODLQKLELFLyQGHODDSRSWRVLV LQKLELHQGRDODVSURWHtQDV
SURDSRSWyWLFDVS\%D[\HVWLPXODQGRDODVDQWLDSRSWyWLFDV
Bcl-XL, ,$3>Inhibitor Apoptotic Protein VXUYLYLQD\)/,3>FLICE Inhibitory Protein) LQKLELGRUDVGHODDSRSWRVLV \GHJHQHV
VXSUHVRUHVGHWXPRUHV 7*)ȕS\37(1 ODLQHVWDELOLGDG
FURPRVyPLFD DVRFLDGDDODXPHQWRGH3&1$>Proliferating Cell
Nuclear Antigen]\DODFRQVLJXLHQWHLQKLELFLyQ DDOWDVFRQFHQtraciones de 7D[ GHOVLVWHPDGHUHSDUDFLyQGHO'1$PHGLDGRSRU
1(5>Nucleotide Excision Repair], así como a la translocación
DOFLWRVROGHODSURWHtQD0$' (Mitotic Arrest DH¿FLHQF\ ODLQPRUWDOL]DFLyQFHOXODU PHGLDQWHHODXPHQWRGHODVXEXQLGDG
catalítica de la WUDQVFULSWDVDLQYHUVDFHOXODUWHORPHUDVDRK7(57
Capítulo 5 / Patogenia de las infecciones virales
105
A
C C
C
A
B
A C
500
A
G
G
490
C
U
A
C
G
C
G
A
C
A
G
C
510
G(1) A(2)
C (C)
U
514
G
480
U
G
U(3) vacuna
A A
C
U
C C A UG G A
G
C
U
G
G
U
G
C
C
U
470
C G C
A
G
(b)
A
A U G
A
530
520
C
A
(a)
A
G
C GC
A
C
G
G
A
C
C
)LJXUD(VTXHPDSUHGLFWLYRGHODHVWUXFWXUDVHFXQGDULDGHOGRPLQLR9 QXFOHyWLGRVD GHODUHJLyQ¶QRFRGL¿FDQWH
del poliovirus tipo 3 (cepa P3/Leon) y su relación con la neurovirulencia y la atenuación viral. A.5HJLyQ¶QRFRGL¿FDQWHGHO51$
YLUDOVHLQGLFDFRQHOyYDORURMRHOGRPLQLR9HOTXHVHREVHUYDFRQPD\RUGHWDOOHHQODLPDJHQB./DÀHFKDLQGLFDHOVLWLRGHODSRVLFLyQ
FUtWLFDSDUDODDWHQXDFLyQRYLUXOHQFLDGHOVHURWLSRC./DVÀHFKDVPXHVWUDQODORFDOL]DFLyQGHODVPXWDFLRQHVDVRFLDGDVDODDWHQXDFLyQ
de los serotipos 1, 2 y 3 de la YDFXQD6DEtQDFODUDGRHQWUHSDUpQWHVLV/DPHUDVXVWLWXFLyQGH&[8HQODSRVLFLyQGHOVHURWLSRVH
DVRFLDDODDWHQXDFLyQ6LQHPEDUJRODUHYHUVLyQDODYLUXOHQFLDSXHGHRFXUULU UHHPSOD]RGH8[& 'LFKRLQIUHFXHQWHHYHQWRVHDVRFLDD
los casos de SROLRSDUDOtWLFDREVHUYDGRVHQDSUR[LPDGDPHQWHGHFDGDPLOORQHVGHLQGLYLGXRVYDFXQDGRVFRQODYDFXQD6DEtQ'HELGRD
GLIHUHQFLDVHQODVVHFXHQFLDVODEDVHRFXUUHHQHOUHVLGXRGHODVHFXHQFLDGH6DEtQPLHQWUDVTXHODFRPSUHQGHHOUHVLGXR
GHODVHFXHQFLDGHVHURWLSRGH6DEtQ/DVUHJLRQHVFRQDSDUHDPLHQWRGHEDVHVVHGHVLJQDQFRPRDE\F'H0DFDGDP$-et al.
J Virol 5HSURGXFLGRFRQDXWRUL]DFLyQ
human Telomerase Reverse Transcriptase HOUHDUUHJORGHOFLWRHVTXHOHWR SRUVREUHH[SUHVLyQGHODTXLQDVD3,.HLQKLELFLyQGH
OD V IRVIDWDVD V 37(1\R6+,3>Src Homology 2 domain containing Inositol polyphosphate [email protected] ORFXDOJHQHUDODOREXlación nuclear característica de los /7GHORVSDFLHQWHVFRQOHXFHPLD
7GHODGXOWR ODDQJLRJpQHVLV DVRFLDGDDODXPHQWRSODVPiWLFR
GH9(*) Vascular Endothelial Growth Factor \DODDFWLYLGDG
GH003>Matrix Metallo [email protected] que mediante su actividad de gelatinasa disrumpe la membrana
EDVDOHQGRWHOLDOSHUPLWLHQGRODH[WUDYDVDFLyQGH/7LQIHFWDGRVD
ORVWHMLGRVGLDQD ODLQYDVLyQDOWHMLGRyVHR SRUDXPHQWRGHOD
DFWLYLGDGGH5$1./>Receptor Activated NFțB Ligand TXH
promueve la diferenciación de células progenitoras a osteoclastos,
lo que promueve la reabsorción ósea y la consiguiente hipercalcemia. Otros eventos en los que 7D[HVWiGLUHFWDPHQWHLQYROXFUDGD
VRQODPLJUDFLyQFHOXODU LQWHUDFWXDQGRFRQSHTXHxDV*73DVDVGHO
FLWRHVTXHOHWR \ODIRUPDFLyQGHODVLQDSVLVYLUROyJLFD
7D[WUDQVDFWLYDODWUDQVFULSFLyQGHOJHQRPDGH+7/9DFWXDQGR VREUH OD UHJLyQ /75 \ HV LPSUHVFLQGLEOH SDUD OD UHSOLFDFLyQ
)LJXUD ,QLFLDOPHQWH7D[OLEHUDDOJHQRPDGHODDFWLYLGDGGH
proteínas represoras de la transcripción, como la histona deacetilaVD +'$& \RODKLVWRQDPHWLODVD +07 DOLQWHUDFWXDUFRQ
ellas. Para esta transactivación viral se requiere un enhancer comSXHVWRSRUWUHVVHFXHQFLDVGHSEUHSHWLGDV(VWDVHFXHQFLDFRQWLHQHXQHOHPHQWRGHUHVSXHVWDDOF$03 cAMP Response Element
R&5( ODTXHMXQWRDRWUDUHJLyQFRQWLJXDFRUULHQWHDUULEDSHUmite la transactivación del genoma proviral.
Entre los genes celulares transactivados se encuentran el de la
FDGHQDĮGHOUHFHSWRUSDUD,/ ,/UĮ \HOGHODFDGHQDKRPynima del receptor para ,/ ,/UĮ HOGHODVFLWRTXLQDV,/
,/H,/HOIDFWRUGHFUHFLPLHQWRWXPRUDOȕ 7*)ȕ ORVRQ-
cogenes c-fos y c-erg, y el factor estimulador para la formación de
FRORQLDVGHJUDQXORFLWRVPDFUyIDJRV *0&6) /DH[SUHVLyQGH
PROpFXODV+/$,HVWiDXPHQWDGDSRU7D[HQFpOXODVJOLDOHVSHURQR
en OLQIRFLWRV7GRQGH±SRUHOFRQWUDULR±RWUDSURWHtQDYLUDO S LQKLEHVXH[SUHVLyQHQODPHPEUDQDFLWRSODVPiWLFD$QiORJDPHQWH
al requerimiento del enhancerGHSESDUDWUDQVDFWLYDUODWUDQVFULSFLyQGHOJHQRPDGHO+7/9VHQHFHVLWDODVHFXHQFLDenhancerDODTXHVHXQHHOIDFWRUWUDQVFULSFLRQDO1)N% Nuclear Factor
kappa B SDUD WUDQVDFWLYDU ORV JHQHV FRGL¿FDQWHV GH ,/ ,/U
Į ,/ ,/U Į7*)ȕ *0&6) \ HO HOHPHQWRGH UHVSXHVWD
65( Serum Responsive Element SDUD ORV RQFRJHQHV c-fos y cerg(OIDFWRU1)N%HV±DVXYH]±DFWLYDGRSRU7D[DOSURPRYHU
VXOLEHUDFLyQGHOFRPSOHMRIRUPDGRSRUGLFKRIDFWRUFRQODSURWHtQD,N% TXHORPDQWLHQHVHFXHVWUDGRHQHOFLWRSODVPD PHGLDQWH
OD IRVIRULODFLyQ GH pVWD SRU OD TXLQDVD ,.. IkB Kinase OD TXH
FRQVWLWXWLYDPHQWHHVDFWLYDGDHQODVFpOXODVLQIHFWDGDVSRU+7/9
SRU7$. T*)ȕActivator Kinase 7D[QRVyORDFWLYD7$.
VLQRWDPELpQSURPXHYHHOUHFOXWDPLHQWRGH,N.KDFLD7$.SDUD
favorecer su interacción.
$ODUHJLyQJHQyPLFDSURYLUDOGHQWURGHO/75TXHFRQWLHQHHO
elemento de respuesta CRE se pueden unir diversas proteínas de
ODIDPLOLD&5(%$7)(QWUHHOODVVHHQFXHQWUDQODSURWHtQD&5(%
cAMP Response Element Binding &5(0 cAMP Response
Element Modulator $7) Activating Transcription Factor HWF
(VWDVSURWHtQDVWLHQHQODSRVLELOLGDGGHXQLUVHVLPXOWiQHDPHQWHDO
DNA y a otras proteínas. Ello es posible merced a poseer tanto
XQ GRPLQLR EiVLFR GH XQLyQ DO JHQRPD FHOXODU HQ IRUPD GH KRPRGtPHURVRKHWHURGtPHURVGHPRGRDQiORJRDOGHXQFLHUUHtipo
FUHPDOOHUD PHGLDGR SRU HVWUXFWXUDV GH OHXFLQD leucine zipper
structures \RWURFRQHOTXHSXHGHQIRUPDUXQFRPSOHMRFRQ7D[
8QDYH]HVWDELOL]DGRVORVFRPSOHMRVVREUHHOSURPRWRUXELFDGRHQ
106
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
Inicia la
leucemia
Tax
Ĺ$FWLYDFLyQ\
SUROLIHUDFLyQ
FHOXODU
Ĺ1)K%\()
Ĺ3,.Ļ37(1
Ļ$SRSWRVLV
ĻS\%D[
Ĺ,$3%FO;/
6XUYLYLQD\)/,3
Ļ3URWHtQDV
VXSUHVRUDV
GHWXPRUHV
Ļ7)*BS
\37(1
Ĺ,QHVWDELOLGDG
FURPRVyPLFD
Ĺ3&1$ĺĻ1(5
Translocación de
0$'DOFLWRVRO
,QPRUWDOL]DFLyQ
ĹK7(57
5HDUUHJORGHO
FLWRHVTXHOHWR
Ĺ3,.
Ļ37(1\R6+,3
Ĺ$QJLRJpQHVLV
Ĺ9(*)\
003
Ĺ,QYDVLyQ
yVHD
Ĺ5$1./\
0&6)
Ĺ+%=
Mantiene la
leucemia
Figura 5.28. Efectos generales promovidos por la proteína Tax de HTLV-1. 0~OWLSOHVYtDVGHVHxDOL]DFLyQUHJXODGDVSRU7D[ ÀHFKDV
QHJUDV SURPXHYHQ OD OHXFHPRJpQHVLV \ OD LQYDVLyQ WXPRUDO GH RWURV WHMLGRV FRPR HO yVHR7D[ HVWLPXOD WDPELpQ OD H[SUHVLyQ GH +%=
FRGL¿FDGDHQODKHEUDFRPSOHPHQWDULDGHO'1$SURYLUDOÀHFKDYHUGH SDUDPDQWHQHUODOHXFHPLD+%=LQKLEHODDFWLYLGDGGH7D[ ÀHFKD
URMD 6HLQGLFDHORULJHQGHDOJXQDVDEUHYLDWXUDVSURYHQLHQWHVGHOLQJOpV NFNB: Nuclear Factor N B PI3-K: Phosphatidyl Inositol 3 Kinase;
PTEN: Phosphatase and TenVLQKRPRORJGHOHWHGRQFKURPRVRPH; BaxBcl-2 Associated X proteinBcl-XL: B cell lymphoma-extra
Large IAP: Inhibitor Apoptotic Protein FLIP: FLICE Inhibitory Protein) TGF-ȕ: Tumor Growth Factor PCNA Proliferating Cell Nuclear
Antigen; NER: Nucleotide Excision RepairMAD-1: Mitotic Arrest DH¿FLHQF\-1; hTERT: human Telomerase Reverse Transcriptase SHIP:
Src Homology 2 domain containing Inositol polyphosphate Phosphatase; VEGF: Vascular Endothelial Growth Factor; MMP9: Matrix Metallo
Proteinase; RANKL-1:Receptor Activated NFNB Ligand (véase la explicación en el texto HO /75 SURYLUDO 7D[ DWUDH IDFWRUHV TXH PRGL¿FDQ ODV KLVWRQDV \
remodelan la cromatina. Esto permite la interacción genómica con
factores de transcripción del aparato basal, que se unen a la región
7$7$GHQWURGHO/75'LFKRFRPSOHMRVHHVWDELOL]DWRWDOPHQWHPHdiante la interacción de 7D[FRQORVIDFWRUHV7),,$7),,'\7%3
T$7$ Binding Protein 8QDYH]IRUPDGRHOFRPSOHMRLQLFLDOFRmienza la transcripción. Para continuar con la fase de elongación,
HV QHFHVDULD OD IRVIRULODFLyQ GHO GRPLQLR FDUER[tOLFR GH OD RNA
SROLPHUDVD ,, HYHQWR HMHFXWDGR DO UHFOXWDU7D[ DO IDFWRU 37()E
3Transcription Elongation Factor b /D LQWHUDFFLyQ HQWUH
7D[ FRQ PLHPEURV GHO FRPSOHMR 6:,61) Switch/Sucrose Non
Fermentable HYLWDODGHWHQFLyQGHODHORQJDFLyQWUDQVFULSFLRQDODO
permitir el acceso de diversos factores transcripcionales al DNA.
(OH[WUHPRFDUER[tOLFRGHODSURWHtQD7D[FRQWLHQHXQFRQJORPHUDGRGHDPLQRiFLGRViFLGRVFX\DGHOHFLyQVHDVRFLDDVXLQDFWLYDFLyQIXQFLRQDO(VWHGRPLQLRDFtGLFRVHDVHPHMDIXQFLRQDOPHQWH
–aunque no es idéntico– al activador de enhancers93 TransInducing FactorĮRĮ7,) GHORVKHUSHVYLUXV
En síntesis, 7D[DFWLYDLQGLUHFWDPHQWHODH[SUHVLyQGHGLYHUVRV
genes virales y celulares.
HIV. No se conocen con precisión las bases moleculares que
se correlacionen con variantes en la patogenicidad del virus HIV.
Durante la fase aguda de la infección, ocurre una masiva depleción
de la población de OLQIRFLWRV7CD4+ &&+ de memoria ubicados
HQ HO WHMLGR OLQIRLGH DVRFLDGR D OD PXFRVD LQWHVWLQDO OR TXH FRQduce a un importante e irreversible daño funcional de la respuesta inmune mediada por la población de CD4+. La emergencia de
XQDSRWHQWHSHUR¿QDOPHQWHLQH¿FD]inmunidad humoral y celular
anti-HIV, conduce a la fase crónica, caracterizada por un control
sólo parcial de la replicación viral, activación celular persistente y
merma progresiva del pool de OLQIRFLWRV7naïve y de memoria, así
como depleción de los OLQIRFLWRV7CD4+ circulantes.
En común con otros retrovirus, +,9SRVHHJHQHVTXHFRGL¿FDQ
el core gag OD WUDQVFULSWDVD LQYHUVD SURWHDVD H LQWHJUDVD pol \ OD HQYROWXUD env +,9 DGHPiV SRVHH XQD VHULH GH JHQHV TXH
FRGL¿FDQSURWHtQDVDX[LOLDUHVUHJXODWRULDV 7DW\5HY \DFFHVRULDV
1HI9LI9SU9SX>SDUD+,[email protected]\9S[>SDUD+,[email protected] FX\DORFDOL]DFLyQSULQFLSDOHVIXQFLRQHV\VLJQL¿FDGRGHVXVGHQRPLQDFLRQHV
VHLQGLFDQHQOD7DEOD 6yORVHKDUipQIDVLVDTXtHQORVDVSHFWRV
PiVUHOHYDQWHVGHDOJXQDVGHHOODV\HQHOSDSHOFUXFLDOGH1HI\
Vif en la patogénesis.
/D DFWLYLGDG GH 7DW \ 5HY HV HVHQFLDO SDUD OD UHSOLFDFLyQ (O
'1$SURYLUDOFRQWLHQHHQVXVH[WUHPRVVHFXHQFLDVUHSHWLGDVODUJDV
/75 R Long Terminal Repeats TXH IXQFLRQDQ FRPR SURPRWRUHV
GH XQ EDMR QLYHO EDVDO GH OD WUDQVFULSFLyQ (Q HO LTR existen sitios para la unión de múltiples factores de transcripción celular,
como 1)ț%6XOLEHUDFLyQGHVGHHOFLWRSODVPDHQODVFpOXODVDFWLYDGDV GLVRFLiQGRVHGHVXLQKLELGRU,ț% SXHGHH[SOLFDUODQHFHVLGDG
de dicha activación para la replicación del HIV. Tat transactiva la
WUDQVFULSFLyQXQLpQGRVHDVHFXHQFLDVHVSHFt¿FDVGHO51$YLUDO
denominadas TAR )LJXUD 'LFKDXQLyQSHUPLWHXQDPD\RU
procesividad de la RNA polimerasa II celular y por ende sintetizar
los RNAm de tamaño completo en lugar de moléculas corresponGLHQWHVDHYHQWRVGHWUDQVFULSFLyQWUXQFDGD/DH[SUHVLyQGH7DWHQ
UDWRQHVWUDQVJpQLFRVLQGXFHOHVLRQHVVHPHMDQWHVDODVREVHUYDGDVHQ
el sarcoma de Kaposi, una lesión tumoral inducida por el ++9
en pacientes con 6,'$FX\RJHQRPDHVWUDQVDFWLYDGRSRU7DW(VWD
proteína SXHGH LQKLELU OD PDTXLQDULD HQ]LPiWLFD GH VtQWHVLV GH
microRNAs PL51$V FHOXODUHVDVtFRPRODGH51$VLOHQFLDGRUHV
YLUDOHVFRQSRODULGDGRSXHVWDDORVPHQVDMHURVGHOHIV denominados
+$$ HIV Antisense initiator AQWLVHQVH51$ JHQHUDGRVDSDUWLUGH
XQHOHPHQWRSURPRWRU+,9D,15 HIV antisense Initiator SUHVHQWHHQODFDGHQDVHQWLGRGHO'1$SURYLUDOHQDPERV/75V'LFKRV
PL51$VVL51$VYLUDOHVSXHGHQUHJXODUODH[SUHVLyQGHORV51$P
YLUDOHVPHGLDQWHODH[DFWDFRPSOHPHQWDULHGDGGHVXVEDVHVFRQHO
FRPLHQ]R\DO¿QDOGHODVHFXHQFLDGHGLFKRVPHQVDMHURV3RUHQGH
107
Capítulo 5 / Patogenia de las infecciones virales
)DVHGHH[SDQVLyQFORQDO
de LT infectados
1. Fase replicativa viral
Productos
oncogénicos
Ĺ)DFWRUHV
de transcripción,
ĹK7(57
Citoquinas
Ĺ,/
,/H,/
Ĺ*0&6)
Ļ7*)ȕ
Proteínas
de superficie
Ĺ,/UĮH
,/UĮ
HTLV-1
pro
5’
LTR
g
a
g
rex
p
o
l
e
n
v
t
a
x
3’
LTR
DNA celular
HBZ
Tax
Figura 5.29. Efectos promovidos por la proteína 7D[GH+7/9 (QXQDSULPHUDHWDSDGHSURPRFLyQGHODUHSOLFDFLyQYLUDOODSURWHtQD
7D[WUDQVDFWLYDJHQHVYLUDOHVXQLpQGRVHDOSRWHQFLDGRU enhancer GHODWUDQVFULSFLyQXELFDGRGHQWURGHO/75SURYLUDO(QXQGHORV
LQGLYLGXRVFRQLQIHFFLyQSHUVLVWHQWHSRU+7/9VHSURGXFHODSUROLIHUDFLyQFORQDOGHORVlinfocitos T (/7 LQIHFWDGRV7D[SURPXHYHODH[SUHVLyQGHFLHUWRVJHQHVFHOXODUHVSURRQFRJpQLFRV LQKLELHQGRODGHDTXHOORVTXHLQKLEHQODtransformación, como TGF-ß), de FLWRTXLQDV
DVtFRPRGHVXEXQLGDGHVGHVXVUHFHSWRUHV/RVSURPRWRUHVGHDOJXQRVGHHVWRVJHQHVSRVHHQVLWLRVSRWHQFLDGRUHVGHODWUDQVFULSFLyQ
GRQGHVHXQHHOIDFWRU1)ț% enhancer 1)ț% \RWURVH[KLEHQODVHFXHQFLD65( Serum Responsive Element 7D[IRUPDKHWHURGtPHURV
FRQODVXEXQLGDGSGH1)ț%\SURPXHYHODH[SUHVLyQGHORVJHQHVTXHSRVHHQODVHFXHQFLDGH'1$GHOSRWHQFLDGRUKRPyQLPR$WUDYpV
de las FLWRTXLQDVLQGLFDGDV\VXVUHVSHFWLYRVUHFHSWRUHVH[SUHVDGRVHQVXSHU¿FLHVHSURPXHYHODSUROLIHUDFLyQFHOXODU(OFLUFXLWR,/
,/ULQGXFHXQDXPHQWRGHODH[SUHVLyQGHODVXEXQLGDGFDWDOtWLFDGHODWUDQVFULSWDVDLQYHUVDFHOXODUWHORPHUDVD K7(57 QHFHVDULDSDUD
ODLQPRUWDOL]DFLyQFHOXODU
ORVPL51$VVRQVHFXHQFLDVGH51$QRFRGL¿FDQWHVTXHUHJXODQ
la expresión génica. 'HORH[SXHVWRVHLQ¿HUHTXHTat afecta no
VyORDTXHOORVPL51$VTXHREUDQFRPRPHFDQLVPRFHOXODUGHdeIHQVDHVSHFt¿FRFRQWUDHIV, sino el entorno global de los mismos
en la célula infectada.
/DVSURWHtQDVUHJXODWRULDV7DW\5HY\ODDFFHVRULD1HIVRQVLQtetizadas inicialmente en la infección celular, mediante RNAs que
H[KLEHQ HYHQWRV GH FRUWH \ HPSDOPH splicing 5HY UHFRQRFH
una región del RNA correspondiente al gen env, denominada RRE
RNA responsive element TXH IDYRUHFH OD H[SRUWDFLyQ QXFOHDU GH
ORV51$VTXHWLHQHQGLFKDVHFXHQFLD HQXQDKHEUDHORQJDGDLQLFLDOPHQWHJUDFLDVD7DW\VLQWLHPSRVX¿FLHQWHSDUDTXHDFW~HWRWDOPHQWHODPDTXLQDULDGHFRUWH\HPSDOPHFHOXODU ORTXHSURPXHYH
la síntesis de la totalidad de las proteínas del +,9 )LJXUD Nef es un factor viral necesario para la total virulencia del
HIV, ORTXHUHVXOWDQHIDVWRSDUDHOKRVSHGHUR6XH[SUHVLyQLPSXOVDDOPHQRVDFFLRQHVFUtWLFDVHQODpatogénesis: 1) promueve la inWHUQDOL]DFLyQ\GHJUDGDFLyQGH&'HQODVXSHU¿FLHFHOXODUSRU
la vía endosomal/lisosómica; 2) inhibe selectivamente el transporte a la membrana celular de ciertas moléculas del CMH-I
+/$$PiVTXH%SHURQRGHRWUDVFRPR+/$&\( ORFXDO
afecta el reconocimiento de las células infectadas con HIV por
linfocitos T CD8+ citotóxicos, así como por células NK; 3) inhibe
la expresión de HLA-II y de receptores para TXLPLRTXLQDV HQ
ODVXSHU¿FLHFHOXODU SURPXHYHODDFWLYDFLyQFHOXODUPHGLDQWHODLQWHUDFFLyQFRQODTXLQDVD3DN p21 activated kinase ; 5)
aumenta la infectividad del HIV; y 6) inhibe la apoptosis de los
LT CD4+ infectados promovida por Fas o 71)Į DWUDYpVGHOD
vía Ask-1-dependiente) y promueve la de los linfocitos CD8+TXH
los reconocen (mediante la vía Fas/FasL, al aumentar la expresión de estas últimas en los CD4+), pero la promueve en dichas
células mediante el aumento de expresión de PD-1 )LJXUD /RH[SXHVWRGHYLHQHHQXQDDOWHUDFLyQVLJQL¿FDWLYDGHODUHVSXHVWD
inmune adaptativa.
/DUHPRFLyQGHPROpFXODV&'GHODVXSHU¿FLHFHOXODUHVSRsible merced a que Nef una vez miristilado se ancla en la memEUDQD SODVPiWLFD \ SURPXHYH OD GLVRFLDFLyQ GH SLCK WDPELpQ
GHQRPLQDGD/&. GHOFRPSOHMRIRUPDGRHQWUHpVWD\ODFRODFLWRSODVPiWLFDGH&'$OXQLUVHDODSURWHtQDDGDSWDGRUD$31HI
también promueve un incremento en la formación de fositas de
clatrina, dentro de las cuales se internaliza CD4, para iniciar su
endocitosis y subsiguiente degradación lisosómica. La regulación
QHJDWLYDTXH1HIHMHUFHVREUHODVPROpFXODV&'HVLQGHSHQGLHQWH
de su capacidad para incrementar la infectividad del HIV e inhibir
ODH[SUHVLyQGHFLHUWDVPROpFXODVGHO&0+HQODVXSHU¿FLHFHOXODU
Esta inhibición de la expresión de ciertas moléculas CMH-I se
produce mediante una aceleración de la endocitosis de las misPDV\XQUHWDUGRHQHOUHFLFODGRKDFLDODVXSHU¿FLHEl primer
HYHQWRHVWiPHGLDGRSRUODLQLFLDOLQWHUDFFLyQHQWUH1HI\ODSURWHtQD FHOXODU 3$&6 Phosphofurin Acidic Cluster Sorting protein 2) que al ser desplazada a la red del trans-Golgi, produce una
cadena de eventos de fosforilación disparados por un miembro de
la familia de las srcTXLQDVDV WLURVLQDTXLQDVDV GHQRPLQDGR6).
TXHSURPXHYHODIRVIRULODFLyQGH=DS6\N\FRQVLJXLHQWHPHQWH
ODXQLyQGHpVWDFRQOD)RVIDWLGLOLQRVLWROTXLQDVD 3,. ORFXDO
incrementa el nivel de PIP y estimula la actividad del factor de
LQWHUFDPELRQXFOHRWtGLFRGHJXDQRVLQD$512\ODFDUJDGH*73
HQ OD PROpFXOD$5) ADP-Ribosylation Factor 6 (O retardo
del reciclado de moléculas del CMH-IKDFLDODVXSHU¿FLHFHOXODU
involucraría la formación de un complejo ternario entre la molécula del CMH-I, Nef (como puente facilitador) y la proteína
celular AP1, lo cual relocaliza a la primera en la región perinuclear. Sin embargo, la inhibición de &0+,QRHVWRWDOPHQWHH¿FD]
\DTXHHOKRVSHGHURPRQWDXQDUHVSXHVWDLQPXQHFLWRWy[LFDFRQWUD
108
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
Núcleo
RRE
RRE
TAR
DNA
celular
5’
LTR
g
a
g
p
o
L
r
v
t e
v
l
a v
p
f
t
r
v
p
u
miRNAs /
siRNAs
e
n
v
r
t
e
a
v
t
n
e
f
3’
LTR
miRNAs /
siRNAs
HAP
Rev
Tat
Citoplasma
Dicer
siRNAs
celulares
Figura 5.30. Esquema del genoma proviral del HIV y efectos de las proteínas regulatorias Tat y Rev. Los diversos genes virales están
ÀDQTXHDGRVSRUUHJLRQHVUHSHWLWLYDVODUJDV ¶\¶/75V TXHSRVHHQVHFXHQFLDVQHFHVDULDVSDUDODLQLFLDFLyQ SURPRWRUHV \WHUPLQDFLyQ
WUDQVFULSFLRQDO(O¶/75HVUHFRQRFLGRSRUODPDTXLQDULDFHOXODU\DTXHSRVHHVLWLRVGHXQLyQSDUDGLYHUVRVIDFWRUHVGHWUDQVFULSFLyQ
FHOXODU FRPRODVUHJLRQHVJHQyPLFDVSRWHQFLDGRUDV>[email protected])ț%6SHWF DXQTXHH[KLEHXQEDMRQLYHOGHDFWLYLGDGSURPRWRUD
/DGLIHUHQWHGLVSRVLFLyQYHUWLFDOGHORVJHQHVLQGLFDVXFRUUHVSRQGHQFLDFRQFDGDXQRGHORVWUHVPDUFRVGHOHFWXUDXELFDGRVHQXQDPLVPD
FDGHQD/DVSURWHtQDV7DW\5HY DOLJXDOTXH1HI VHVLQWHWL]DQFRPRUHVXOWDGRGHHYHQWRVGHFRUWH\HPSDOPH splicing 7DWUHFRQRFH
\VHXQHDXQDVHFXHQFLDGH51$ 7$5Trans-Activating Response element TXHIRUPDXQDSURWXEHUDQFLDFRQDVSHFWRGHDVDUXORXELFDGDLQPHGLDWDPHQWHFRUULHQWHDEDMRGHOVLWLRGHLQLFLRGHODWUDQVFULSFLyQ(QDXVHQFLDGH7DWVHSURGXFHXQDWUDQVFULSFLyQDERUWLYD6X
SUHVHQFLDLQFUHPHQWDODSURFHVLYLGDG\IDFLOLWDODHORQJDFLyQGHO51$$OVLQWHWL]DUVHHO51$tQWHJURVHDOFDQ]DDSURGXFLUXQDVHFXHQFLD
de reconocimiento para REV, denominada RRE (Rev Responsive Element PHUFHGDORFXDOVHSURGXFHODH[SRUWDFLyQQXFOHDUGHO51$
VLQWHWL]DGR5HYFRQWUDUUHVWDHOHIHFWRVXSUHVRUGHODH[SRUWDFLyQDVRFLDGRDVHFXHQFLDVGHVHVWDELOL]DGRUDVULFDVHQ$8SUHVHQWHVHQ
las regiones genómicas gag y pol(QODPLVPDUHJLyQGHO'1$SURYLUDOTXHFRGL¿FD7$5 ODVXEUHJLyQUHSHWLGD5 \KDVWDODVXEUHJLyQ8
(Untranslated ¶ GHQWURGHO/75SHURHQVHQWLGRRSXHVWRH[LVWHXQHOHPHQWRSURPRWRULQLFLDGRUWUDQVFULSFLRQDODQWLVHQWLGR HQLQJOpVHIV
antisense initiator o HIVaINR) del que deriva un RNA antisentido (HIVaINR antisense RNA DSDUWLUGHOFXDOVHFRGL¿FD Q OD V SURWHtQD V +$3 HIV Antisense Protein (O51$VLQWHWL]DGRSXHGHRSHUDUWDPELpQFRPRXQSUHFXUVRUGHPL51$VVL51$VYLUDOHVFRPSOHPHQWDULRVD
ODVSULPHUDVEDVHVGHO51$YLUDO FRQSRODULGDGVHQWLGR UHJXODQGRVXH[SUHVLyQ7$7SXHGHVXSULPLURLQDFWLYDU SRULQWHUDFFLyQGLUHFWD OD
actividad de los RNA silenciadores de la propia expresión de los genes del +,9\WDPELpQUHJXODUODSURGXFFLyQGHDOJXQRVVL51$VFHOXODUHV
\SRWHQFLDOPHQWHYLUDOHV DOLQKLELUDOD51$VD,,,FHOXODU'LFHUTXHORVJHQHUDHQHOFLWRSODVPD
HIV, aunque la misma no logra limitar la infección. La activación
FHOXODUSRU1HIHVWiDVRFLDGDDODXQLyQ\DFWLYDFLyQGHODTXLnasa PAKTXHIRVIRULODODSURWHtQDUHJXODWRULDGHOFLWRHVTXHOHWR
0(5/,1 Moesin-Ezrin-Radixin-Like Protein HQFDUJDGDGHXQLU
a la actina con las glicoproteínas de la membrana celular. El aumento de la infectividad promovido por NefHVWiDVRFLDGRDWUHV
SRWHQFLDOHVDFFLRQHVD LQKLELUODEDUUHUDGHDFWLQDTXHLPSLGH
el ingreso viralE HYLWDUTXHODVFiSVLGHVque entran a la célula
sean degradadas en el proteasoma; c) inhibir una proteína ceOXODU D~Q QR FDUDFWHUL]DGD TXH LQWHU¿HUH FRQ OD LQWHUDFFLyQ
entre la envoltura viral y la molécula CD4, impidiendo su producción celular e incorporación al virión.
/DH[SUHVLyQGHVifHVWiFUtWLFDPHQWHYLQFXODGDDODinfectividad del HIV, ya que su ausencia deviene en la generación de partíFXODVGHIHFWXRVDVFRQP~OWLSOHVFiSVLGHV6Xacción principalHVWi
mediada por la inhibición de la proteína celular APOBEC3G
Apolipoprotein B mRNA-Editing Catalytic polypeptide 3G XQD
FLWLGLQDGHVDPLQDVDTXHH[SHULPHQWDOPHQWHSXHGHFRQYHUWLUFpOXlas permisivas para HIV en no permisivas. $32%(&*WUDQVIRUPD
residuos de dC en dU del DNA del +,9HQXQFRQWH[WRGHGLQXcleótidos dCdC, con un gradiente decreciente de actividad desde el
H[WUHPR¶DO¶GHODKHEUD )LJXUD (VWDVmutaciones tornan
defectuoso el molde para la síntesis del RNA genómico, pues en
OXJDU GH LQFRUSRUDUVH D pVWH XQ UHVLGXR * OR KDUi XQD$ UHGXciendo la DSWLWXGUHSOLFDWLYD ¿WQHVV GHOJHQRPD$32%(&*HV
activa al unirse a hebras de DNA monocatenario, aunque también
puede unirse al RNA monocatenario, sin activarse. Esto último es
importante pues $32%(&*QRVyORSURPXHYHODKLSHUPXWDFLyQ
de la cadena negativa de DNA sintetizada, sino que también –en
ausencia de Vif– es incorporada al virión, al unirse al RNA viral.
$32%(&*WDPELpQWLHQHDFWLYLGDGDQWLYLUDOLQGHSHQGLHQWHGHVX
actividad como desaminasa. Vif promueve su inhibición tanto al
inducir su degradación proteasómica luego de atraer al compleMR ( XELTXLWLQDOLJDVD Cullina-5/elongina B/elongina C/Rbx1 como también por mecanismos independientes del proteasoma.
HBV. La transcripción del RNA pregenómico del HBV es controlada por el promotor del core, el cual consiste en un promotor
EiVLFRGHOcore %&3 \GRVHOHPHQWRVUHJXODWRULRVXQRSRVLWLYR
5(>@ \RWURQHJDWLYR 5(>@ (O%&3FRQWLHQHHOVLWLRGHXQLyQ
principal para una variedad de factores de transcripción incluido el
IDFWRUQXFOHDUKHSDWRFLWDULR +1) \HOIDFWRUGHWUDQVFULSFLyQ
GHXQRGHORVSURPRWRUHVGHODDOE~PLQDGHSROOR &2837) Las mutaciones más frecuentemente detectadas en el BCP son
A1762T y G1764AODVFXDOHVUHGXFHQODXQLyQGHO&2837)DO
109
Capítulo 5 / Patogenia de las infecciones virales
CMH-I
CMH-I
CMH-I
(C y E)
(A y B)
A, B, C y E
CD4
CD8
CMH-I
1
2
E.T.
Fas
FasL
3
6
Fas
4
Fas
Ask-
1
5
7
PD1
8
Apoptosis del LT
CD8+ no infectado
(vía Fas)
Apoptosis del LT CD4+
infectado (vía PD1)
e inhibición de la señal
mediada por Fas
Figura 5.31. Efectos de la proteína Nef del HIV./DPLULVWLODFLyQGH1HISURPXHYHODUHPRFLyQGHPROpFXODV&'GHODVXSHU¿FLHFHOXODU
7DPELpQLQKLEHODSUHVHQWDFLyQGHDOJXQDVPROpFXODVGHKLVWRFRPSDWLELOLGDGGHFODVH, $\HQPHQRUPHGLGD%SHURQR&QL( \,,HQOD
PHPEUDQDSODVPiWLFD1HIWDPELpQDXPHQWDODLQIHFWLYLGDGGHO+,9\SURPXHYHODDFWLYDFLyQGHORVlinfocitos T CD4+0HGLDQWHODLQWHUDFción Fas/)DV/LQGXFHODapoptosis de los LT CD8+TXHUHFRQRFHQDORVCD4+LQIHFWDGRV
dC
dC
C
dU
dU
Vif
C
E3
ubiquitina-ligasa
Proteasoma
APOBEC 3G
Figura 5.32Inhibición de la ciditina desaminasa celular APOBEC3G por la proteína Vif del HIV. $32%(&*VHXQHDO'1$SURYLUDO
PRQRFDWHQDULRSURPRYLHQGRODVXVWLWXFLyQG&SRUG8ORTXHKDUiTXHHO51$YLUDOOXHJRVLQWHWL]DGRLQFRUSRUHXQD$HQOXJDUGHXQD* KLSHUPXWDFLyQ*ĺ$ DIHFWDQGRVXIXQFLRQDOLGDG7DPELpQSXHGHXQLUVHDO51$PRQRFDWHQDULRYLUDOLQFRUSRUiQGRVHDOYLULyQ9LISURPXHYH
ODLQKLELFLyQGH$32%(&*SRUPHFDQLVPRVGHSHQGLHQWHVHLQGHSHQGLHQWHVGHVXGHJUDGDFLyQHQHOSURWHDVRPD
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
110
NS1
Acs. antiNS1 preexistentes
Acs. antiNS1 preexistentes
C
C
Activación
del C
NS1
Activación
del C
Derrame
plasmático
H-S
Derrame
plasmático
C-SE
Mimetismo
molecular
Apoptosis
ROS- y RNSdependiente
Dengue
Endotelio
capilar
Figura 5.33. Participación de la proteína no estructural 1 (NS1) del virus dengue en el derrame plasmático observado en casos
graves de la enfermedad homónima.(OFKRTXH\OD¿HEUHKHPRUUiJLFDSRUGHQJXHHVWiQSDUFLDOPHQWHSURPRYLGRVSRUODDFWLYDFLyQGHO
VLVWHPD&RPSOHPHQWR & /DIRUPDFLyQGHLQPXQRFRPSOHMRV 16\DQWLFXHUSRV>[email protected]¿FRVSUHH[LVWHQWHVSRUXQDLQIHFFLyQDQWHULRU HQFLUFXODFLyQRVREUHODVXSHU¿FLHHQGRWHOLDODFWLYDODFDVFDGDGHOVLVWHPDFRPSOHPHQWRDXPHQWDQGRODSHUPHDELOLGDGFDSLODU'HELGR
DOPLPHWLVPRPROHFXODUORVDQWLFXHUSRVDQWL16WDPELpQUHFRQRFHQDQWtJHQRVH[SXHVWRVHQODVXSHU¿FLHGHODVFpOXODVHQGRWHOLDOHVOR
TXHGHVHQFDGHQDPHFDQLVPRVDSRSWyWLFRVFRQSDUWLFLSDFLyQGHHVSHFLHVUHDFWLYDVGHR[tJHQR 526 \QLWUyJHQR 516 +6KHSDUiQ
VXOIDWR&6(FRQGURLWtQVXOIDWR(
BCP y generan un nuevo sitio de unión para el factor de transFULSFLyQHVSHFt¿FRGHOKtJDGR+1). Estos cambios en la unión a
factores de transcripción probablemente sean la causa de la disminución en los niveles de RNAm de pre-core y en la síntesis de HBe
Ag observada en estudios de transfección in vitro con variantes que
poseían estas dos mutaciones. Algunos autores postulan un aumento en la replicación debido a estas mutaciones, ya que –contrariamente a lo que ocurre con las mutantes e- WDPELpQGHQRPLQDGDV
e minus ±ODVmutaciones A1762T y G1764AVRQPiVIUHFXHQWHV
en pacientes con hepatitis crónica activa antes y después de la seroconversión +%H$Jĺanticuerpos anti-HBe. Estas mutaciones,
HVWiQasociadas a un peor curso evolutivo de la infección en pacientes infectados con ciertos genotipos (A, B, C y D) del HBV
véase el Capítulo 24.3 La proteína X del +%9 +%[ VHFRPSRUWDFRPRXQWUDQVDFtivador de la transcripción de genes virales y celulares, a la vez
que modula el Ca++ citosólico, promueve la actividad del factor
WUDQVFULSFLRQDO67$7DFHOHUDHOSDVRSRUORVSXQWRVGHFKHTXHR
GHOFLFORFHOXODU\HVWLPXODODDFWLYLGDGGHODWHORPHUDVD ULERQXFOHRSURWHtQDDVRFLDGDDODLQPRUWDOL]DFLyQ HYHQWRVTXHSURPXHYHQODWXPRULJpQHVLV(QUDWRQHVWUDQVJpQLFRVODVRODH[SUHVLyQGH
+%[SURGXFHHOhepatocarcinoma. A su vez –y como consecuencia
del solapamiento del BCP y del gen x– las PXWDFLRQHV$7
\ *$ VH WUDGXFHQ HQ FDPELRV DPLQRDFtGLFRV HQ OD SURWHtQD
+%[+%[PXWDGDXQHH¿FD]PHQWHD+1)in vivo, aumentando la
XQLyQDO'1$\HOHIHFWRWUDQVDFWLYDGRUGHHVWHIDFWRUMXVWL¿FDQGR
que aquellos pacientes con infección crónica por una cepa de HBV
que presenta estas mutaciones tienen un mayor riesgo de desarrollar hepatocarcinoma celular.
/DSURWHtQD+%[VDOYDMHVHFRPSRUWDFRPRXQWUDQVDFWLYDGRU
de la transcripción para genes no sólo del HBV, sino también de
otros virus como HIV, sobre el que también promueve un aumento
de la replicación. En este caso, su acción transactivadora sobre el
SURPRWRUXELFDGRHQHO/75SURYLUDOGHOHIV es sinergística con
ODSURWHtQDWUDQVDFWLYDGRUD7DWGHpVWHORTXHSRGUtDFRQWULEXLUD
XQDSURJUHVLyQPiVUiSLGDDOSIDA en los pacientes coinfectados
con HIV-HBV.
Dengue./DJOLFRSURWHtQDQRHVWUXFWXUDO 16 GHHVWHYLUXV
es un factor importante tanto en la replicación del genoma viral
como en la alta virulencia de este agente. Se la puede encontrar
tanto en el compartimiento intracelular –co-localizando con el
51$ YLUDO GREOH FDGHQD IRUPD UHSOLFDWLYD ± FRPR HQ HO H[WHULRUFHOXODUHQVXIRUPDVROXEOH/DDFXPXODFLyQGH16VROXEOH
en suero de pacientes infectados –así como los niveles elevados
de ,)1Į71)ĮH,/VHFRUUHODFLRQDFRQODJUDYHGDGGHOD
enfermedad y es por esto que se ha postulado que esta proteína
contribuiría con los cambios de permeabilidad vascular a través
de la activación de la cascada de complemento dependiente de
DQWLFXHUSRVREVHUYDGRVHQORVSDFLHQWHVFRQ¿HEUHKHPRUUiJLFD
\FKRTXHSRUGHQJXH )LJXUD 6LELHQQRVHKDQGLOXFLGDGR
D~QORVPHFDQLVPRVH[DFWRVPHGLDQWHORVFXDOHVODSURWHtQD16
VROXEOHVHSUHVHQWDHQODVXSHU¿FLHGHFpOXODVLQIHFWDGDV\QRLQfectadas, se ha postulado para estas últimas la unión de la proteína
YLUDODJOLFRVDPLQRJOLFDQRV KHSDUiQVXOIDWR\FRQGURLWtQVXOIDWR
( TXHVHHQFXHQWUDQHQODVXSHU¿FLHFHOXODUSULQFLSDOPHQWHHQ
FpOXODVHQGRWHOLDOHV6HKDGHPRVWUDGRTXHODH[SRVLFLyQGH16
VREUHODVXSHU¿FLHGHFpOXODVHQGRWHOLDOHVSUHVHQWDXQDPDUFDGD
HVSHFL¿FLGDGSRUKtJDGRULxyQSOHXUD\SHULWRQHRDGLIHUHQFLD
GHLQWHVWLQRRFHUHEUR/RDQWHULRUH[SOLFDUtDHOVHOHFWLYRGHUUDme vascular que ocurre en las infecciones graves por dengue y
que estaría relacionado con la relativa habilidad de las células
HQGRWHOLDOHVGHORVGLIHUHQWHVWHMLGRVSDUDXQLUDOD16VROXEOH
Capítulo 5 / Patogenia de las infecciones virales
A
B
111
E
C
D
Figura 5.34. 9LUXVLQÀXHQ]D$'GLVWULEXFLyQGHODVKHPDJOXWLQLQDV +$ \QHXUDPLQLGDVDV 1$ HQODVXSHU¿FLHGHOYLUXVLQÀXHQ]DVHJ~Q
VXGLVSRVLFLyQHVSDFLDO6HREVHUYDXQFluster GHKHPDJOXWLQLQDV SDQHO$DODL]TXLHUGD XQDPROpFXODGHQHXUDPLQLGDVDHQXQcluster
GHKHPDJOXWLQLQDV SDQHO$DOFHQWUR \XQclusterGHQHXUDPLQLGDVDV SDQHO$DODGHUHFKD /RVSDQHOHV%\&PXHVWUDQGHQWUR
GHOUHFXDGURUHVSHFWLYRODHVWUXFWXUDGH+$\1$/DEDUUDKRUL]RQWDOLQGLFDQP(OSDQHO'PXHVWUDXQPRGHORGHGLVWULEXFLyQGH+$
(en verde) y 1$ HQDPDULOOR DVtFRPRGHODFDSDOLStGLFDGHHQYROWXUD HQD]XO /DEDUUDLQGLFDQPE.0(GHSDUWtFXODVYLUDOHVGH
LQÀXHQ]D$ +1 FDXVDQWHGHOEURWHGH6HREVHUYDQSDUWtFXODVRYDOHVRHVIpULFDVFRQHVStFXODVFRUUHVSRQGLHQWHVDODH[SUHVLyQ
HQVXVXSHU¿FLHGHPROpFXODVGH+$\1$/DEDUUDKRUL]RQWDOLQGLFDQP
)XHQWHODVLPiJHQHVGHORVSDQHOHV$'IXHURQSXEOLFDGDVSRU+DUULV$et al31$65HSURGXFLGRFRQDXWRUL]DFLyQ
/DLPDJHQGHOSDQHO(IXHREWHQLGDGHOVLWLRweb ZZZFGFJRY &'&Centers for Disease Control and Prevention((88 y mediante esto ser blanco de la reactividad cruzada de los antiFXHUSRV HVSHFt¿FRV DQWL16 GXUDQWH XQD LQIHFFLyQ VHFXQGDULD
5HFLHQWHPHQWH VH KD FRPSUREDGR HQ XQ PRGHOR H[SHULPHQWDO
murino in vivo que otro de los mecanismos involucrados en el
desarrollo de la hemorragia por dengue, es la producción de espeFLHVUHDFWLYDVGHQLWUyJHQR 516 \R[tJHQR 526 SRUSDUWHGH
ODVFpOXODVHQGRWHOLDOHVLQIHFWDGDV(Oy[LGRQtWULFR 12 UHDFFLRQD FRQ VXSHUy[LGR 2 SDUD IRUPDU SHUR[LQLWULWR 2212 HO
FXDOQLWUDDODPLQRiFLGRWLURVLQD\IRUPDQLWURWLURVLQD/DH[SUHVLyQGHODHQ]LPDy[LGRQtWULFRVLQWHWDVDLQGXFLEOH L126 \GH
QLWURWLURVLQDHQHOWHMLGRKHPRUUiJLFRVHYHHVWLPXODGDVLQHUJtVWLcamente por 71)ĮORFXDOSURPXHYHODapoptosis de las células
endoteliales, con el subsiguiente derrame vascular.
,QÀXHQ]D Una PD\RU UHSOLFDFLyQ GHO YLUXV LQÀXHQ]D VH
asocia a una mayor virulenciaSRUORTXHVHLQWURGXFLUiDOOHFtor inicialmente en este tema. Dos características sobresalen de su
51$ VXLQHVWDELOLGDG\ VXplasticidad. Ambas características
posibilitan la evolución particular e impredecible de este agente
en la naturaleza.
(OYLUXVHVFDSD]GHSDGHFHUFDPELRVKDVWDHQDSUR[LPDGDPHQWHXQGHVXVHFXHQFLDDPLQRDFtGLFDHQODVJOLFRSURWHtQDVGH
HQYROWXUD KHPDJOXWLQLQD>DEUHYLDGR+$HQHOWH[WR\[email protected]\QHXUDPLQLGDVD>NA y N, [email protected]¿JXUD \FRQVHUYDUD~QVXIXQFLyQ 7DEOD $OJXQDV
GHGLFKDVVXVWLWXFLRQHV RHQRWUDVSURWHtQDVYLUDOHV VHDVRFLDQD
FDPELRVDQWLJpQLFRV )LJXUD$\% 3RUVHULQÀXHQ]DXQYLUXVFRQJHQRPDD51$TXHXWLOL]DSDUD
VXUHSOLFDFLyQXQFRPSOHMRGHSROLPHUDVDVYLUDOHV PA, 3%\3% TXHQRWLHQHQFDSDFLGDGGHOHFWXUDGHSUXHED FRUUHFFLyQGHHUURUHV
DOPRPHQWRGHODFRSLDGHOWHPSODGRGH51$ pVWRVSXHGHQRFXrrir en el proceso de copia de las bases complementarias al templaGR mutaciones (VWDVmutaciones –así como las promovidas por
la presión de selección positiva del sistema inmune– promueven
cambios antigénicos menores en las glicoproteínas de envoltura
HQLQJOpVantigenic drifts \VHDVRFLDQDODVepidemias anuales observadas. La ocurrencia de algunas PXWDFLRQHVHVSHFt¿FDVSXHGH
afectar el tropismo del virus por un determinado hospedador ú
órgano, la virulencia de las cepas y su transmisibilidad.
La segmentación del RNA viral favorece su reasociación
PH]FODGHVHJPHQWRVJHQyPLFRVGHGLIHUHQWHRULJHQ FXDQGRHQ
XQDPLVPDFpOXODKRVSHGHUDFRH[LVWHQGRVRPiVYLUXVLQÀXHQ]D
diferentes. El evento de reasociación génica del RNA de LQÀXHQ]D
ha dado origen a grandes cambios fenotípicos abruptos en el viUXV KDELWXDOPHQWHVHDIHFWDQODVJOLFRSURWHtQDVGHHQYROWXUD+$
y NA, y las polimerasas 3% 3% \ 3$ OR FXDO VH WUDGXMR HQ
las SDQGHPLDVGH +1 \ +1 VLQSDUWLFLSDFLyQ
directa de porcinos. La designación de dichos subtipos dentro del
tipo A de virus LQÀXHQ]D LQGLFD ORV cambios antigénicos mayoresHQWRQFHVRFXUULGRV HQLQJOpVantigenic shifts) en las respecWLYDVKHPDJOXWLQLQDV\QHXUDPLQLGDVDVREVHUYiQGRVHODVXFHVLYD
+1ĺ+1ĺ+1 RFRQFRPLWDQWHFLUFXODFLyQ GHVGH
KDVWDHOSUHVHQWH+1\+1 GHFHSDVGHLQÀXHQ]D$ DGHPiV
GHOD% /DSDQGHPLDGH +1 RFXUULySRUXQVDOWRGH
HVSHFLHGHXQYLUXVWRWDOPHQWHDYLDUWUDQVPLWLGRDOKRPEUH )LJXUD
(QVtQWHVLVORVcambios antigénicos mayores pueden involuFUDUFHSDVGHGLYHUVRRULJHQFRPRSRUHMHPSORSRUFLQRKXPDQR
DYLDUKXPDQRRDXQSRUFLQRDYLDUKXPDQR FRPRVHGRFXPHQtó con el virus LQÀXHQ]D$+1GHRULJHQSRUFLQRHPHUJHQWH
HQ /D VHFXHQFLD GH DPLQRiFLGRV GH OD KHPDJOXWLQLQD + GH
LQÀXHQ]D $ +1 SDQGpPLFD GL¿HUH VXVWDQFLDOPHQWH GH
la correspondiente a cepas de LQÀXHQ]D HVWDFLRQDO FLUFXODQWHV HQ
WDPELpQGHODIDPLOLD+ \FRQVLJXLHQWHPHQWHGHODDFWXDO
YDFXQD HQ XVR SDUD KXPDQRV$ PRGR GH HMHPSOR HVWLPDFLRQHV
SUHOLPLQDUHV GRFXPHQWDURQ XQ GH FDPELRV DO FRPSDUDUVH OD FHSD HPHUJHQWH$&DOLIRUQLD +1 FRQ OD GH OD
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
112
Segmento de
RNA
Algunas funciones de importancia
asociadas a las proteínas virales
3URWHtQDVFRGL¿FDGDV
3% SROLPHUDVDEiVLFD
ƒ3ROLPHUL]DHO51$YLUDOFRPSOHPHQWDULR FRQSRODULGDG>@
3% SROLPHUDVDEiVLFD
ƒ3ROLPHUL]DHO51$YLUDOFRPSOHPHQWDULR 2
3%) SURWHtQD FRGL¿FDGD HQ HO GR
PDUFR GH OHFWXUD GH HVWH VHJPHQWR GHO
RNA viral)
ƒPromueve la muerte de células del sistema inmune (macrófagos
alveolares WLSR ,, FpOXODV GHQGUtWLFDV PHGLDQWH apoptosis mediada
SRUODVPLWRFRQGULDVUHJXODD3%
3
PA (polimerasa ácida)
ƒ3ROLPHUL]DHO51$YLUDO 4
+$ KHPDJOXWLQLQD
ƒ3URPXHYHODDGVRUFLyQYLUDODUHFHSWRUHVFHOXODUHVGHiFLGRVLiOLFR
SRUORTXHdetermina el rango de especie
5
NP (QXFOHRSURWHtQD
ƒ3URWHJHHOPDWHULDOJHQpWLFRYLUDOHQODFpOXOD
ƒ7UDQVSRUWDHO51$YLUDODOQ~FOHR
ƒ&RODERUDFRQODDFWLYLGDGGHODPA
6
NA (QHXUDPLQLGDVD
ƒ/LEHUDODVSDUWtFXODVYLUDOHVGHVXVWDQFLDVPXFRLGHV\SHUPLWHHO
HJUHVRYLUDOGHODFpOXODSRUORTXHHVWiimplicada en la transmisibilidad viral
M1(proteína de matriz 1)
ƒ3URPXHYHODLQWHUDFFLyQHQWUHODQXFOHRFiSVLGH\ODHQYROWXUDYLUDO
M2 (proteína de matriz 2)
ƒ$FW~DFRPRFDQDOLyQLFRGHWUDQVPHPEUDQDTXHSHUPLWHODDFLGL¿FDFLyQYLUDOQHFHVDULDSDUDSURVHJXLUODLQIHFFLyQLQWUDFHOXODU
16 SURWHtQDQRHVWUXFWXUDO
ƒInhibe la actividad antiviralLQGXFLGDSRUHOVLVWHPDInterferón, al
LPSHGLUHOUHFRQRFLPLHQWRFHOXODUGHO51$YLUDOSRUHOVHQVRUFHOXODU
5,* OLPLWDQGRODLQGXFFLyQGHDTXpO \DOEORTXHDUODDFWLYLGDGGH
ODSURWHtQDVFHOXODUHVPKR y CPSF30
161(3 SURWHtQDQRHVWUXFWXUDOSURWHtQDGHH[SRUWDFLyQQXFOHDU
ƒ5HJXODODWUDQVFULSFLyQUHSOLFDFLyQYLUDO
ƒ6HDVRFLDDOWUDQVSRUWHGHQXFOHRFiSVLGHVKDFLDODPHPEUDQDFLWRSODVPiWLFD MXQWRDM1)
1
7
8
7DEOD5HODFLyQHQWUHORVVHJPHQWRVGHOJHQRPDD51$YLUDO\ODVSURWHtQDVFRGL¿FDGDVSRULQÀXHQ]Dtipo A.
FHSDHVWDFLRQDO$86$:5$0& +1 )LJXUD
$ (QPRGRDQiORJRODVHFXHQFLDDPLQRDFtGLFDGHODneuraPLQLGDVDH[KLEHXQGHVXVWLWXFLRQHVUHVSHFWRDODGHFHSDV
FLUFXODQWHVHQ(VWRVFDPELRVWDQLPSRUWDQWHVVHHQFXDGUDQ
entre los denominados cambios "mayores", aun cuando el virus sigue perteneciendo al subtipo H1N1 de virus. Los cambios
observados en la hemaglutinina del nuevo virus están concentrados en los 5 sitios antigénicos (A-E) responsables de inducir
anticuerpos neutralizantes además el sitio C exhibe la sustitución aminoacídica Asp277Asn iFLGRDVSiUWLFRĺDVSDUDJLQD
HQODSRVLFLyQGHODKHPDJOXWLQLQD TXHLQWURGXFHXQQXHYR
sitio de glicosilación que podría "enmascarar" dicho determinante
DQWLJpQLFR )LJXUD% $OSUHVHQWHVHLJQRUDHOFRPSRUWDPLHQWRTXHWHQGUiGLFKR
virus emergente pandémico 2009 )LJXUDVSDQHO%\ en función de la actual circulación de cepas causantes de la LQÀXHQza estacional por virus WLSR$ VXEWLSRV +1 \ +1 7DPELpQ
se desconoce el comportamiento que el nuevo virus podría tener
en un determinado hospedador ante la eventual coinfección con
HOYLUXVDYLDUDOWDPHQWHSDWRJpQLFRLQÀXHQ]Dtipo A subtipo +1
)LJXUD La virulencia del virus LQÀXHQ]DWLHQHXQRULJHQPXOWLJpnico (Tabla 5.7)\DTXHVHDVRFLDDODH[SUHVLyQGHORVJHQHVFRGL¿FDQWHVGHODHA, la NAODSROLPHUDVDEiVLFD PB1 PB2, y
GHODVSURWHtQDVQRHVWUXFWXUDO NS1) y PB1-F2 3%Frame2,
FRGL¿FDGDHQIRUPDSDUFLDOPHQWHVXSHUSXHVWDDXQTXHHQXQPDUco alternativo de lectura al correspondiente a 3% HV H[SUHVDGD
HQXQDVLJQL¿FDWLYDSURSRUFLyQGHFHSDVGHOWLSR$ 6LQHPEDUJR
HQHOJHQRPDGHODVSULPHUDVFHSDVDQDOL]DGDVHQGHOQXHYR
YLUXVHPHUJHQWHLQÀXHQ]DWLSR$ +1 3%)H[KLEHXQDVHxDOGHWHUPLQDFLyQHQHOFRGyQTXHODWRUQDUtDIXQFLRQDOPHQWH
LQDFWLYD\DTXHH[FOX\HODUHJLyQTXHFRGL¿FDHOGRPLQLRSHSWtGLFRSDUDVXORFDOL]DFLyQPLWRFRQGULDO \SRUHQGHVXIXQFLyQSUR
DSRSWyWLFD Aunque no se conocen con certeza todos los factores que determinan la patogenicidad y virulencia de los virus LQÀXHQ]DVHSXHGHD¿UPDUTXHDOJXQRVGHpVWRVVHDVRFLDQDXQDPSOLRWURSLVPR
tisular y a la habilidad de replicar sistémicamente. A nivel molecular, uno de los determinantes de alta patogenicidad y virulencia
es la presencia de una serie de aminoácidos básicos DUJLQLQDR
OLVLQD en el sitio de clivaje de la HA, lo que le permite utilizar
ODVSURWHDVDVSUHVHQWHVHQXQDH[WHQVDJDPDGHWHMLGRV\SRUHQGH
UHSOLFDUHQHOORVSURYRFDQGRDVtXQDHQIHUPHGDGPiVJUDYH(VWH
evento conduce a las manifestaciones sistémicas observadas en
pacientes infectados con el tipo A subtipo +1GHLQÀXHQ]D XQ
agente de JULSHDYLDU 'LFKDVVHFXHQFLDVDPLQRDFtGLFDVEiVLFDVQR
se encuentran presentes en las deducidas luego del secuenciamiento nucleotídico de las primeras cepas de virus LQÀXHQ]D$ +1 HPHUJHQWHHQ$WUDYpVGHOD+$ODSDUWtFXODYLUDOVHDGVRUEH
DODFpOXODPHGLDQWHODXQLyQDUHFHSWRUHVGHiFLGRVLiOLFRXELFDGRV
113
Capítulo 5 / Patogenia de las infecciones virales
Hidrofilicidad
A
Sitio A
Sitio E
Sitio D
Sitio B
Sitio C
Sitio B
Sitio C
Posición aminoacídica
B
Sitio de
unión al receptor
Sitio B
Sitio D
Cabeza
globular
Sitio A
Sitio E
Bisagra
Tallo
fibroso
Sitio E
Rulo
Péptido
de fusión
Exterior
Membrana
Interior
)LJXUD$3HU¿OGHKLGUR¿OLFLGDGGHODKHPDJOXWLQLQDGHODVFHSDVGHLQÀXHQ]D$&DOLIRUQLD +1 HPHUJHQWHHQ
y A/USA/WRAMC-1154048/2008 (H1N1) que circuló en 2008./RVYDORUHVSRVLWLYRVGHKLGUR¿OLFLGDGIUHFXHQWHPHQWHVHDVRFLDQDVLWLRV
DQWLJpQLFRV6HLQGLFDODSRVLFLyQDSUR[LPDGDGHOLQLFLRGHORVVLWLRVDQWLJpQLFRV$( URWXODGRVIXHUDGHHVFDODSDUDVXPHMRUYLVXDOL]DFLyQ REVHUYiQGRVH GLIHUHQFLDV VLJQL¿FDWLYDV HQWUH DPEDV KHPDJOXWLQLQDV &RUWHVtD GH -XOLHWD 7ULQNV 'HSWR 0LFURELRORJtD 3DUDVLWRORJtD H
,QPXQRORJtD)DFXOWDGGH0HGLFLQD8%$ B. Esquema de un monómero de hemaglutinina insertado en una membrana exhibiendo
los sitios antigénicos A-E, indicados en el panel A. /D HVWUHOOD SLQWDGD HQ URMR LQGLFD HO QXHYR VLWLR GH JOLFRVLODFLyQ GHQWUR GHO VLWLR
DQWLJpQLFR&GHELGRDODVXVWLWXFLyQ$VSĺ$VQHQODSRVLFLyQORTXHPRGL¿FDVXDQWLJHQLFLGDG
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
114
Genes asociados a la
patogenicidad / virulencia
Genes asociados a la
transmisibilidad
Múltiples
Múltiples
+$
+$
NA
NA
3%
3%
3%)
3%
NS1
7DEOD)DFWRUHVYLUDOHVDVRFLDGRVDODSDWRJHQLFLGDGYLUXOHQFLD\WUDQVPLVLELOLGDGGHOYLUXVLQÀXHQ]D$ Se indican las abreviaWXUDVGHORVJHQHVYLUDOHVFRGL¿FDQWHVGHGLIHUHQWHVSURWHtQDVHA: KHPDJOXWLQLQDNA: QHXUDPLQLGDVD PB1: SROLPHUDVDEiVLFDPB1-F2:
SURWHtQDFRGL¿FDGDHQXQPDUFRGHOHFWXUDDOWHUQDWLYR Frame 2) del gen 3%3%SROLPHUDVDEiVLFDNS1:QRHVWUXFWXUDO
1918
Gripe española
1957
Gripe asiática
1968
Gripe de Hong Kong
1977
Gripe rusa
1950
H1N1
H2N2
PB2
PB1
PA
HA
NP
NA
M
NS
8?
5
3
N1
PB2
PB1
PA
HA
NP
NA
M
NS
H1
H3N2
PB2
PB1
PA
HA
NP
NA
M
NS
6
2
N2
PB2
PB1
PA
HA
NP
NA
M
NS
H2
H1N1
PB2
PB1
PA
HA
NP
NA
M
NS
PB2
PB1
PA
HA
NP
NA
M
NS
N?
PB2
PB1
PA
HA
NP
NA
M
NS
H3
Hasta Febrero de 2009
Gripe estacional por
influenza A
H3N2 ó H1N1*
H1N1
H1N2
H1N1
)LJXUD 2ULJHQ GH ORV YLUXV LQÀXHQ]D$ DVRFLDGRV D pandemias previas y a la gripe estacional. *8Q QXHYR YLUXV HPHUJHQWH
$+1LQLFLyODSULPHUSDQGHPLDGHOVLJOR;;,
HQODVXSHU¿FLHFHOXODUWDPELpQSURPXHYHODOLEHUDFLyQGHOJHQRma viral al citoplasma celular al fusionar la envoltura de la partícula viral capturada con la membrana de la vesícula endocítica. La
HA induce la producción de anticuerpos neutralizantes protectores.
Es un homotrímero que es procesado proteolíticamente para geneUDUGRVVXEXQLGDGHVOD+$\OD+$(OFOLYDMHSRVWWUDGXFFLRQDO
necesario para que el virus sea infectivo es llevado a cabo por proteasas celulares similares a la tripsina.
La actividad de la NA es crítica para la liberación de las
partículas virales que quedan adheridas a la membrana citoplasPiWLFDORTXHSHUPLWHODGLVHPLQDFLyQYLUDODOSURGXFLUVHHOHJUHVR
mediante brotación. Las polimerasas PB1 y PB2 MXQWRFRQOD3$ participan en la constante evolución viral asociada a la emergencia
de mutaciones nucleotídicas y a eventuales cambios aminoacídiFRV\GHORVFRUUHVSRQGLHQWHVSHU¿OHVGHJOLFRVLODFLyQGHELGRDOD
IDOWDGHOHFWXUDGHSUXHEDLQKHUHQWHDOFRPSOHMRHQ]LPiWLFRGHSRlimerización. Esta es la base de los cambios antigénicos menores
(antigenic drift) que contribuyen a evadir la respuesta inmune
del hospedero y promueven la patogenicidad estacional asociada a cada epidemiaFDXVDGDSRULQÀXHQ]Dtipo A, que requiere la
preparación periódica de nuevas vacunas. PB2 es también asociada a la diferente propagación viral y virulencia en distintos
WHMLGRV\HVSHFLHVVRQFUtWLFRVORVresiduos aminoacídicos en las
posiciones 627 *OXiFLGRJOXWiPLFRy/\VOLVLQD y 701 $VS
iFLGR DVSiUWLFR y$VQ DVSDUDJLQD /DV FHSDV DYLDUHV DOWDPHQWH
patogénicas +1\HOQXHYRYLUXV+1SDQGpPLFR FX\R
VHJPHQWRGH51$FRGL¿FDQWHGH3%HVGHRULJHQDYLDUVHJ~QVH
REVHUYDHQHOHUUHFXDGUR>[email protected]]TXLHUGD
HQODEDVHGHOD¿JXUD H[KLEHQ*OXPLHQWUDVODVFHSDV
KXPDQDVFLUFXODQWHVKDVWDSRUWDEDQ/\VHQGLFKDSRVLFLyQ
/DVXVWLWXFLyQDPLQRDFtGLFD*OXĺ/\VHQODSRVLFLyQOHV
FRQ¿HUHDODVFHSDVGHRULJHQDYLDU+1\+1 FDXVDQWHVGH
XQEURWHHQ+RODQGDHQ XQDH¿FLHQWHUHSOLFDFLyQ\DOWDYLrulencia en ratones. Por ende, dicha PXWDFLyQ*OX/\VVHDVRcia en cepas aviares a la adaptación viral para propagarse en células humanas y determina una alta patogenicidad en mamíferos.
6LQHPEDUJR/\VSDUHFHUtDQRVHUWRWDOPHQWHLPSUHVFLQGLEOH
ya que otras mutaciones compensatorias pueden proveer la adaptación a mamíferos cuando la antedicha PXWDFLyQ HVWi DXVHQWH
La presencia de Glu ó Lys en la posición 627 de PB2 deter-
115
Capítulo 5 / Patogenia de las infecciones virales
2da. triple
reasociación
N2
PB2
PB1
PA
HA
NP
NA
M
NS
H1
N1
PB2
PB1
PA
HA
NP
NA
M
NS
H1
2009
A (H1N1)
N1
PB2
PB1
PA
HA
NP
NA
M
NS
H1
PB2
PB1
PA
HA
NP
NA
M
NS
3
2
~1998
HA
NP
NA
M
NS
PB1
HA
NA
PB2
PA
NA
M
~1998
~1998
N2
H3N2
H3
PB2
PB1
PA
HA
NP
NA
M
NS
1
PB1
HA
NA
~1918
~1998
~1979
~1968
H1N1
H3N2
H?N?
1ra. triple
reasociación
)LJXUD2ULJHQGHOYLUXVLQÀXHQ]D$+1FDXVDQWHGHOEURWHGH6HWUDWDGHXQYLUXVTXHUHFRQRFHJHQHVGHRULJHQSRUFLQRKXPDQR\DYLDU LQGLFDGRFRQUHFXDGURVQHJURVJUXHVRV 3DUDXQDPHMRUYLVXDOL]DFLyQVyORVHLQGLFDQORVJHQHVTXHSDUWLFLSDURQ
HQHOVXUJLPLHQWRGHHVWHYLUXVHPHUJHQWH(QGLIHUHQWHVPRPHQWRVGHOVLJOR;;JHQHVGHLQÀXHQ]DDYLDUVHWUDQVPLWLHURQDSRUFLQRVRDO
KRPEUH\GHpVWHDOFHUGR1.(QSRUFLQRVGH((88VHSURGXMRDSUR[LPDGDPHQWHHQXQDSULPHUDWULSOHreasociación de genes de
LQÀXHQ]D UHFXDGURD]XOWHQXH JHQHUDQGRYLUXV$ +1 2.(VWHYLUXVH[SHULPHQWyXQVHJXQGRHYHQWRGHUHDVRFLDFLyQFRQLQÀXHQ]D$
+1 FDXVDQWHGHODLQÀXHQ]DSRUFLQDFOiVLFD ORTXHJHQHUyYLUXV$ +1 \ +1 3.(OOLQDMHSRUFLQRQRUWHDPHULFDQRGHORVYLUXVFRQ
la triple UHDVRFLDFLyQJpQLFDH[SHULPHQWyODPH]FODFRQJHQHVGHLQÀXHQ]DSRUFLQDGHOLQDMHHXUDVLiWLFR
mina, respectivamente, la menor o mayor capacidad viral de
replicar a 33ºC. Para una adecuada propagación viral interKXPDQDDWUDYpVGHOHVWRUQXGR\ODWRVHVLPSUHVFLQGLEOHTXH
el virus pueda replicar en el tracto respiratorio superior, donde existe dicha temperatura. Los sitios de replicación preferenciales de las cepas +1VRQ±HQWUHRWURV±HOWUDFWRUHVSLUDWRULR
LQIHULRUHQHOKRPEUH\HOLQWHVWLQRHQODVDYHVORVFXDOHVH[KLEHQ
WHPSHUDWXUDVVXSHULRUHVDž& ž&\ž&UHVSHFWLYDPHQWH /DOLPLWDFLyQUHODWLYDSDUDUHSOLFDUDž&GHWHUPLQDUtDODLQH¿ciente transmisión interhumana observada en los primeros años
de LQÀXHQ]DDYLDUFDXVDGDSRUHOsubtipo +1'HDOOtTXHSDUD
XQDHYHQWXDOSURSDJDFLyQSDQGpPLFDGHOYLUXVLQÀXHQ]D$+1
FX\RV JHQHV VRQ HQ VX WRWDOLGDG GH RULJHQ DYLDU ¿JXUD VHKD\DSRVWXODGRODFUXFLDOSUHVHQFLDGH/\VHQ3% mutaFLyQ *OXĺ/\V \D TXH SRVLELOLWDUtD OD SURSDJDFLyQ WDQWR HQ HO
WUDFWRUHVSLUDWRULREDMRFRPRDOWRSin embargo, la presencia de
627Glu en las cepas inicialmente caracterizadas en 2009 de
LQÀXHQ]D$ +1 \ OD VLJQL¿FDWLYD WUDQVPLVLELOLGDG LQWHU
KXPDQD VXJLHUHQ TXH RWURV PDUFDGRUHV D~Q GHVFRQRFLGRV
están presentes en este agente emergente(QVHGHPRVWUyTXHFHSDVFLUFXODQWHVGHLQÀXHQ]D$ +1 GLIHUtDQVyORHQ
QXFOHyWLGRVUHVSHFWRDGRVYLUXVFUHDGRVH[SHULPHQWDOPHQWH
SRUGRVJUXSRVGHLQYHVWLJDFLyQ'LFKRVYLUXVH[KLEtDQHOPLVPR
subtipo de KHPDJOXWLQLQD + FRQ VXVWLWXFLRQHV DPLQRDFtGLFDV
SURPRYLGDV PHGLDQWH PXWDJpQHVLV HQ ORV JHQHV FRGL¿FDQWHV GH
la HA y 3% DSDUWLUGHXQDFHSD+1 \OXHJRSURSDJDGDHQ
hurones, o mediante mutagénesis y UHDVRFLDFLyQJpQLFD TXLPHUD
FRQWHQLHQGR HO JHQ + PXWDGR HQ XQ HVTXHOHWR GH IUDJPHQWRVGH51$GHOYLUXVSDQGpPLFR$ +1 FDUHQWHGHVX
SURSLR JHQ FRGL¿FDQWH GH OD +$ >[email protected] $PERV YLUXV FUHDGRV
H[KLELHURQ WUDQVPLVLyQ HQWUH KXURQHV LQIHFWDGRV H[SHULPHQWDOmente. Si bien no se ha demostrado que dichas mutaciones sean
las mismas que las que podrían asociarse a la transmisión interhumana, estos resultados demuestran la transmisión del virus aviar
entre mamíferos y alertan sobre el riesgo de una eventual pande-
mia por cepas +1HQFDVRGHDGTXLULUORVFDPELRVREVHUYDGRV
)LJXUD /DFUHDFLyQGHHVWRVQXHYRVYLUXVGHODERUDWRULR
KDSURGXFLGRXQLQWHQVRGHEDWHpWLFRHQODFRPXQLGDGFLHQWt¿FD
internacional.
La proteína NS1 es la principal responsable de la evasión
D OD UHVSXHVWD LQPXQH TXH H[KLEH HVWH YLUXV Por su capaciGDG GH XQLyQ D \ VHFXHVWUR GHO 51$ ELFDWHQDULR YLUDO GXUDQWH
OD UHSOLFDFLyQ JHQyPLFD afecta la capacidad de los receptores
celulares de la respuesta inmune innata FRPR ODV KHOLFDVDV
5,* Retinoic acid Inducible Gene: JHQ LQGXFLEOH SRU iFLGR
UHWLQRLFR TXHSURPXHYHQHOGLVSDURGHODVtQWHVLVGHinterferón (Figura 5.39). También NS1 inhibe CPSF30 Cleavage and
Polyadenylation SSHFL¿FLW\FactorIDFWRUGHHVSHFL¿FLGDGGHFOLYDMH \ SROLDGHQLODFLyQ XQ IDFWRU TXH SDUWLFLSD HQ HO SURFHVDmiento de pre-mensajeros celulares, incluido el del interferón
(,)1 ȕ$VXYH]LQKLEHHQP~OWLSOHVVLWLRVODYtDGHVHxDOL]Dción del LQWHUIHUyQ Į\ȕ DVtFRPRDDOJXQDVGHODVSURWHtQDV
LQGXFLGDV SRU GLFKD FLWRTXLQD OR TXH IDYRUHFH OD UHSOLFDFLyQ
YLUDO $GHPiV HVSHFt¿FDPHQWH LQWHUDFW~D FRQ SURWHtQDV WDOHV
como la PKR SURWHtQD TXLQDVD GHSHQGLHQWH GH 51$ TXH SURmueve la apoptosis, la proteína RNAsa L TXHGHJUDGDHO51$
YLUDO \OD¶¶2OLJR$GHQLODWRVLQWHWDVDTXHDFWLYDOD51$VD
L ODWHQWH FHOXODUTXHGHJUDGDHO51$YLUDO/DSURWHtQDNS1 del
nuevo virus emergente LQÀXHQ]D$ +1 HVWiWUXQFDGDGHELGRDXQFRGyQGHWHUPLQDFLyQSUHPDWXURTXHH[FOX\HODUHJLyQ
del dominio de reconocimiento proteína-proteína GHQRPLQDGR
OLJDQGRSDUDGRPLQRV3'=>DFUyQLPRGHODVSULPHUDVOHWUDVGHODV
tres proteínas en las que se descubrió su presencia: Post synaptic
density protein, Drosophila disc large tumor suppressor, y Zonula
occludens-1 [email protected] LQYROXFUDGRHQODVHxDOL]DFLyQFHOXODU\HQOD
YLUXOHQFLDGHODVFHSDVFDXVDQWHVGHODSDQGHPLDGH\HQODV
de LQÀXHQ]DDYLDU+1.
)LQDOPHQWH HV QHFHVDULR GHVWDFDU TXH OD SURWHtQD PB1-F2
HVWiFRGL¿FDGDSRUPXFKDVSHURQRWRGDVODVFHSDVGHOtipo A
(especialmente su prevalencia es menor en las cepas huma-
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
116
PB2
PB1
PA
HA
NA
NP
M
NS
N1
H5
PB2
PB1
PA
HA
NA
NP
M
NS
1997
A (H5N1)
Figura 5.38. Origen aviar de los genes de LQÀXHQ]D$ H5N1).
QDVGHLQÀXHQ]D$+1TXHFLUFXODURQHQORV~OWLPRVDxRV PB1-F2H[KLEH HQWUHRWUDV XQDORFDOL]DFLyQPLWRFRQGULDOTXH
produce su alteración morfológica, la consiguiente pérdida del
potencial de membrana mitocondrial y promueve la apoptosis
de los macrófagos alveolares WLSR (VWR DIHFWD OD UHVSXHVWD
inmune del hospedero al inhibir una adecuada presentación
de los antígenos virales a los OLQIRFLWRV 7 CD4+ ayudadores
£VHLPSLGHHOQH[RHQWUHODUHVSXHVWDLQQDWD\ODDGDSWDWLYD Adicionalmente, la eliminación de dichas células, facilita la soEUHLQIHFFLyQEDFWHULDQD7RGDVODVFHSDVTXHRULJLQDURQpandePLDV HQ HO VLJOR ;; +1 HQ +1 HQ \ +1
HQ DVtFRPRODVFHSDVDOWDPHQWHSDWRJpQLFDVGHOsubtipo
+1SURGXFWRUDVGHLQÀXHQ]DDYLDUKDFLD¿QHVGHODGpFDGDGH
\KDVWDODDFWXDOLGDG H[SUHVDURQ3%)&RPRVHLQGLFy
HQXQSiUUDIRDQWHULRUHOYLUXVHPHUJHQWH$ +1 SDQGpPLFR
FRGL¿FDHQHOJHQ3%)XQSpSWLGRWUXQFDGRTXHFDUHFH
GHOGRPLQLRGHDQFODMHPLWRFRQGULDO(QOD7DEODVHUHVHxD
las características de virulencia y transmisibilidad de las difeUHQWHVFHSDVGHYLUXVLQÀXHQ]D$
Rotavirus. +DVWD¿QHVGHODGpFDGDGHVHSRVWXODEDTXH
ODGLDUUHDFDXVDGDSRUURWDYLUXVHUDGHELGD±H[FOXVLYDPHQWH±DXQ
proceso de mala-absorción causado por la destrucción masiva de
los enterocitos maduros. Sin embargo, este modelo no sólo no poGtDH[SOLFDUHOFXDGURGHGLDUUHDGLIHUHQFLDOHQWUHDGXOWRV\niños
PHQRUHVGHDxRVVLQRTXHWDPSRFRVHDMXVWDEDDORVQXPHURVRV
casos de diarrea sin daño morfológico aparente del epitelio intesWLQDO(VWRFDPELyHQFXDQGRVHSRVWXOyDODSURWHtQDQRHVWUXFWXUDO 163 GHURWDYLUXVFRPRODSULPHUDHQWHURWR[LQDYLUDO
Actualmente se postula su efecto sobre los enterocitos de las vellosidades y células de la cripta, mediante su liberación desde enterocitos infectados y su unión a un UHFHSWRUD~QQRLGHQWL¿FDGRDXQ
en células no infectadas. La unión de NSP4 soluble a ese receptor
celular –diferente del UHFHSWRUYLUDO\FRQQLYHOGHH[SUHVLyQGHpendiente de la edad del hospedero– activaría una serie de eventos
que provocarían como consecuencia una diarrea secretoria. Si bien
como se mencionó anteriormente esta proteína viral es considerada
XQDHQWHURWR[LQDpVWDVyORVHDVHPHMDDODVWR[LQDVEDFWHULDQDV±
como las de Vibrio cholerae y Escherichia coli– en que en ambos
FDVRVQRVHREVHUYDGDxRPRUIROyJLFRDSDUHQWH 7DEOD NSP4
HVFDSD]GHHVWLPXODUORVSOH[RVGHOVLVWHPDQHUYLRVRDXWyQRPR
habiéndose postulado que dicho evento contribuiría hasta en un
GHOYROXPHQGHODGLDUUHD
6.3.2 Bases moleculares y genéticas de la persistencia
¢4XpPHFDQLVPRVGHWHUPLQDQODPDQWHQFLyQRHUUDGLFDFLyQYLUDO
HQ HO RUJDQLVPR" /D UHVSXHVWD D HVWH LQWHUURJDQWH QR HV ~QLFD QL
YiOLGD SDUD WRGRV ORV YLUXV 8Q SULPHU \ REYLR UHTXLVLWR SDUD OD
instalación de una infección persistente es que el virus sólo cause
daño tisular o enfermedad leve en el hospedero. Así en algunos
YLUXVVHSURGXFHXQDH[SUHVLyQOLPLWDGDGHDOJXQRVJHQHVODTXH
HVWiHQFLHUWRVFDVRVLQÀXLGDSRUODUHVSXHVWDFHOXODURJHQHUDOGHO
hospedero.
Los factores que regulan la instalación y/o mantención de una
LQIHFFLyQSHUVLVWHQWHSXHGHQVHUFODVL¿FDGRVVHJ~QVXRULJHQ YLUDO
RGHOKRVSHGHUR RVHJ~QFXiOVHDVXHIHFWR GLVPLQXLUHOSRWHQFLDO
OtWLFRGHOYLUXVRHYDGLUODUHVSXHVWDLQPXQH (QOD7DEODVH
PHQFLRQDUiQVyORDOJXQRVHMHPSORVLOXVWUDWLYRV
Virus hepatitis C(OOHFWRUHVUHIHULGRDOFDStWXORHVSHFt¿FR
GRQGHHOWHPDHVGHVDUUROODGRin extenso. En esta sección sólo
VH KDUi UHIHUHQFLD D OD UHODFLyQ H[LVWHQWH HQWUH OD infección persistente por HCV y la generación de micro RNAs (miRNAs) y
51$LQWHUIHUHQWHVSHTXHxRV small interfering RNAs o siRNAs),
miembros del sistema celular de LQWHUIHUHQFLDD51$ 51$L /RV
PL51$V\ORVVL51$VVRQG~SOH[GHQWTXHWLHQHQODFDSDFLGDGGHXQLUVHDVHFXHQFLDVFRPSOHPHQWDULDVHVSHFt¿FDVGH51$
regulando la H[SUHVLyQJpQLFDDPEDVPROpFXODVGL¿HUHQHQVXELRJpQHVLV véase el capítulo 7: "Mecanismos de defensa" ([LVWHQ UHVXOWDGRV FRQWUDSXHVWRV UHVSHFWR DO SRWHQFLDO URO GH
estas moléculas en la patogénesis de esta infección. La modulación negativa de la H[SUHVLyQJpQLFDpor miRNAs puede ocurrir
mediante la degradación de dichas secuencias blanco de RNA
H[DFWDPHQWHFRPSOHPHQWDULDVDXQTXHHQORVPHWD]RDULRVODPDyoría de los PL51$VHXQHQDODUHJLyQ¶875 ¶Untranslated
Region PHGLDQWHFRPSOHPHQWDULHGDGSDUFLDOORTXHSURGXFHXQ
bloqueo de la iniciación traduccional, una inhibición de etapas subsiguientes de la misma, y/o la formación de "cuerpos de procesamiento" con posterior degradación del genoma diana. Sin embargo,
recientemente, se han detectado PL51$VTXHSXHGHQ estimular
la expresión génicaVHJ~QHOORVVLWLR V GHXQLyQDO51$PHQVDMHURHVSHFt¿FR6HKDSRGLGRGHWHUPLQDUTXH±HQPXFKRVFDVRV±
los miRNAs forman parte esencial de la respuesta inmune innata
mediada por interferón.
El HCV es un paradigma entre los agentes causales de infecFLyQ SHUVLVWHQWH \D TXH DSUR[LPDGDPHQWH WUHV FXDUWDV SDUWHV GH
ORVLQGLYLGXRVLQIHFWDGRVODGHVDUUROOD(VWHHYHQWRHVWiDVRFLDGR
EiVLFDPHQWHDGRVDVSHFWRVD ODevolución viral vinculada con la
Capítulo 5 / Patogenia de las infecciones virales
117
Figura 5.39. Efectos de la proteína NS1 de LQÀXHQ]D0HGLDQWHODLQKLELFLyQGHOVHQVRUFHOXODU5,* XQDKHOLFDVD 16LQKLEHODLQGXFFLyQGHOVLVWHPDInterferón (,)1 $GHPiVLQWHUDFW~DFRQHLQKLEHDGLYHUVDVPROpFXODVDQWLYLUDOHVLQGXFLGDVSRUInterferón, tales como
ODSURWHtQDTXLQDVDGHSHQGLHQWHGH51$ 3.5 TXHSURPXHYHODDSRSWRVLVOD¶¶ROLJRDGHQLODWRVLQWHWDVD ¶¶2$6 TXHHVWLPXODOD
DFWLYLGDGGHOD51$VD/ ODWHQWH FHOXODU TXHGHJUDGDHO51$YLUDO $GHPiV16VHFXHVWUDHLQKLEH&36) Cellular cleavage and Polyadenylation SSHFL¿FLW\Factor XQIDFWRUFHOXODUUHTXHULGRSDUDHOSURFHVDPLHQWR¶WHUPLQDOGHORV51$SUHPHQVDMHURVLQFOXLGRHOGHO
LQWHUIHUyQȕ$QiORJDPHQWH16LQKLEHIDFWRUHVGHWUDQVFULSFLyQFRPR,5)\-1.QHFHVDULRVSDUDODVtQWHVLVGHOLQWHUIHUyQ/DLPDJHQ
de NS1 de la cepa de LQÀXHQ]D+1 $9LHWQDP FRUUHVSRQGHDVXHVWUXFWXUDFULVWDORJUi¿FDREWHQLGDPHGLDQWHUD\RV;DXQD
UHVROXFLyQGHc'LFKDFHSDHVWXYRDVRFLDGDDXQDPRUWDOLGDGGHOHQXQEURWHGH9LHWQDPHQ'H%RUQKROGW=D\3UDVDG%9
Nature5HSURGXFLGRFRQDXWRUL]DFLyQ
replicación genómica de la RNA polimerasa del HCV sin lectura
de prueba y por ende con una elevada tasa de PXWDFLRQHVEDMROD
SUHVLyQGHVHOHFFLyQGHODUHVSXHVWDLQPXQH\E ODDIHFWDFLyQGH
dicha respuesta del hospedero. El HCV interacciona con los dos
principales componentes del sistema de interferencia a RNA: los
miRNAs y los siRNAs.
Como otros virus, el +&9SXHGHPRGL¿FDUODDFWLYLGDGGH
los miRNAs celulares, mediante estructuras que funcionan como
supresoras virales de los RNA de LQWHUIHUHQFLD HQ LQJOpV Viral
Suppressors or RNA interference o VSR (VWRVverdaderos factores de virulenciaSXHGHQDOWHUDUHOSHU¿OGHPL51$VGHXQDGHterminada célula, y por ende de su transcriptoma. En el caso del
HCV, ello parecería ocurrir como consecuencia de la capacidad
YLUDO GH HYROXFLRQDU UiSLGDPHQWH HQ FRQWUDVWH FRQ OD OHQWD evolución de los miRNAs celulares. Al igual que otros virus a RNA,
+&9HVWiHQULTXHFLGRHQVHFXHQFLDVTXHSXHGHQVHUEODQFRGHOD
DFFLyQGHPLFUR51$V PL51$V KXPDQRVWDOHVFRPRPL5
PL5DPL5PL5PL5\PL5ORVTXHSXHGHQ LQKLELU H[SHULPHQWDOPHQWH OD JHQHUDFLyQ GH UHSOLFRQHV XQLGDGGHiFLGRQXFOHLFRFRQFDSDFLGDGGHUHSOLFDFLyQUHJXODGDSRU
SURWHtQDV in vitro 0iV D~Q PL5 \ PL5 SXHGHQ LQKLELU
la replicación del HCV in vitro. Las secuencias diana para los
miRNAs están llamativamente conservadas entre los diferentes
genotipos del HCV. Algunos autores postulan que el HCV puede mutar para evadir la eventual actividad antiviral de ciertos
componentes del sistema de RNAi, lo cual contribuiría tanto
a la instalación de la infección persistente como a la aparición
de reactivaciones en la infección crónica )LJXUD 6LQHPbargo, otros grupos de investigación postulan que el sistema de
RNAi en humanos, no tendría un efecto antiviral como ocurre en
plantas e invertebrados, sino que sería necesario para la replicación
YLUDO$HVWHUHVSHFWRVHKDGRFXPHQWDGRODH[LVWHQFLDGH miRNAs
KHSDWRFLWRHVSHFt¿FRVFRPRHOPL5. Este miRNA constituye
HO XQDVFRSLDV GHORVTXHVHORFDOL]DQHQGLFKDFpOXOD
Sorprendentemente, –y en contraposición con los anteriormente
descriptos– miR-122 no sólo no inhibe la replicación del HCV,
VLQRTXHHVXQIDFWRUQHFHVDULRSDUDVXSURSDJDFLyQHQhepatocitos al promover la traducción de proteínas, mediante la estabilización del RNA viral con los ribosomas celulares, contribuyendo al hepatotropismo del HCV. Contrariamente a otros miRNAs,
miR-122 se une a la región 5’UTR del RNA viral. Este es el
primer miRNA conocido en la Virología que regula positivamente
ODH[SUHVLyQYLUDOORTXHOR\HUJXHHQXQSRWHQFLDOEODQFRWHUDSpXtico en pacientes con hepatitis C crónica. Este miRNA se encuentra
VLJQL¿FDWLYDPHQWHGLVPLQXLGRHQSDFLHQWHVFRQhepatitis C crónica
que responden pobremente desde el punto de vista virológico a la
subsiguiente terapéutica con Interferón, no habiéndose demostrado
una asociación con los niveles de carga viral del HCV.
Las proteínas estructurales del HCV pueden también inhibir la actividad de siRNAs celulares. Se ha demostrado que
el coreLQKLEHDODULERQXFOHDVDFHOXODU'LFHU TXHFOLYDHOIRES
GHO JHQRPD YLUDO \ HO 51$ GHO LQWHUPHGLDULR UHSOLFDWLYR HQFDUgada de generar los fragmentos de RNA bicatenarios precursores
de los siRNAs. Asimismo, la interacción directa de las proteínas
HVWUXFWXUDOHV±HVSHFLDOPHQWH(GHODHQYROWXUDGHOHCV– con la
SURWHtQD$UJRQDXWHGHOFRPSOHMR5,6& RNA-Induced Silencing
Complex) elude la actividad del sistema de RNAi. Se ha postulado
que estas estrategias del HCV contribuyen a la persistencia viral.
Debe aún establecerse si los eventos de inhibición de miRNAs
y siRNAs por el HCV propugnan un escape a una respuesta antiYLUDO FRPRDUJXPHQWDURQP~OWLSOHVJUXSRVGHLQYHVWLJDFLyQHQWUH
\ VLHQUHDOLGDGFRUUHVSRQGHQDSDVRVREOLJDWRULRVGH
la biología del +&9SDUDSURPRYHUVXSURSLDUHSOLFDFLyQ FRPR
ORSRVWXODURQFRQWHPSRUiQHDPHQWHDOJXQRV RVLGHEHDQDOL]DUVH
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
118
CARACTERÍSTICA
7UDQVPLVLyQLQWHUKXPDQD
Gravedad clínica
,QÀXHQ]D
A(H1N1)
causante de
pandemia en
1918
,QÀXHQ]D
A(H2N2)
causante de
pandemia en
1957
+++ / ++++
+++ / ++++
++++
+++
,QÀXHQ]D$ H5N1)
aviar
- ĺ“
(extremadamente
restringida)*
++++
,QÀXHQ]D
A (H1N1)
y A(H3N2)
estacional
,QÀXHQ]D
A(H1N1)
pandémico
(2009)
++
+++
++
++ /
+++**
7DEOD&RPSDUDFLyQSUHOLPLQDU\SURYLVRULDHQWUHODLQIHFFLyQSRULQÀXHQ]D$ +1 SDQGpPLFD\ODVSURGXFLGDVSRU
RWURVYLUXVLQÀXHQ]D$ +DVWD-XOLRGH**:/DVSULPHUDVVHPDQDVGHSHQHWUDFLyQ\SURSDJDFLyQGHOYLUXVHPHUJHQWHHQODSREODFLyQGH0p[LFRVHDVRFLDURQDXQDJUDYHGDGFRPSDUDEOHDODH[KLELGDSRUHOYLUXVFDXVDQWHGHODSDQGHPLDGHFRQVLJQL¿FDWLYD
PRUWDOLGDG(QVHPDQDVVXEVLJXLHQWHVVHREVHUYDURQGHVGHFDVRVDIHEULOHVFRQOHYHRPRGHUDGRFRPSURPLVRGHOWUDFWRUHVSLUDWRULRKDVWD
QHXPRQtDVJUDYHVHVWLPiQGRVHODWDVDGHPRUWDOLGDGHQHQORVSULPHURVFDVRVFRQ¿UPDGRVPHGLDQWHHVWXGLRVYLUROyJLFRV
PROHFXODUHV GDWRVGHOD2UJDQL]DFLyQ0XQGLDOGHOD6DOXGDOGtDGH-XQLRGH CARACTERÍSTICAS
Daños morfológicos
$EVRUFLyQGH'JOXFRVDYtD6*/7,
Absorción de Cl- por los enterocitos de las vellosidades
Secreción de Cl-SRUODVFpOXODVGHODFULSWD
Secreción neta de Cl0HGLDGRUHVLQWUDFHOXODUHVHQODVHFUHFLyQGH&O-
ENTEROTOXINA BACTERIANA*
No
Normal
'LVPLQXLGD
$XPHQWDGD
Masiva
cAMP o cGMP
ENTEROTOXINA VIRAL**
No
'HIHFWXRVD
$XPHQWDGD
Normal
Moderada
Ca++
Tabla 5.9. Características principales de las diarreas asociadas a toxinas de origen bacteriano y viral. *: Vibrio cholerae y Escherichia coli. **:3URWHtQDQRHVWUXFWXUDO 163 GHURWDYLUXV SGLT1:WUDQVSRUWDGRUGHVRGLR\JOXFRVD$GDSWDGRGH/RUURW0 9DVVHXU
M. Virol J
VIRUS
FACTOR ASOCIADO A PERSISTENCIA
EFECTO
Coxsackie
Deleciones en la región I del RNA genómico
Menor tasa de replicación en miocardio
ĺinfección persistente en miocardio
Sarampión
'HIHFWRHQODH[SUHVLyQGHORVJHQHV0+\)
,QIHFFLyQDERUWLYDHQHQFpIDORĺ3((6
LCMV
/DFHSDFORQGH/&09H[KLEHPD\RUWURSLVPRSRUFpOXODV
UHWLFXODUHV¿EUREOiVWLFDV &)5 \GHQGUtWLFDV3RVHHDPLQRiFLGRV
GLIHUHQWHVUHVSHFWRDODFHSD$UPVWURQJHQODJOLFRSURWHtQDGH
HQYROWXUD\RWURHQODSROLPHUDVD
0RGL¿FDFLyQGHOWURSLVPRYLUDO
(VWLPXODFLyQHQ&)5GHODH[SUHVLyQ
de 3'/ĺLQPXQRWROHUDQFLDPD\RU
replicación viral y agotamiento de LT
HBV
(O+%H$JDWUDYLHVDSODFHQWD
Deleción clonal de /7HVSHFt¿FRVSDUD
+%H$J\+%F$JĺLQPXQRWROHUDQFLD
Otros ejemplos de factores asociados a la SHUVLVWHQFLDYLUDOVHDERUGDUiQHQORVFDStWXORVHVSHFt¿FRVGHDTXHOORVYLUXVTXHSURGXFHQ
infecciones persistentes.
Tabla 5.10. Factores asociados a la persistencia viral: algunos ejemplos. PEES: SDQHQFHIDOLWLVHVFOHURVDQWHVXEDJXGDLCMV: 9LUXV
GHODFRULRPHQLQJLWLVOLQIRFLWDULDPD-L1 (Programmed Death –LLJDQG OLJDQGRGHODSURWHtQDGHPXHUWHSURJUDPDGD3' LT:OLQIRFLWR7
HBV: YLUXVKHSDWLWLV%HBe Ag y HBc AgDQWtJHQRH\DQWtJHQRGHOcore del YLUXVKHSDWLWLV%
119
Capítulo 5 / Patogenia de las infecciones virales
(a) Persistencia viral durante la infección crónica por HCV
Supresión mediada por miRNAs
Inducción de miRNAs
del hospedero
Bajos niveles
de replicación viral
Débil inducción de IFN
Inflamación
seguida de los
HCV mutantes
Hepatitis
A
Mutaciones
ocasionales en los
sitios de unión de
los miRNAs al HCV
B
B
A
A
Tiempo
(b) Manifestaciones agudas o intermitentes debido
a las mutantes de escape a los miRNAs
Replicación de las
cuasiespecies del HCV
con mutantes de escape
a miRNAs
Infiltrado
inflamatorio y
hepatitis
Fuerte respuesta de IFN
con inducción de miRNAs inefectivos
miRNA del hospedero inducido por IFN
HCV con sitios blanco para miRNAs del hospedero
HCV con mutaciones en los sitios blanco para miRNAs del hospedero
Figura 5.40. Mutantes de escape del HCV a los miRNAs celulares se asocian a la infección persistente.
A
B
Arm
Arm
CL-13
CL-13
Día 1
Día 3
Día 8
Día 30
GL - Día 30
Co-localización Co-localización Co-localización Co-localización
C
PD-L1
LAMININA
CO-LOCALIZACIÓN
Figura 5.41. Patrón reticular de la infección del bazo de ratones infectados con el virus de la coriomeningitis linfocitaria (LCMV).
A. 0LFURVFRStDySWLFDGHFRUWHVKLVWROyJLFRVGHED]RGHUDWRQHVLQIHFWDGRVGtDVDQWHVFRQODFHSD$UPVWURQJ $UP R&/GH/&09
PDUFDGRVSDUDGHWHFFLyQGHDQWtJHQRVYLUDOHVXWLOL]DQGRKHPDWR[LOLQDFRPRWLQFLyQGHFRQWUDVWHB.%D]R\JDQJOLROLQIiWLFRSHULIpULFR */
DODGHUHFKD PDUFDGRVSDUDGHWHFFLyQGHDQWtJHQRVGHOFLWRHVTXHOHWRGHODVFpOXODVUHWLFXODUHV¿EUREOiVWLFDV YHUGH \SDUDDQWtJHQRVGH
/&09 URMR DORV\GtDVSRVWLQIHFFLyQ SL /DVUHJLRQHVGHFRORUEODQFRLQGLFDQFRORFDOL]DFLyQ2EVpUYHVHTXHODLQIHFFLyQ
FRQODFHSD$UPVWURQJVHOLPLWDDORVGtDVPLHQWUDVTXHODSURGXFLGDSRUODFHSD/&09&/SHUVLVWHD~QDORVGtDVSL$OGtD
SRVWLQIHFFLyQDPEDVFHSDVVHORFDOL]DQHQOD]RQDPDUJLQDOH[KLELHQGRXQJUDGRVLPLODUGHLQIHFFLyQ$ORVGtDVSLODFHSD/&09
&/SXGRGHWHFWDUVHHQODSXOSDEODQFD\PiVLQWHQVDPHQWHHQODSXOSDURMDDOFDQ]DQGRHOPi[LPRDOGtDSL\SHUPDQHFLHQGRHQ
DOWRVQLYHOHVKDVWDHOGtDSL&RQWUDULDPHQWHODLQIHFFLyQFRQODFHSD$UPVWURQJSHUPDQHFLyORFDOL]DGDHQOD]RQDPDUJLQDOVLHQGR
FRQWURODGDDOGtD/RVDQWtJHQRVGHODFHSD/&09&/ SHURQR$UPVWURQJ FRORFDOL]DURQFRQODVFpOXODVUHWLFXODUHV¿EUREOiVWLFDV
$XPHQWR[ ED]R \[ */ %DUUDGHHVFDODȝP ED]R \ȝP */ C.0LFURVFRStDFRQIRFDOGHFRUWHVKLVWROyJLFRVGHED]R
de ratones infectados con LCMV CL-13 marcados para 3'/ YHUGH \ODPLQLQD URMR /DVUHJLRQHVHQEODQFRLQGLFDQFRORFDOL]DFLyQ/D
expresión de PD-L1 (Programmed death-Ligand HQODVFpOXODVUHWLFXODUHV¿EUREOiVWLFDVHYLWDVXPXHUWHDOLQWHUDFWXDUFRQODSURWHtQD
LQKLELWRULD3'H[SUHVDGDSRUlinfocitos T CD8+$XPHQWR[%DUUDGHHVFDODȝP'H0XHOOHU61et al. 31$6±
5HSURGXFLGRFRQDXWRUL]DFLyQ
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
120
individualmente cada molécula del sistema RNAi, sin que puedan
proponerse generalizaciones. De hecho, la actividad de células T
CD56+ mediante la vía ,)1Ȗĺ-$.67$7ĺ,)1ĮȕLQKLEHOD
concentración del miR-122 proviral y aumenta la del miR-196a
antiviral en hepatocitos.
Coxsackie. Es conocido que el daño agudo en el miocardio
infectado con virus &R[VDFNLH%RFXUUHSRUPHFDQLVPRVGLUHFWRV
DVRFLDGRV±HQWUHRWURV±DODHVWUXFWXUDHVSDFLDOGHOIRES del RNA
YLUDOTXHLQWHUDFW~DFRQIDFWRUHVGHWUDQVFULSFLyQHVSHFt¿FRV\DOD
H[SUHVLyQGHXQDSURWHDVDYLUDOTXHFOLYDDODGLVWUR¿QDDIHFWDQGR
HOFLWRHVTXHOHWR HLQGLUHFWRV PHGLDGRVSRUODUHVSXHVWDLQPXQH
FHOXODU7 8QHMHPSORGHODGLVPLQXFLyQGHOSRWHQFLDOOtWLFRYLUDO
para mantener una infección persistente es el producido por ciertas
cepas cardiovirulentas de &R[VDFNLH%HQFpOXODVFDUGtDFDVKXPDnas. Se ha documentado la presencia de cepas con deleciones de
KDVWDQWHQODUHJLyQ,GHO51$JHQyPLFRHQPXHVWUDVKLVWROygicas de corazón provenientes de pacientes con miocarditis agudas.
(VWiFRPSUREDGRTXHODDIHFWDFLyQGHHVWDUHJLyQJHQyPLFDSURGXce una marcada disminución en la tasa de replicación viral. Se ha
postulado que estos genomas delecionados se encuentran en todos
ORVWHMLGRVGRQGHUHSOLFD&R[VDFNLH%SHURTXHSRUIDFWRUHVPLFURDPELHQWDOHV SRUHMHPSORIDFWRUHVGHWUDQVFULSFLyQHVSHFt¿FRV
GHFpOXODVFDUGtDFDVHWF VXSHUDUtDQHQQ~PHUR±\HQHVFDVRWLHPSR±DORVJHQRPDVVDOYDMHV&DEHGHVWDFDUTXHDOWHQHUXQDPHQRU
WDVDGHUHSOLFDFLyQ±VRQFDVLLQGHWHFWDEOHVODVFiSVLGHVYLUDOHV\ORV
51$WDQWRGHSRODULGDG ± FRPR ±ODVFHSDVFRQJHQRPDVGHOHFLRQDGRVHYDGHQH¿FLHQWHPHQWHDODUHVSXHVWDLQPXQHDQWLYLUDOGHO
hospedero, permitiendo con esto la instauración y mantenimiento
de la infección persistente.
Sarampión. La SDQHQFHIDOLWLVHVFOHURVDQWHVXEDJXGD 3((6 PRINCIPALES
COMPONENTES
RESPUESTA
INNATA
consiste en una forma de infección persistente abortiva, progresiva
y fatal que ocurre varios años después del inicio de la misma. El
virus sarampión infecta el SNC aunque los neocomponentes de la
replicación viral no se incorporan a la membrana celular para formar virus completos. Como consecuencia de esta restricción -deSHQGLHQWHGHODFpOXODKRVSHGHUDVHDFXPXODQQXFOHRFiSVLGHVHQHO
interior de las células nerviosas. Esta patología ocurre en presencia
GHLQ¿OWUDGRV%\7\HOHYDGRVWtWXORVGHanticuerpos anti-saramSLyQ([LVWHXQGHIHFWRHQODH[SUHVLyQGHORVJHQHVGHHQYROWXUD
YLUDO\GHOJHQ0FRGL¿FDQWHGHODPDWUL]YLUDOFRQODFRQVLJXLHQWH
formación anormal de partículas. El defecto genético subyacente
FRQVLVWH HQ OD PDVLYD KLSHUPXWDFLyQ$ĺ* \ 8ĺ& GHO JHQRma viral recuperado a partir del SNC. Mediante hibridación in
situ se ha podido demostrar en el SNC secuencias genómicas de
virus sarampión antes de la aparición local de niveles detectables
de antígenos virales. Si bien no se forman viriones, se producen
FRPSOHMRVGHQXFOHRSURWHtQDVFRQGLVHPLQDFLyQWUDQVVLQiSWLFDGH
genomas y requerimiento de la proteína viral de fusión, pero en
ausencia del receptor viral. La recuperación de virus infeccioso a
partir del encéfalo sólo se obtiene mediante cocultivo con células
permisivas.
LCM(VWHIDVFLQDQWHPRGHORH[SHULPHQWDOPXULQRHVGHVDrrollado en este capítulo por la crucial trascendencia que tuvo su
conocimiento en la comprensión de otras infecciones persistentes
GHO KXPDQR FRPR ODV SURGXFLGDV SRU HBV, HCV y +,9 /D
cepa viral Armstrong de LCM produce en el ratón una infección aguda, mientras que la cepa clon 13GHHVWHYLUXV /&09
&/ SURPXHYHXQDinfección persistente, asociada a agotamiento de la respuesta T$PEDVFHSDVYLUDOHVVyORGL¿HUHQHQ
DPLQRiFLGRVHQVXVUHVSHFWLYDVJOLFRSURWHtQDVGHHQYROWXUD\
-
0DFUyIDJRV\QHXWUy¿ORV
NKT - macrófago
ĹH[SUHVLyQHQVXSHU¿FLH
FHOXODUGHOreceptor para
C3a
MECANISMO
EFECTOR
-
5DGLFDOHVOLEUHV2212
2122IL-13
5HFOXWDPLHQWRGH
eosinófilos
EJEMPLO
-
-
+HSDWLWLV& \PXFKDV
otras infecciones)
(QIHUPHGDGLQÀDPDWRULD
SXOPRQDUFUyQLFD SRVW
infección viral)
+LSHUUHDFWLYLGDGDpUHDHQ
la enfermedad por RSV
DJUDYDGDSRUYDFXQDFLyQ
previa
ADAPTATIVA
&HOXODU
-
CD4+ 7K
-
-
CD4+ 7K
-
-
CD8+ citotóxicos
-
+XPRUDO
$QWLFXHUSRV
-
5HFOXWDPLHQWRGH
PRQRQXFOHDUHV\
QHXWUy¿ORVTXHOLEHUDQ
enzimas proteolíticas,
radicales libres y 71)Į
KLSHUVHQVLELOLGDG
retardada)
?
5HFOXWDPLHQWRGH
HRVLQy¿ORV
+DSORWLSRVHVSHFt¿FRVGH
IL-13, IL-4 e IL-10
3HUIRULQDV71)Į
Fas/FasL, ,)1Ȗ,/ȕ
5HFOXWDPLHQWRGH
PRQRFLWRV\QHXWUy¿ORV
-
4XHUDWLWLVSRUYLUXVKHUSHV
simplex
-
1HXPRQtDHQOD
enfermedad por RSV
DJUDYDGDSRUYDFXQDFLyQ
previa
-
+HSDWLWLVSRU+%9
0LRFDUGLWLVSRUYLUXV
&R[VDFNLH%
6tQGURPHSXOPRQDUSRU
KDQWDYLUXV6LQ1RPEUH
,QPXQRFRPSOHMRV
$QWLFXHUSRVKHWHURWtSLFRV
facilitadores
-
-
'HQJXHKHPRUUiJLFR
Tabla 5.11. Mecanismos indirectos de daño hístico mediados por la respuesta inmune. *: La enfermedad por RSV agravada por vaFXQDFLyQSUHYLDVHFDUDFWHUL]DSRUQHXPRQtDHKLSHUUHDFWLYLGDGDpUHD/DSDGHFLHURQQLxRVTXHKDEtDQVLGRYDFXQDGRVHQODGpFDGDGH
FRQXQDYDFXQDLQDFWLYDGD\TXHOXHJRVHH[SXVLHURQDODLQIHFFLyQFRQFHSDVVDOYDMHVGHGLFKRYLUXV
Capítulo 5 / Patogenia de las infecciones virales
otro en la polimerasa. Recientemente, se ha documentado que la
infección de células dendríticas constituye un blanco importante
HQODLQIHFFLyQSRUODFHSD/&09&/6RUSUHQGHQWHPHQWHVH
pudo determinar que ésta infecta mayor número de células denGUtWLFDVTXHODFHSD$UPVWURQJ\DTXHHODPLQRiFLGRGHGLIHUHQFLD HQ VX JOLFRSURWHtQD GH HQYROWXUD OH FRQ¿HUH PD\RU D¿QLGDG
por el receptor alfa-distroglicano presente en dicha estirpe celular. Esta diferencia en el tropismo como determinante del curso de la infección –crónica vs aguda– determina la producción
inicial de IL-10 y ODHVWLPXODFLyQGHODH[SUHVLyQGHODPROpFXOD
pro-apoptótica PD-L1 Programmed Death-Ligand 1 HQODVcéOXODVGHQGUtWLFDVOXHJRGHODLQIHFFLyQFRQODFHSD/&09&/
que promueve la inactivación de /7DWUDYpVGHVXLQWHUDFFLyQFRQ
PD-1 YpDVHOD¿JXUDHQHOFDStWXOR 0HGLDQWHGLFKRVHYHQtos, esta cepa de LCMV produce una marcada disminución en la
inmunopatología mediada por los /7&'+FLWRWy[LFRVTXHOLPLtan la infección viral, previniendo así la destrucción de las céluODVLQIHFWDGDV IDYRUHFLHQGRHQHVWHVHQWLGRDOKRVSHGHUR \DVX
vez permitiendo la consiguiente persistencia viral en la infección
crónica. A su vez, –y a diferencia de la cepa Armstrong– LCMV
&/LQIHFWDVLJQL¿FDWLYDPHQWHFpOXODVUHWLFXODUHV¿EUREOiVWLFDV
FRQVWLWX\HQWHV GHO HVWURPD OLQIRLGH HQ ED]R \ JDQJOLR OR TXH
coadyuva a la inmunosupresión y a la persistencia viral. Dado
que dichas células proveen una microarquitectura tridimensional
para la migración, reclutamiento y activación de los linfocitos
HQORVyUJDQRVOLQIiWLFRVVHFXQGDULRVVXLQIHFFLyQ\FRPSURPLVR
IXQFLRQDO IDFLOLWD OD UiSLGD GLVHPLQDFLyQ YLUDO \ VX SHUVLVWHQFLD
)LJXUD$\% /DH[SUHVLyQGH3'/HQODVFpOXODVUHWLFXODUHV¿EUREOiVWLFDVLQIHFWDGDVFRQ/&09&/ )LJXUD& evita la inmunopatología local mediada por los OLQIRFLWRV7&'+
FLWRWy[LFRVSHURFRPSURPHWHFUXFLDOPHQWHWDQWRODUHVSXHVWDLQmune en curso como la futura.
La administración de anticuerpos anti-UHFHSWRUGH,/ RHO
XVRGHDQLPDOHVJHQpWLFDPHQWHGH¿FLHQWHVSDUDSURGXFLUGLFKDFLWRTXLQD RDQWL3'/EORTXHDODinmunosupresión por vías independientes, y transforma la infección persistente crónica en aguda,
UHVWDEOHFLHQGRODDFWLYLGDG7\SURYH\HQGRPHPRULDLQPXQROyJLFD (VWDV LQYHVWLJDFLRQHV EiVLFDV FRQVWLWX\HURQ XQD KHUUDPLHQWD
singular para la comprensión de la patogénesis molecular de infecciones persistentes del humano con compromiso de la respuesta
7 SRUHIV, HBV, +&9 HWF \ SDUDHODQiOLVLVGH XQD SRWHQFLDO
modulación terapéutica.
6.4. MECANISMOS INDIRECTOS DE LESIÓN CELULAR
&RPR VH PHQFLRQy HQ SiUUDIRV DQWHULRUHV ORV YLUXV SXHGHQ R QR
VHUFLWRSiWLFRV+DELWXDOPHQWHHQHOKRVSHGHURLQPXQRFRPSHWHQWH
XQD LQIHFFLyQ DJXGD SRU XQ YLUXV FLWRSiWLFR HV HOLPLQDGD SRU XQD
DGHFXDGDUHVSXHVWDLQPXQH(QFRQWUDSRVLFLyQORVYLUXVQRFLWRSiticos pueden causar infecciones persistentes en las que la mayoría
de las manifestaciones clínicas de la enfermedad son promovidas
probablemente por mecanismos indirectos asociados a la participaFLyQ PXFKDVYHFHVH[DFHUEDGD GHODUHVSXHVWDLQPXQHDORFXDO
se denomina inmunopatología. La misma puede ser causada por
ODUHVSXHVWDLQPXQHLQQDWD SRUHMHPSORODIRUPDFLyQGHUDGLFDOHV
OLEUHV \R DGDSWDWLYD FHOXODU SULQFLSDOPHQWH 7 \R KXPRUDO % 7DEOD 8QFDVRHVSHFLDOORFRQVWLWX\HQDOJXQDVenfermedades
de naturaleza autoinmune en las que se dispara una respuesta antitisular, a la que posiblemente contribuirían algunas infecciones viraOHV GHELGRDOPLPHWLVPRPROHFXODUGHFLHUWRVHStWRSHVYLUDOHVFRQ
DOJXQRVFHOXODUHV (ODQiOLVLVGHVHFXHQFLDVDPLQRDFtGLFDVPHGLDQWH
ordenadores ha demostrado homología entre regiones de proteínas
EiVLFDVGHODPLHOLQDKXPDQD\SURWHtQDVGHGLIHUHQWHVYLUXVHQWUH
ORVFXDOHVVHHQFXHQWUDQORVWLSRV$\%GHOYLUXVLQÀXHQ]DVDUDPpión, Epstein-Barr, parotiditis, vaccinia, varicela-zóster y otros. Ello
podría asociarse a las neuritis y encefalomielitis desmielinizantes
post-infecciosas a veces observadas como reacción inmunológica
cruzada. En ellas, el virus no necesita estar presente, una vez que
se ha disparado la respuesta inmune, para producir las lesiones en
121
las células diana que comparten los determinantes antigénicos con
las proteínas virales. Este mimetismo molecular también contribuye –parcialmente– al desencadenamiento de manifestaciones graves
por virus dengue mediadas por DQWLFXHUSRVDQWL16TXHSURGXFHQ
UHDFFLRQHVFUX]DGDVVREUHDQWtJHQRVGHVXSHU¿FLHGHOHQGRWHOLRFDSLODU )LJXUD En casos muy particulares, puede desencadenarse abruptamente un VtQGURPHGHUHVSXHVWDLQÀDPDWRULDVLVWpPLFD VHPHMDQWHDO
REVHUYDGRHQHOFKRTXHWy[LFR\ODVHSVLVWy[LFDFDXVDGRVSRURWURV
PLFURRUJDQLVPRV ODTXHHVLQGXFLGDSRUXQDV~ELWDOLEHUDFLyQGH
FLWRTXLQDV £XQD YHUGDGHUD WRUPHQWD GH FLWRTXLQDV SURLQÀDPDWRULDV Los mecanismos indirectos de daño hístico mediados por los
OLQIRFLWRV7 VRQ ORV PiV \ PHMRU HVWXGLDGRV DXQTXH WDPELpQ
las células NK, las NKT, los polimorfonucleares y los macrófagos participan en grado y circunstancias diversas en las lesiones
mediadas y moduladas por /7(OGDxRWLVXODUSXHGHHVWDUPHGLDGR
principalmente por la población de linfocitos T CD4+ y/o CD8+ citotóxica. La población de /7CD4+ a su vez puede corresponder
DODTXHSRVHHXQSHU¿OGHDFWLYLGDGTh1 o Th2.
Radicales libres 6X JHQHUDFLyQ GXUDQWH OD UHVSXHVWD LQÀDmatoria puede estar asociada al daño promovido principalmente
SRUHOy[LGRQtWULFR NO SURGXFLGRDSDUWLUGHODR[LGDFLyQGH
/DUJLQLQD GDQGR RULJHQ D FLWUXOLQD \ 12 \ SRU HO DQLyQ VXSHUy[LGR O2- JHQHUDGRSRUODHQ]LPD[DQWLQDR[LGDVDSUHVHQWH
en fagocitos. Ambas especies pueden reaccionar entre sí formanGR SHUR[LQLWULWRV ONOO- TXH ±D VX YH]± SXHGHQ PHGLDU ORV
HIHFWRV Wy[LFRV GHO 2-, ya que algunos virus y células no son
afectados por este último. El aumento de NO en una célula puede
REHGHFHUDODXPHQWRGHVXVtQWHVLV SRUPLHPEURVGHODIDPLOLD
GHODV12VLQWHWDVDV 126 RDXQGHIHFWRHQVXHOLPLQDFLyQ/DV
126SXHGHQH[SUHVDUVHFRQVWLWXWLYDPHQWHHQQHXURQDV\FpOXODV
HQGRWHOLDOHVRLQGXFLUVH DFWLYiQGRVHODHQ]LPDLQGXFLEOHL126 debido a la acción de FLWRTXLQDV SURLQÀDPDWRULDV FRPR ,/
71)ĮH,)1ȖSULQFLSDOPHQWHHQPDFUyIDJRVLas especies reactivas del oxígeno y del nitrógeno modulan la permisividad
celular a la replicación viral. Los radicales libres mencionados
VRQLPSRUWDQWHVPHGLDGRUHVGHODUHVSXHVWDLQÀDPDWRULD\SXHGHQ
participar del daño hístico, como fue demostrado en múltiples
LQIHFFLRQHV LQFOX\HQGR ODV SURGXFLGDV H[SHULPHQWDOPHQWH FRQ
YLUXV LQÀXHQ]D \ FLWRPHJDORYLUXV HQ HO SXOPyQ GH UDWRQHV (O
contenido lipídico enriquecido del SNC es particularmente susFHSWLEOHDODSHUR[LGDFLyQOLStGLFDXQSURFHVRGHGDxRDXWRFDWDlítico de estructuras lipídicas que genera productos de desecho,
TXHSXHGHQDOWHUDUPDFURPROpFXODVFHOXODUHV(OGDxRR[LGDWLYR
es un componente de la HQFHIDOLWLV FDXVDGD SRU KHUSHV VLPSOH[
WLSR OD HQIHUPHGDG QHXURGHJHQHUDWLYD SURPRYLGD SRUHIV, y
de la panencefalitis esclerosante subaguda producida por virus
sarampión.
Ciertos virus al infectar una célula también pueden inducir
la producción de radicales libres efecto viral directo OR TXH
puede promover la inestabilidad cromosómica y el eventual desarrollo de tumores, tal como se observa en un determinado porFHQWDMH GH ODV LQIHFFLRQHV SHUVLVWHQWHV SURGXFLGDV HQ hepatocitos
por HBV y HCV o en linfocitos B por EBV.
Circuito NKT-Macrófago-IL-13. /DDFWLYDFLyQGHHVWHHMHGH
ODLQPXQLGDGLQQDWDSURYHHHOQH[RHQWUHODLQIHFFLyQYLUDODJXGD
inicial y –a través de una respuesta innata activada persistentemente– el daño hístico de la enfermedad crónica. Estos hallazgos tienen
especial relevancia en la comprensión de los mecanismos patogénicos subyacentes del asma y de la enfermedad obstructiva crónica
SXOPRQDUGHOKXPDQR )LJXUD Linfocitos T CD4+. Estos linfocitos modulan gran parte de
ODUHVSXHVWDLQPXQHSURGXFLHQGRXQYDVWRFRQMXQWRGHcitoquiQDV\UHFOXWDQGR\DFWLYDQGRFpOXODVLQHVSHFt¿FDVFRPRORVpoliPRUIRQXFOHDUHVQHXWUy¿ORV\PRQRFLWRVTXHSXHGHQSURPRYHUHO
GDxRKtVWLFR UHDFFLyQGHKLSHUVHQVLELOLGDGUHWDUGDGD PHGLDQWH
la liberación de 71)ĮHQ]LPDVSURWHROtWLFDV\UDGLFDOHVOLEUHV
&RPRUHJODSUHOLPLQDU \PX\JHQHUDO VHDVXPHTXHODVLQIHF-
122
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
FLRQHVSHUVLVWHQWHVSRUYLUXVQRFLWRSiWLFRVSURPXHYHQXQDUHVpuesta CD4+ inmunopatológica, mientras que ante la infección
SRUYLUXVFLWRSiWLFRVGLFKDUHVSXHVWDFHOXODUHVSURWHFWRUDDXQque pueden promoverse también eventos de daño tisular.
Linfocitos T CD4+ Th1. (QEDVHDHVWXGLRVH[SHULPHQWDOHVUHDlizados en ratones inoculados con diversos virus, se ha demostrado
que ciertas infecciones virales persistentes del encéfalo promueven
una respuesta mediada por linfocitos CD4+ 7K SRVWXOiQGRVH OD
participación del 71)Į\GHUDGLFDOHVOLEUHVSURGXFLGRVSRUPDFUyIDJRVDFWLYDGRVFRPRFDXVDGHOGDxR YpDVHHOtWHPDQWHULRU (O71)ȕSRGUtDHVWDUDVRFLDGRDORVHYHQWRVGHGHVPLHOLQL]DFLyQ
de los oligodendrocitos. /D TXHUDWLWLV HVWURPDO KHUSpWLFD XQD
grave lesión ocular que produce opacidad y puede conducir a la
FHJXHUD está mediada por linfocitos T CD4+ Th1 TXHH[SUHVDQ
los receptores para quimioquinas &&5\&;&5 , con la participación de polimorfonucleares y células presentadoras de antígeno.
La atmósfera local de ,)1Ȗ,/Į,/H,/HVLPSRUWDQWHHQ
la SDWRJpQHVLVREVHUYiQGRVHTXHORVQLYHOHVGH0,3ĮHOHYDGRV
agravan la lesión. En ciertas circunstancias también participan células NK y linfocitos B. La queratitis acontece como consecuencia
GHODLQLFLDOLQIHFFLyQGHOHSLWHOLRFRUQHDOTXHSURPXHYHXQLQ¿OWUDGRLQÀDPDWRULRHQHOHVWURPDSURGXFWRGHODDFWLYDFLyQGHFpOXODVQRLQIHFWDGDVDOOtORFDOL]DGDV DFWLYDFLyQFHOXODUbystander Linfocitos T CD4+ Th2. (VWDHVWLUSHFHOXODUHVWiLQYROXFUDGD
en las lesiones observadas en la EURQTXLROLWLVSRUYLUXVVLQFLFLDO
respiratorio (RSV), como se demostró al utilizar ratones inmunosuprimidos infectados con 569 HQORVTXHODVOHVLRQHVHUDQOLPLWDGDV \UHFRQVWLWXLGRVFRQODSREODFLyQCD4+ Th2 DJUDYiQGRVHODV
PLVPDV (VWHYLUXVHVFDXVDGHHQIHUPHGDGJUDYHHQDQFLDQRV\HQ
PHQRUHVGHDxRV$XQTXHHOPHFDQLVPRGHOHVLyQQRVHFRQRFH
HQSURIXQGLGDGHVSUREDEOHTXHHOUHFOXWDPLHQWRGHHRVLQy¿ORVHQ
HOWHMLGRGDxDGRVHDPHGLDGRSRUSURGXFWRVGHULYDGRVGHORVlinfocitos 7K
Modulación de la respuesta innata y del balance entre
linfocitos T CD4+ Th1 y Th2. (QODGpFDGDGHVHGHVDUURlló una vacuna a virus completo inactivada para evitar la grave
bronquiolitis asociada a RSV. Sorpresivamente, se documentó
que aquellos que habían sido vacunados, desarrollaban posteriorPHQWHDQWHODLQIHFFLyQFRQHOYLUXVVDOYDMHXQFXDGURDXQPiV
FUtWLFR enfermedad por RSV agravada [ERA] por la vacunación previa TXHHOTXHSDGHFtDQORVQRYDFXQDGRVDVRFLDGR
D KLSHUUHDFWLYLGDG DpUHD \ QHXPRQtD FRQ LQ¿OWUDGRV HRVLQRItOLcos, siendo estos dos los componentes principales de la ERA.
Ello devino en la suspensión de la aplicación de dicha vacuna.
$SUR[LPDGDPHQWHGpFDGDVGHVSXpVVHSXGRGHVFXEULUHOHQLJPiWLFRHYHQWR(OFLHQWt¿FRDUJHQWLQR)HUQDQGR3ROODN\VXJUXSR
establecieron en un modelo murino y en material de autopsia de
los niños que habían padecido la ERA, que la hiper-reactividad
DpUHD \ OD HRVLQR¿OLD SXOPRQDU HUDQ PHGLDGDV SRU LQPXQRcomplejos 0iV D~Q HQ VXEVLJXLHQWHV HVWXGLRV GRFXPHQWDURQ
HOUROPRGXODGRUQHJDWLYRGH&VREUHODH[SUHVLyQGHOreceptor
SDUD&D &D5 \DTXHHOXVRGHUDWRQHV&GH¿FLHQWHVH[KLEtDQXQDXPHQWRGHO&D5HQFpOXODVHSLWHOLDOHV\HQHOP~VFXOR
OLVREURQTXLDO(OXVRGHDQWDJRQLVWDVSDUD&D5VHDVRFLyDOD
atenuación de la secreción bronquial, la hiper-reactividad aérea
\ODHRVLQR¿OLDSXOPRQDU$QWHQLYHOHVQRUPDOHVGHH[SUHVLyQGH
dicho UHFHSWRUODHRVLQR¿OLDHVSURPRYLGDSRUODDFWLYLGDGGHlinfocitos CD4+ 7KODTXHHVUHJXODGDQHJDWLYDPHQWHSRUHO,)1Ȗ
secretado desde los OLQIRFLWRV7&'+. Recientemente, el mismo
grupo estableció que la falta de protección de la vacuna inactivada administrada en esa época y la consiguiente ERA es atribuible
a la falta de avidez de los anticuerpos por epítopes protectores,
GDGD OD UHVWULQJLGD HVWLPXODFLyQ GH UHFHSWRUHV7ROOVtPLO 7/5 TXHLPSHGtDXQDDGHFXDGDPDGXUDFLyQGHODD¿QLGDG
Linfocitos T citotóxicos (CTLs) CD8+. Estas células desempeñan un rol crucial en la limitación y eliminación de las infecciones virales, mediante PHFDQLVPRV QR FLWROtWLFRV PHGLDGRV
principalmente por ,)1Ȗ \ 71)Į \ FLWROtWLFRV PHGLDGRV SRU
perforinas, ya que ni las granzimas ni el sistema )DV)DV/VHUtDQ
WDQUHOHYDQWHV 6LQHPEDUJRHVWDSREODFLyQFHOXODUDVXYH]SXHGH
UHFOXWDUFpOXODVLQHVSHFt¿FDVFRPRSROLPRUIRQXFOHDUHVQHXWUy¿ORV
\PRQRFLWRVTXHDPSOL¿FDQODUHDFFLyQLQÀDPDWRULD\SURPXHYHQ
daño hístico.
/DLQIHFFLyQH[SHULPHQWDOFRQHOYLUXVLCM permitió establecer las bases del conocimiento donde lesiones tisulares son mediadas por OLQIRFLWRV7&'+, población que a través de perforinas
promueve el daño celular, y mediante la liberación de citoquinas
SURLQÀDPDWRULDV ,/,/71)Į\71)ȕ DWUDHRWUDVFpOXODV
LQÀDPDWRULDV(OHBV no produce habitualmente per se alteraciones morfológicas en hepatocitos de humanos inmunocompetentes, a pesar de los muy elevados niveles de producción viral
GLDULD SDUWtFXODV SRUSHUtRGRVTXHSXHGHQH[WHQGHUVH
varias décadas. (V OD UHVSXHVWD LQÀDPDWRULD LQHVSHFt¿FD QHXWUy¿ORV\PDFUyIDJRV GHSHQGLHQWHWRWDOPHQWHGHODSUHVHQFLD
de los linfocitos T CD8+ODTXHDPSOL¿FDUiODOHVLyQKHSDWRFttica también promovida por éstos. La eventual eliminación de la
LQIHFFLyQYLUDORFXUUHSRUPHFDQLVPRVQRFLWROLWLFRV PHGLDGRVSRU
,)1Ȗ\71)Į \SRUPHFDQLVPRVLQPXQHVFLWROtWLFRVWDOFRPR
VHGRFXPHQWyHQIDVFLQDQWHVH[SHULPHQWRVHQUDWRQHVWUDQVJpQLFRV
\ HQ SULPDWHV 8Q UDWyQ TXH H[SUHVD HO WUDQVJpQ GHO DQWtJHQR GH
VXSHU¿FLHGHO+%9 +%V$J QRGHVDUUROODSDWRORJtD SXHVUHFRQRFH DO DQWtJHQR FRPR SURSLR 6LQ HPEDUJR DO VHU LQPXQL]DGR
DGRSWLYDPHQWH FRQ &7/V &'+ KLVWRFRPSDWLEOHV \ HVSHFt¿FRV
para epítopes del +%V$JGHVDUUROODHQSRFDVKRUDVXQLQ¿OWUDGR
KHSiWLFRFRQVWLWXLGRSRUHVWDVFpOXODVTXHVHPHMDODVOHVLRQHVREservadas en la hepatitis B del humano, y en las que se visualizan
FpOXODVDSRSWyWLFDV(VWXGLRVUHDOL]DGRVHQFKLPSDQFpVSRU)UDQFLV
&KLVDULGRFXPHQWDURQTXH±LQLFLDOPHQWHODV&7/V&'+ promueven la eliminación no citolítica del virus en hepatocitos, siguiendo
GtDVGHVSXpVXQDHOLPLQDFLyQFLWROtWLFD FRQVXEDGHODVWUDQVDPLQDVDV /RVCTLs CD8+ son imprescindibles para promover la
patología, pero la lesión es fundamentalmente asociada a la
presencia de macrófagos y polimorfonucleares y a las FLWRTXLnas liberadas en el sitio de la lesión7DPELpQODmiocarditis aguda promovida en humanos por el virus Coxsackie BHVWiDVRFLDGR
a la actividad de CTLs CD8+ \ ±VHJ~Q HO PRGHOR H[SHULPHQWDO
murino– fundamentalmente relacionada con la actividad de perforinas.5DWRQHVJHQpWLFDPHQWHGH¿FLHQWHVHQODSURGXFFLyQGHODV
mismas, desarrollan lesiones leves, aunque se produce igualmente
la HOLPLQDFLyQ YLUDO /DV OHVLRQHV VRQ SUREDEOHPHQWH H[DFHUEDdas por FLWRTXLQDVFRPR,/ȕ\71)Į\SRUTXLPLRTXLQDV TXH
DWUDHQPiVOLQIRFLWRV FRPR0,3Į/HVLRQHVPHGLDGDVSRU&7/V
&'+ han sido reportadas también en el síndrome pulmonar por el
hantavirus Sin Nombre.
Anticuerpos facilitadores e inmunocomplejos. El dengue es
XQD HQIHUPHGDG FRQRFLGD FRPR ¿HEUH TXHEUDQWDKXHVRV DVRFLDGDDLQWHQVDFHIDOHDH[DQWHPD\DGRORUHVGHHVSDOGD\PLHPEURV
([LVWHQ4 serotipos del virus dengue, los que no inducen protección
KHWHURWtSLFD0iVD~QODLQIHFFLyQSRUHVWHYLUXVSXHGHDVRFLDUVHD
FXDGURVVHYHURVFXDQGRDFDHFHHQXQLQGLYLGXRTXHSUHYLDPHQWH
hubo sido infectado por un serotipo diferente al de la infección
en curso'LFKRHYHQWRHVWiUHODFLRQDGRFRQHOUROTXHGHVHPSHxDQ
anticuerpos circulantes no neutralizantes frente a epítopes del virus
infectante. Dichos anticuerpos son reconocidos por receptores para
)FȖGHORVPRQRFLWRVSHULIpULFRVQRUPDOPHQWHQRVXVFHSWLEOHVTXH
facilitan el ingreso viral y promueven una mayor replicación viral en
HORUJDQLVPR SRWHQFLDFLyQYLUDO (OORGHYLHQHHQXQDPD\RUSURducción de FLWRTXLQDV SURLQÀDPDWRULDV TXH DWUDHQ PiV linfocitos,
ORVTXH±DVXYH]±SURGXFHQPiVcitoquinas. Éstas y otros mediaGRUHVTXtPLFRVIDYRUHFHQHOGHUUDPHSODVPiWLFRDVRFLDGRDOD¿HEUHKHPRUUiJLFDSRUGHQJXH/D"potenciación viral" promovida
por anticuerpos heterotípicos no protectores es una de las causas
SRVWXODGDV SDUD OD PD\RU LQFLGHQFLD GH OD ¿HEUH KHPRUUiJLFD SRU
GHQJXH\HOFKRTXHSRUGHQJXH/D¿HEUHKHPRUUiJLFDSRUGHQJXH
SXHGHRFXUULUHQODSULPRLQIHFFLyQFRQXQDLQFLGHQFLDGH
LQIHFFLRQHVSHURODPLVPDDVFLHQGHDHQODUHLQIHFFLyQFRQXQ
VHURWLSRGLIHUHQWHREVHUYiQGRVHHOFKRTXHSRUGHQJXHHQGHFDGD
LQGLYLGXRVUHLQIHFWDGRVGHHVWDPDQHUD$YDODQGRHOUROGHORVan-
123
Enfermedad
Detección viral
Capítulo 5 / Patogenia de las infecciones virales
4
8
12
16
18
Días post-infección
20
22
24
Virus infeccioso
Enfermedad
Enfermedad
Detección viral
Figura 5.42. Infección aguda subclínica. (MHPSORLQIHFFLyQSRUYLUXVKHSDWLWLV$GHQWURGHOSULPHUDxRGHYLGD
-4
-2
0
2
4
6
Días de aparición de la enfermedad
8
Virus infeccioso
Enfermedad
Figura 5.43. Infección aguda con manifestaciones clínicas. (MHPSORLQIHFFLyQSRUYLUXVVDUDPSLyQ
10
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
Enfermedad
Detección viral
124
2
3
4
1
2
3
Semanas / Años post-infección
Virus infeccioso
Enfermedad
4
5
Nucleocápside en SNC
Genoma viral en SNC
Enfermedad
Detección viral
Figura 5.44. Infección persistente lenta abortiva con manifestaciones tardías.(MHPSORSDQHQFHIDOLWLVHVFOHURVDQWHVXEDJXGD 3((6 SRUYLUXVVDUDPSLyQ
4
8
12
16
18
20
Meses después del nacimiento
22
Virus infeccioso
Enfermedad
Figura 5.45. Infección persistente con manifestaciones clínicas. (MHPSORUXEpRODFRQJpQLWD
24
125
Enfermedad
Detección viral
Capítulo 5 / Patogenia de las infecciones virales
4
8
12
16
18
Meses post-infección
20
22
24
Virus infeccioso
Enfermedad
Enfermedad
Detección viral
Figura 5.46. Infección persistente subclínica. (MHPSORLQIHFFLyQQHRQDWDOSRUYLUXVKHSDWLWLV%
2
Días
4
6
Meses - años
Virus infeccioso
Enfermedad
Días post-infección
Ausencia de virus
Genoma viral en SN
Figura 5.47. Infección persistente latente. (MHPSORLQIHFFLyQSRUYLUXVKHUSHVVLPSOH[
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
Enfermedad
Detección viral
126
0
15
Años post-infección
Virus infeccioso
Enfermedad
Enfermedad
Detección del agente
Figura 5.48. Infección persistente con transformación celular tardía.(MHPSORLQIHFFLyQSRUYLUXVKHSDWLWLV%DVRFLDGRDOKHSDWRFDUFLQRPD
0
1
2
3
4
5
Años post-infección
Agente infeccioso
Enfermedad
Figura 5.49. Infección persistente lenta. (MHPSORNXUX
6
7
8
Capítulo 5 / Patogenia de las infecciones virales
ticuerpos facilitadores en esta infección, se ha documentado una alta
incidencia de casos graves de infección por dengue en menores de 1
DxRQDFLGRVGHPDGUHVTXHOHWUDQV¿ULHURQSDVLYDPHQWHDWUDYpV
de la placenta anticuerpos IgG contra un serotipo diferente al de
su propia infección (O ULHVJR GH GHQJXH KHPRUUiJLFR GLVPLQX\H
ostensiblemente en los niños con el devenir del tiempo, asociado a la
concentración y vida media de la IgG materna transferida.
Depósito de inmunocomplejos. /RV LQPXQRFRPSOHMRV SURmueven la activación del sistema complemento y del sistema de
TXLQLQDV pVWDVDWUDYpVGHOIDFWRU+DJHPDQ \ODDJUHJDFLyQSODTXHWDULD(OIDFWRUTXLPLRWiFWLFRGHOcomplemento atrae polimorfonucleares que a su vez liberan enzimas lisosomales. Estas, en
combinación con las aminas vasoactivas liberadas, desencadenan
ODVOHVLRQHVLQÀDPDWRULDVTXHSURGXFHQHOGDxRFHOXODU6LODUHDFFLyQFRQWLQ~DPiVDOOiGHOSHUtRGRDJXGRORVpolimorfonucleares
son reemplazados por células mononucleares. Los factores que deWHUPLQDQHOJUDGRGHGDxRPHGLDGRSRUFRPSOHMRVLQPXQHVVRQORV
VLJXLHQWHVWDPDxRGHOFRPSOHMRSURSRUFLyQUHODWLYDGHODQWtJHQR\
GHODQWLFXHUSRQDWXUDOH]DGHODUHGGHOFRPSOHMRtipo de antígeno,
HVSHFL¿FLGDG GHO DQWLFXHUSR \ VX DYLGH] SRU HO DQWtJHQR FODVH \
subclase de inmunoglubulinas y grado de activación de macrófagos.
6L ORV LQPXQRFRPSOHMRV VH IRUPDQ HQ H[FHVR GH DQWtJHQRV \
con DQWLFXHUSRVGHEDMDD¿QLGDGQRVHUiQUHPRYLGRVGHFLUFXODción mediante las células retículo-endoteliales que poseen receptoUHVSDUD)F3UREDEOHPHQWHVHIRUPHQLQPXQRFRPSOHMRVHQODPD\RUtDGHODVLQIHFFLRQHVYLUDOHVODH[LVWHQFLDGHDQWtJHQRVYLUDOHV
HQH[FHVRDOPRPHQWRGHJHQHUDUVHODUHVSXHVWDLQPXQHFRQVWLWX\H
XQ SDVR WUDQVLWRULR KDFLD HO SRVWHULRU H[FHVR GH anticuerpos. Sin
HPEDUJRODIRUPDFLyQGHLQPXQRFRPSOHMRVSXHGHVHUSURORQJDGD
en el caso de las infecciones persistentes, como se conoció inicialmente en la infección de ratones lactantes inmunocompetentes infectados con virus /&0 TXH GHVDUUROODQ LQPXQRFRPSOHMRV
circulantes asociados a glomerulonefritis. En las infecciones persistentes se liberan partículas virales o algunos de sus antígenos
de manera continua en presencia de una respuesta de anticuerpos
FXDOLWDWLYDPHQWHGH¿FLHQWH EDMDD¿QLGDGRGLULJLGDFRQWUDHStWRSHV
QRFUtWLFRV RHQFDQWLGDGHVPtQLPDV
El daño hístico mediado por complejos inmunes puede localizarse en riñóQ SRUHMHPSORglomerulonefritis observadas en
el curso de las KHSDWLWLV%SRUFRPSOHMRVIRUPDGRVSRUHODQWtJHQR
GHVXSHU¿FLH\HODQWLFXHUSRHVSHFt¿FR>HBs Ag / DQWL+%[email protected]
DQWtJHQRWDPELpQVHFUHWDGRGHVGHODFpOXOD +%H$J FRQHODQWLFXHUSRHVSHFt¿FR>DQWL+%[email protected], HCMV,
HIV o VDUDPSLyQ SHTXHxRVYDVRVGHODSLHO DOJXQRVH[DQWHPDV
virales o en los pródromos de la enfermedad por +%9 SHTXHxDV
arterias arteritis en infectados con HCMV, HIV o VDUDPSLyQ
periarteritis nodosa observada en pacientes con KHSDWLWLV% RarticulacioneV artritis observada con algunos arbovirus, erythrovirus
>[email protected] KXPDQR % R UXEpROD 2WUR VLWLR SUHIHUHQFLDO GH
GHSyVLWRGHLQPXQRFRPSOHMRVHVHOplexo coroideo. A su vez, se
han detectado depósitos de antígenos de virus sarampión y de sus
DQWLFXHUSRVHVSHFt¿FRVHQHOSNC de pacientes con panencefalitis
HVFOHURVDQWHVXEDJXGD 3((6 (VWXGLRVUHFLHQWHVVXJLHUHQTXHODV
KHSDWLWLV % IXOPLQDQWHV VH DVRFLDQ D LQPXQRFRPSOHMRV IRUPDGRV
por antígeno del core del +%9 +%F$J H[SUHVDGRVHQhepatocitos y DQWLFXHUSRVHVSHFt¿FRVVLQWHWL]DGRVHQHOKtJDGRSRUSODVmocitos, con depósito de FRPSOHPHQWR(QPRGRDQiORJRVHKD
REVHUYDGR TXH ORV FDVRV JUDYHV GH JULSH SDQGpPLFD +1
en personas de mediana edad estuvieron asociados a la presencia
de anticuerpos circulantes anti-KHPDJOXWLQLQD + GH EDMD DYLGH]
\ DO GHSyVLWR SXOPRQDU GH LQPXQRFRPSOHMRV GH EDMD DYLGH] FRQ
activación del complemento.
7. MODELOS
DE INFECCIÓN
El desenlace de una infección viral en el organismo humano es variable. Puede ocurrir una infección subclínica o bien desarrollarse
signos y síntomas inducidos por la alteración celular ocasionada
127
SRUHOYLUXV\RODUHVSXHVWDGHOKRVSHGHUR/DUHVXOWDQWH¿QDOHV
dependiente de múltiples factores: dosis infectante, puerta de entrada, vía de diseminación, tropismo viral, virulencia del microorganismo, edad, estado nutricional y carga genética del hospedero y
su respuesta inmune innata y adaptativa frente al agente.
7.1. INFECCIONES AGUDAS
Muchos virus producen infecciones limitadas en el tiempo. Estos
virus son eliminados del organismo en pocos días o semanas. Para
ello, el hospedero desarrolla diversos mecanismos de la respuesta
LQQDWD SRUHMHPSORHOVLVWHPDLQWHUIHUyQ \DGDSWDWLYD anticuerSRVHLQPXQLGDGFHOXODU GHdefensa.
Cierta proporción de las infecciones virales agudas del ser humaQRFXUVDHQIRUPDDVLQWRPiWLFDVHSURGXFHODUHSOLFDFLyQYLUDOHQDXsencia de manifestaciones clínicas. Son las llamadas infecciones aguGDVVXEFOtQLFDVRLQDSDUHQWHV )LJXUD (OORRFXUUHSRUHMHPSOR
HQHOGHODVLQIHFFLRQHVFRQYLUXVSROLRHOGHORVLQIHFWDGRV
FRQYLUXVSDURWLGLWLV\HQPiVGHOGHODVLQIHFFLRQHVFRQYLUXV
KHSDWLWLV$ FDVLHQHOGHODVTXHDFRQWHFHQGXUDQWHHOSULPHU
DxRGHYLGD Se ha postulado que la síntesis temprana de interferón, con el
consiguiente estado antiviral que éste induce sobre las células, favorecería el curso subclínico de algunas infecciones virales.
Por el contrario, en ciertas infecciones agudas la replicación
YLUDO VH DFRPSDxD GH VtQWRPDV FOtQLFRV HOOR VH REVHUYD IUHFXHQtemente en LQÀXHQ]D )LJXUD ¿HEUHDPDULOODHOGHORV
infectados con SROLR GHpVWHSRUFHQWDMHVyORHOGHVDUUROOD
HQIHUPHGDGSDUDOtWLFD \PXFKDVRWUDVLQIHFFLRQHV
El virus sarampión también produce habitualmente una infecFLyQDJXGDVLQWRPiWLFD PX\DOWDSDWRJHQLFLGDG 6LQHPEDUJRHQ
XQD SURSRUFLyQ GH O GH FDGD GH HQIHUPRV VH SXHGH
observar una rara complicación tardía: es la panencefalitis escleroVDQWHVXEDJXGD 3((6 ODTXHVHDQDOL]DHQHOSUy[LPRtWHP
7.2. INFECCIONES PERSISTENTES
Ciertos virus pueden permanecer en el organismo por períodos proORQJDGRV PHVHVDxRV\DXQGXUDQWHWRGDODYLGD 6RQORVDJHQWHV
productores de infecciones persistentes. Éstas pueden –a su vez–
estar o no asociadas a manifestaciones clínicas.
Entre las infecciones persistentes comprendidas en el primer
grupo podrían mencionarse la PEES y la infección congénita con
virus rubéola.
La PEES es una forma de infección persistente lenta abortiva
en la cual el virus sarampión infecta el SNC aunque los neocomponentes de la replicación viral no se incorporan a la membrana
celular para formar virus completos. Como se mencionó en una
VHFFLyQ DQWHULRU H[LVWH XQ GHIHFWR HQ OD H[SUHVLyQ GH ORV JHQHV
0 + \ ) FRQ OD FRQVLJXLHQWH IRUPDFLyQ DQRUPDO GH SDUWtFXODV
Como consecuencia de esta restricción –dependiente de la célula
KRVSHGHUD±VHDFXPXODQQXFOHRFiSVLGHVHQHOLQWHULRUGHODVFpOXlas nerviosas. Mediante hibridación in situ se ha podido demostrar
en el SNC secuencias genómicas de virus sarampión antes de la
DSDULFLyQORFDOGHQLYHOHVGHWHFWDEOHVGHDQWtJHQRVYLUDOHV )LJXUD
/DUHFXSHUDFLyQGHYLUXVLQIHFFLRVRDSDUWLUGHOHQFpIDORVyOR
se obtiene mediante cocultivo con células permisivas. La PEES es
una enfermedad casi invariablemente letal que resulta de la persistencia de una infección abortiva.
En la UXEpRODFRQJpQLWDHOUHFLpQQDFLGRLQIHFWDGRH[KLEHXQD
amplia variedad de anormalidades, que incluyen las cardiopatías
congénitas, defectos oculares, sordera, retardo del crecimiento,
púrpura trombocitopénica, osteítis, hepatitis, neumonía, encefalitis y lesión cerebral con alteraciones mentales. Se comprueba una
FRQWLQXDUHSOLFDFLyQ\H[FUHFLyQYLUDOODTXHVHSXHGHSURORQJDU
PiVDOOiGHOSULPHUDxRGHYLGD\HQDOJXQRVWHMLGRV±FRPRHOFULVWDOLQRRFXODU±KDVWDORVRDxRVGHVSXpVGHRFXUULGRHOQDFLPLHQWR )LJXUD 8QHMHPSORFDUDFWHUtVWLFRGHLQIHFFLyQSHUVLVWHQWHDVLQWRPiWLFD
128
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
se observa en los portadores crónicos de virus KHSDWLWLV% )LJXUD
'LYHUVRVIDFWRUHVKDQVLGRDVRFLDGRVDVXSURGXFFLyQWHPSUDQD HGDG GH OD LQIHFFLyQ SULPDULD ±XVXDOPHQWH DVLQWRPiWLFD±
EDMD FRQFHQWUDFLyQ YLUDO GHO LQyFXOR IDFWRUHV JHQpWLFRV HWF 6H
FDOFXODHQPiVGHHOQ~PHURGHSRUWDGRUHVFUyQLFRV
del HBV en el mundo, siendo éstos el principal reservorio para la
FRQWLQXD GLVHPLQDFLyQ KRUL]RQWDO SRU YtD VH[XDO \ SDUHQWHUDO \
YHUWLFDO PDGUHKLMR GHOYLUXV
En algunas infecciones persistentes el virus puede continuar
UHSOLFiQGRVH LQIHFFLRQHV FUyQLFDV SURGXFWLYDV PLHQWUDV TXH HQ
otras puede mantenerse en alguna forma subviral no infecciosa
conservando su capacidad para replicarse en algún momento posWHULRU LQIHFFLRQHVODWHQWHV DVRFLiQGRVHDHSLVRGLRVDJXGRVGHHQfermedad. Esta última variedad de infección persistente se observa
HQODVLQIHFFLRQHVSRUYLUXVKHUSHVVLPSOH[\YDULFHOD]yVWHU(QHO
primer caso, el virus entra al organismo a través de piel y mucosas.
Muchas infecciones primarias pueden cursar en forma subclínica.
En otros casos, se observan típicas lesiones vesiculosas producto
de la infección lítica local de las células epiteliales parabasales e
LQWHUPHGLDVDFRPSDxDGDVGHXQDUHVSXHVWDLQÀDPDWRULD(OYLUXV
KHUSHVVLPSOH[GHYLHQHODWHQWHOXHJRGHODLQIHFFLyQSULPDULD\VH
dirige por los nervios sensitivos hasta los ganglios correspondientes. Las bases moleculares de la latencia en células nerviosas se
GHVFULELHURQHQHOtWHP'LYHUVRVHVWtPXORVFRPROD¿HEUHOD
tensión emocional, la luz solar y los traumatismos pueden precipitar la reactivación viral por un mecanismo hasta ahora desconocido.
'HVSXpVGHODUHDFWLYDFLyQHOYLUXV HQIRUPDGHVXEFRPSRQHQWHV se traslada posiblemente por vía nerviosa sensitiva y establece una
QXHYDLQIHFFLyQHQSLHORPXFRVDV )LJXUDV\ La división de las infecciones virales persistentes en diversos tiSRVQRHVVLHPSUHH[FOX\HQWHHOvirus hepatitis B es capaz de causar
DGHPiVGHODLQIHFFLyQDJXGD XQDinfección persistente productiva
en los KHSDWRFLWRV\H[KLELUXQDUHSOLFDFLyQUHVWULQJLGDHQHOcarcinoPDKHSDWRFHOXODU )LJXUD /Dpatogenia del hepatocarcinoma
QRKDVLGRDFODUDGDDXQTXHVHKDGHPRVWUDGRTXHGHVSXpVGHR
PiVGpFDGDVGHLQIHFFLyQFUyQLFDFRQvirus hepatitis B la incidencia
GHDTXpOHVYHFHVPiVHOHYDGDTXHHQODSREODFLyQJHQHUDO(Q
el hepatocarcinoma se observa la integración del genoma viral en el
de la célula hospedera. Se ha reportado la mutagénesis insercional en
los genes hTERT y PDGF, o la activación de oncogenes como el de
ODFLFOLQD$(VSRVLEOHTXHHOvirus hepatitis B inicie una serie de
HYHQWRVTXHFRQGX]FDDODLQMXULDKHSDWRFHOXODUFUyQLFD\TXHpVWDD
su vez, estimule la regeneración celular crónica. La producción persistente de los hepatocitos podría favorecer la acumulación de mutaciones al azar en el genoma celular, algunas de las cuales podrían
ser transformantes y conducir a la adquisición de un fenotipo celular
maligno. El hallazgo de que el gen X del virus hepatitis B posee caSDFLGDGWUDQVDFWLYDGRUDWUDQVFULSFLRQDOTXHVHH[WLHQGHPiVDOOiGHO
virus hepatitis B a otros virus así como a genes celulares, sugiere que
podría también participar en el proceso de transformación.
0iV D~Q FRQ¿UPDQGR OR DUELWUDULR±DXQTXH GLGiFWLFR±GH OD
VXEFODVL¿FDFLyQ GH ODV LQIHFFLRQHV SHUVLVWHQWHV HO EBV produce
una infección productiva en el epitelio faucial y una infección latente en OLQIRFLWRV'HPDQHUDDQiORJDHO+,9HVWiODWHQWHHQlinIRFLWRV7QRDFWLYDGRV\VHPXOWLSOLFDHQOLQIRFLWRV7DFWLYDGRV\
monocitos.
Algunas infecciones persistentes poseen un período de incubación muy prolongado en las que el tropismo por el hospedero y
la susceptibilidad del órgano blanco son restringidos. Los virus y
DJHQWHVQRFRQYHQFLRQDOHV SULRQHV TXHODVSURGXFHQFDXVDQODV
denominadas infecciones lentas. En esta categoría de infecciones
pueden incluirse la SDQHQFHIDOLWLVHVFOHURVDQWHVXEDJXGD PHQFLRnada anteriormente como rara complicación tardía de pacientes
que padecieron VDUDPSLyQ ODleucoencefalopatía multifocal progresiva asociada al poliomavirus JC, la panencefalitis rubeólica y
OD LQIHFFLyQ SRU DOJXQRV OHQWLYLUXV FRPR HO YLVQD GH ODV RYHMDV
7DPELpQVHLQFOX\HQDORVDJHQWHVGHODHQIHUPHGDGGH&UHXW]IHOGW
-DNREHONXUX )LJXUD \HODJHQWHGHOVFUDSLHHQODVRYHMDV
scrapie UDVFDGR (VWHVHJXQGRJUXSRGHHQIHUPHGDGHVVHFDUDFteriza por producir degeneración neuronal, estado espongiforme de
ODVXVWDQFLDJULVKLSHUWUR¿DHKLSHUSODVLDDVWURFtWLFDHQDXVHQFLD
GH IHQyPHQRV LQÀDPDWRULRV /ODPDWLYDPHQWH QR VH GHWHFWD UHVSXHVWDLQPXQHKXPRUDORFHOXODUHQHOKRVSHGHUR(ORULJHQPiV
SUREDEOHGHONXUXSRGUtDKDEHUFRUUHVSRQGLGRDXQFDVRHVSRUiGLFR
de enfermedad de Creutzfeldt-Jakob en Nueva Guinea el que, merFHGDORVULWRVFDQLEDOtVWLFRVGHODWULEX)RUH HQODLVODGH*XDP fue diseminado a dicha población, emergiendo entonces una cepa
diferente de un mismo agente. La replicación de este agente es lenWDDWUDYpVGHORVDxRVDOFDQ]iQGRVHWtWXORVGH dosis infectantes
por gramo de encéfalo.
8. CONCLUSIONES
La SDWRJHQLDGHODVLQIHFFLRQHVYLUDOHVHVWiLQÀXHQFLDGDSRUP~Otiples factores dependientes del agente y del hospedero. Con el advenimiento de la biología molecular se ha comenzado una nueva
HUDODTXHSHUPLWLUiDFHUFDUVHDOREMHWLYRGHUHODFLRQDUHVWUXFWXUD\
funcionalidad de las biomoléculas. La permanente investigación en
HVWHFDPSRVLQGXGDSURSRUFLRQDUiODVEDVHVSDUDXQPHMRUGHVDUURllo de medidas racionales de SUR¿OD[LV\WHUDSpXWLFDHQODVGLYHUVDV
infecciones virales.
Capítulo 5 / Patogenia de las infecciones virales
129
Bibliografía
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
$NKRYD 2 %DLQEULGJH 0 0LVUD 9 7KH QHXURQDO KRVW FHOO IDFWRU
ELQGLQJSURWHLQ=KDQJIHLLQKLELWV+HUSHVVLPSOH[YLUXVUHSOLFDWLRQJ
Virol $OFKp/(%DVXDOGR-$&DQGXUUD1(&DYDOODUR/&RWR&'DPRQWH
EB, et al2SLQLyQGHH[SHUWRV(OFDVRGHOYLUXVGHLQÀXHQ]DDYLDU
7HPD 0DQLSXODFLyQ JHQpWLFD GHO YLUXV GH LQÀXHQ]D DYLDU +1
para facilitar su capacidad de infección a un huésped mamífero".
4XtPLFD9LYD KWWSZZZTXLPLFDYLYDTEIFHQXEDDU
YQRSLQLRQKWPO
$YLUXWQDQ 3 =KDQJ / 3XQ\DGHH 1 0DQX\DNRUQ$ 3XWWLNKXQW &K
Kasinrerk W, et al6HFUHWHG16RIGHQJXHYLUXVDWWDFKHVWRWKHVXUIDce of cells via interactions with heparan sulfate and chondroitin sulfate
E". PLoS Pathog
&KDSPDQ10.LP.6'UHVFKHU.02ND.7UDF\6¶WHUPLQDOGHOHWLRQVLQWKHJHQRPHRIDFR[VDFNLHYLUXV%VWUDLQVRFFXUUHGQDWXUDOO\
in human heart". Virology
&KHQJ9&7R..7VH++XQJ,)<XHQJ.<7ZR\HDUVDIWHUSDQGHmic LQÀXHQ]D$+1ZKDWKDYHZHOHDUQHG"Clin Microbiol
Rev
'HOJDGR0)&RYLHOOR60RQVDOYR$&0HOHQGL*$+HUQiQGH]-=
Batalle JP et al. "/DFNRIDQWLERG\DI¿QLW\PDWXUDWLRQGXHWRSRRU7ROO
like receptor stimulation leads to enhanced respiratory syncytial virus
disease". Nature )DUFL3'tD]*&KHQ=*RYLQGDUDMDQ67LFH$$JXOWR/ et al. "B
cell gene signature with massive intrahepatic production of antibodies
to hepatitis B core antigen in hepatitis B virus-associated acute liver
failure". Proc Natl Acad Sci USA
)OLQW6-(QTXLVW/:5DFDQLHOOR6NDOND$03ULQFLSOHVRI9LURORJ\
0ROHFXODU%LRORJ\3DWKRJHQHVLVDQG&RQWURORI$QLPDO9LUXVHVrd.
(GLWLRQ$603UHVV:DVKLQJWRQ
)UDVHU & 'RQQHOO\ &$ &DXFKHPH] 6 +DQDJH :3 9DQ .HUNKRYH
0''pLUGUH+ROOLQJVZRUWK7et al. "Pandemic potential of a strain of
,QÀXHQ]D$ +1 HDUO\¿QGLQJVScience.
*DPERWWR$%DUUDWW%R\HV60GH-RQJ0'1HXPDQQ*.DZDRND
< +XPDQ LQIHFWLRQ ZLWK KLJKO\ SDWKRJHQLF +1 LQÀXHQ]D YLUXV
Lancet
*RxL6(,VHUWH-$$PEURVLR$05RPDQRZVNL9*KLULQJKHOOL3'
Lozano ME. "Genomic features of attenuated Junín virus vaccine strain candidate". Virus Genes
+HQNH8,*RHUJHQ'=KHQJ-6RQJ<6FKWWOHU&*)HKU&et al.
PLFUR51$ VWLPXODWHV WUDQVODWLRQ RI hepatitis C virus RNA".
EMBO J
+HUROG 6 6WHLQPXHOOHU 0 YRQ :XOIIHQ : &DNDURYD / 3LQWR 5
Pleschka S, et al. "Lung epithelial apoptosis in LQÀXHQ]DYLUXVSQHXPRQLDWKHUROHRIPDFURSKDJHH[SUHVVHG71)UHODWHGapoptosis-inducing ligand". J Exp Med
.LP (< %DWWDLOH -7 3DWHO$& <RX <$JDSRY ( *UD\VRQ 0+ et
al. "Persistent activation of an innate immune response translates res-
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
‡
piratory viral infection into chronic lung disease". Nature Med
/LQ&/ .DR-+"Hepatitis B viral factors and clinical outcomes of
chronic hepatitis B". J Biomed Sci
/RUURW 0 9DVVHXU 0 +RZ GR WKH URWDYLUXV 163 DQG EDFWHULDO
HQWHURWR[LQVOHDGGLIIHUHQWO\WRGLDUUKHD"Virology J 0DFDGDP $- )HUJXVRQ * 6WRQH '0 0HUHGLWK - .QRZOVRQ 6
Auda G, et al. "Rational design of genetically stable, live-attenuated
Poliovirus vaccines of all three serotypes: relevance to poliomyelitis
eradication". J Virol±
0DKDMDQ96'UDNH$&KHQ-9LUXVVSHFL¿FKRVWPL51$VDQWLYLUDOGHIHQVHVRUSURPRWHUVRISHUVLVWHQWLQIHFWLRQ"Trends in Immunol
0DLGML(0F'RQDJK6*HQEDFHY27DEDWD73HUHLUD/0DWHUQDO
antibodies enhance or prevent cytomegalovirus infection in the placenWDE\QHRQDWDO)Freceptor-mediated transcytosis". Am J Pathol
0RQGRWWH -$ /R]DFK 3 $PDUD $ *DPDUQLN $9 (VVHQWLDO UROH RI
'HQJXHYLUXVHQYHORSHSURWHLQ1JO\FRV\ODWLRQDW$VSDUDJLQHGXULQJ
viral propagation". J Virol 0XHOOHU 61 0DWORXELDQ 0 &OHPHQV '0 6KDUSH $+ )UHHPDQ *-
Gangappa S, et al9LUDOWDUJHWLQJRI¿EUREODVWLFUHWLFXODUFHOOVFRQWULEXWHV
to immunosuppression and persistence during chronic infection". Proc Nat
Acad Sci USA 1RYHO VZLQHRULJLQ ,QÀXHQ]D $ +1 YLUXV LQYHVWLJDWLRQ WHDP
"Emergence of a novel swine-origin ,QÀXHQ]D$ +1 YLUXVLQKXPDQV
N Engl J Med 2009; 360:2615-21.
5DPEDXW$3\EXV2*1HOVR0,9LERXG&7DXEHQEHUJHU-.+ROPHV
(&7KHJHQRPLFDQGHSLGHPLRORJLFDOG\QDPLFVRIKXPDQLQÀXHQ]D
A virus". Nature
5HHG-/%UHZDK<$'HODQH\7:HOOLYHU7%XUZHOO7%HQMDPLQ(
et al. "Macrophage impairment underlies airway occlusion in primary
respiratory syncytial virus bronchiolitis". J Infect Dis
5RMHN-0.XQ]6&HOOHQWU\E\KXPDQSDWKRJHQLFDUHQDYLUXVHV
Cell Microbiol
5XVVHOO&$)RQYLOOH-0%URZQ$(%XUNH')6PLWK'/-DPHV6/et
al7KHSRWHQWLDOIRUUHVSLUDWRU\GURSOHWWUDQVPLVVLEOH+1LQÀXHQ]D
virus to evolve in a mammalian host". Science
6DORPRQ 5 :HEVWHU 5* 7KH LQÀXHQ]D YLUXV HQLJPD Cell 8PEDFK-/.UDPHU0)-XUDN,.DUQRZVNL+:&RHQ'0&XOOHQ
%50LFUR51$VH[SUHVVHGE\+HUSHVVLPSOH[YLUXVGXULQJODWHQW
infection regulate viral mRNAs". Nature
9DQ +RHYHQ 1 3DSSDV & %HOVHU -$ 0DLQHV 75 =HQJ + *DUFtD
Sastre A et al. "Human HA and polymerase subunit 3%SURWHLQVFRQfer transmission of an avian LQÀXHQ]DYLUXVWKURXJKWKHDLUProc Natl
Acad Sci USA
6
Oncogénesis viral
Norberto A. Sanjuan
INTRODUCCIÓN
Los mecanismos por los cuales los retrovirus pueden ser onFRJpQLFRVVRQEiVLFDPHQWHWUHV(QHOSULPHUR FX\RHMHPSORHV
(Op[LWRREWHQLGRGHVGHPHGLDGRVGHOVLJOR;,;HQHOFRQWUROGH el virus del VDUFRPDGH5RXVGHORVSROORV HOYLUXVWLHQHHQVX
las enfermedades infecciosas a través de vacunas llevó a que desde JHQRPDODFRGL¿FDFLyQQHFHVDULDSDUDVXVWUHVJHQHVHVWUXFWXUDOHV
comienzos del siglo XX se intentara encontrar una etiología vi- gag, pol y env\DGHPiVXQRQFRJpQYLUDOHOv-src. Este último
UDOGHYDULDVQHRSODVLDVPDOLJQDVKXPDQDV'HHVDIRUPDHQ constituye una versión mutada y altamente transformante del protoEllerman y Bang describieron el hallazgo de un virus asociado a oncogén celular c-src que es un gen normal. El virus adquirió ese
OHXFHPLDVH[SHULPHQWDOHVDORTXHOXHJRVHOHVXPDURQRWURVYDULRV oncogén a través de la evolución biológica y lo hizo en su forma
GHVFXEULPLHQWRVGHYLUXVUHODFLRQDGRVFRQFiQFHUHV(OOROOHYyD PXWDGD&DEHVHxDODUTXHODH[SUHVLyQGHXQDVRODFRSLDGHORQFRTXHHQODGpFDGDGHVHLQYLUWLHUDPXFKRHVIXHU]R\GLQHUR gén v-srcHQXQDFpOXODHVVX¿FLHQWHSDUDWUDQVIRUPDUODPLHQWUDV
SDUDHQFRQWUDUSRUHMHPSORDXQYLUXVSURGXFWRUGHDOJ~Qtipo de TXHODVREUHH[SUHVLyQGHOSURWRRQFRJpQc-src no lo hace. Este
OHXFHPLDKXPDQDFRQHO¿QGHHODERUDUXQDYDFXQDSURWHFWRUD7R- virus tiene, entonces, todos los genes necesarios para replicar y
dos esos esfuerzos fallaron y en la actualidad se acepta que si bien SURGXFLUSURJHQLH\WDPELpQXQRQFRJpQFX\DH[SUHVLyQOOHYDDOD
H[LVWHQYLUXVUHODFLRQDGRVFRQODJpQHVLVGHFiQFHUHVHQODHVSHFLH transformación celular. El mecanismo de transformación es, por
humana, estos son siempre cofactores, es decir actores necesarios ORWDQWRPX\IiFLOGHFRPSUHQGHUSHURHVWHtipo de virus es abSHURQRVX¿FLHQWHVSDUDSURYRFDUHOGHVDUUROORGHXQDQHRSODVLD VROXWDPHQWHH[FHSFLRQDOGHQWURGHORVretrovirus oncogénicos. El
PDOLJQD6LQHPEDUJRDOJXQRVYLUXVRQFRJpQLFRVVRQH[FHOHQWHV segundo mecanismo lo emplean aquellos retrovirus que también
KHUUDPLHQWDVSDUDHVWXGLDUHQIRUPDH[SHULPHQWDOHOGHVDUUROORGH han incorporado en su genoma a un oncogén que es la variante
GLVWLQWRVWLSRVGHQHRSODVLDV(VWRVLJQL¿FDTXHHQODDFWXDOLGDG mutada de un proto-oncogén celular normal pero, a diferencia del
PiVTXHLQWHQWDUGHVFXEULUODH[LVWHQFLDGHYLUXVTXHSRUVtPLVPRV HMHPSORDQWHULRUDOKDEHULQFRUSRUDGRDORQFRJpQKDQSHUGLGRSDUWH
SURYRTXHQFiQFHUHVVHHPSOHDQORVYLUXVRQFRJpQLFRVSDUDFRP- de alguno de los tres genes estructurales. Es decir, estos retrovirus
SUHQGHUPHMRUHOSURFHVRGHWDOODGRGHOGHVDUUROORGHODVQHRSODVLDV pueden transformar pero no pueden replicar por sí mismos porque
&RPRLQWURGXFFLyQDOWHPDHVDFRQVHMDEOHDFODUDUODVGLIHUHQ- les falta la maquinaria genética necesaria para ello. Para replicar
FLDVTXHH[LVWHQHQWUHORVFRQFHSWRVGHtransformación celular y requieren de una co-infección en un modelo que tenga un retrovirus
de neoplasia malignaRFiQFHU/Dtransformación celular es un endógeno que sí aporta los tres genes estructurales aunque no tiene
proceso que puede observarse in vitro en el cual las células se ningún oncogén. El tercer mecanismo lo emplean los retrovirus que
inmortalizan, luego de que en un cultivo fueron infectadas con un carecen de oncogén pero que tienen los tres genes estructurales.
YLUXVGHWHUPLQDGRGLFKDVFpOXODVVRQFDSDFHVGHFUHFHUHQPHGLRV En este caso, para que un virus provoque una neoplasia tiene que
FRQEDMDVFRQFHQWUDFLRQHVGHDJDUORTXHHYLGHQFLDXQDLQGHSHQ- UHDOL]DUP~OWLSOHVFLFORVGHUHSOLFDFLyQGXUDQWHORVFXDOHVLPSDFWDUi
GHQFLDGHODQFODMHDOVXVWUDWRSXHGHQIRUPDUSOXULFDSDVORTXH en el genoma celular innumerables veces en forma de provirus. La
indica la pérdida de la inhibición del crecimiento por contacto y, mayoría de esas veces la incorporación del UHWURYLUXVQRSURGXFLUi
eventualmente, pueden desarrollar tumores si son inoculadas en cambio alguno en la célula pero, por azar, en un momento dado el
UDWRQHVLQPXQRGH¿FLHQWHV(QFDPELRHOIHQyPHQRGHoncogé- YLUXVLPSDFWDUiHQXQJHQUHJXODWRULRRHQVXSURPRWRU\SURYRFDUi
QHVLVVLHPSUHVHGDHQDQLPDOHV RKXPDQRV HLPSOLFDODDGLFLyQ la transformación celular. A este mecanismo se le denomina mutalenta y sucesiva de varias mutaciones críticas en algunos genes génesis por inserción y es el que emplea el +7/9,
A diferencia de los virus oncogénicos con RNA, los que poseen
regulatorios del crecimiento celular. El hecho de que un virus sea
capaz de provocar transformación celular in vitro no indica en DNA pertenecen a familias y a géneros muy distintos y cada uno
de ellos utiliza diferentes estrategias para la transformación celular.
absoluto que pueda inducir una neoplasia humana.
([LVWHQDTXtYLUXVKXPDQRVTXHWLHQHQODFDSDFLGDGGHLQGXFLUQHRplasias en animales y transformar células de otras especies in vitro,
MECANISMOS ONCOGÉNICOS
FRPRSRUHMHPSORDOJXQRVadenovirus que, no obstante, nunca hasta
([LVWHQGRVJUDQGHVJUXSRVGHYLUXVRQFRJpQLFRVORVretrovirus, hoy han sido asociados al desarrollo de neoplasias humanas. Otros,
que tienen un genoma compuesto por RNA, y los virus que contie- VLQHPEDUJRVtHVWiQDVRFLDGRVDFiQFHUHVGHODHVSHFLHKXPDQD
nen DNA como elemento de información genética. Ambos tipos di- basado esto en datos epidemiológicos, clínicos y moleculares. Los
¿HUHQHQORVPHFDQLVPRVHPSOHDGRVSDUDGHVDUUROODUXQDQHRSODVLD PLHPEURVPiVFRQVSLFXRVGHHVWHJUXSRGHYLUXVVRQHO(SVWHLQ
En el caso de los UHWURYLUXVH[LVWHQGRVJUDQGHVJUXSRVORVH[y- %DUUHOKHUSHVKXPDQR ++9 HOYLUXVGHODhepatitis B y el
JHQRV\ORVHQGyJHQRV/RVH[yJHQRVVRQORVTXHSXHGHQLQIHFWDU virus SDSLORPDKXPDQR +39 /RVWUHVSULPHURVVHUiQWUDWDGRV
DXQDQLPDOGHVGHHOH[WHULRUPLHQWUDVTXHORVHQGyJHQRVIRUPDQ H[WHQVDPHQWHHQRWURVFDStWXORVGHWDOIRUPDTXHHQpVWHVHSURIXQSDUWHGHOJHQRPDGHORVDQLPDOHVSXHGHQH[SUHVDUVHSDUFLDOPHQWH GL]DUiQORVDVSHFWRVPiVLPSRUWDQWHVGHOHPV. Aunque tomemos
\SXHGHQVHUKHUHGDGRV([LVWHQHYHQWXDOPHQWHUHFRPELQDFLRQHV al HPV como al virus prototipo que interviene en la etiopatogenia
HQWUHXQYLUXVH[yJHQR\XQRHQGyJHQRFRPRVHYHUiPiVDGHODQ- GHDOJXQDVQHRSODVLDVPXFRFXWiQHDVGHEHPRVUHFRUGDUTXHDFRte. Cabe citar que la inmensa mayoría de estos virus forman parte PLHQ]RVGHVHGHVFXEULyXQQXHYRYLUXVpolioma asociado a
GHPRGHORVQHWDPHQWHH[SHULPHQWDOHVTXHSURYRFDQVREUHWRGR la etiología del carcinoma de células de Merkel de la piel. Esta es
leucemias o sarcomas en animales endocriados. Estos modelos no XQDQHRSODVLDPDOLJQDUDUDSHURFRQVWLWX\HXQHMHPSORGHFyPR
WLHQHQXQDFRQWUDSDUWHKXPDQD\SDUHFHQEDVWDQWHDUWL¿FLDOHVFRPR los virus SROLRPDSXHGHQHVWDULQYROXFUDGRVHQDOJXQRVFiQFHUHV
SDUDH[SOLFDUODJpQHVLVGHXQDQHRSODVLDHQHOKRPEUH(O~QLFR FXWiQHRV0X\UHFLHQWHPHQWHKHPRVUHSRUWDGRODGHWHFFLyQGHDQretrovirus humano asociado a una neoplasia maligna es, hasta hoy, tígenos de virus polioma en el WLSRPiVIUHFXHQWHGHQHRSODVLDV
EHQLJQDVGHORVDQH[RVFXWiQHRVKXPDQRVFRPRVRQORVSLORPDWULel +7/9,
132
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
FRPDV1RREVWDQWHHOVLJQL¿FDGRGHHVWHKDOOD]JRWRGDYtDGHEHVHU
constatado en forma independiente por otros investigadores.
Se ha detectado también que algunos virus papiloma humanos
GHQRPLQDGRVEHWDSDSLORPDYLUXV SXHGHQSURGXFLULQIHFFLRQHV
ODWHQWHVHQODSLHOGHOKXPDQR\HYHQWXDOPHQWHOHVLRQHVFXWiQHDV
posteriores, a diferencia de los "alfa-papilomavirus" que producen
OHVLRQHVSUHQHRSOiVLFDV\QHRSOiVLFDVHQODVPXFRVDVHQWUHHOODV
la genital.
EL VIRUS PAPILOMA HUMANO: SU PARTICIPACIÓN EN LA ONCOGÉNESIS
Estos virus son icosaédricos y desnudos y tienen un genoma con
'1$ELFDWHQDULR+DVWDKDFHSRFRVHORVDJUXSDEDMXQWRFRQORV
virus polioma como Papovavirus pero las diferencias genéticas
halladas hicieron que hoy se los considere como miembros de la
familia Papilomaviridae, que es independiente de la Poliomaviridae. Como todo virus, tiene genes tempranos, que son regulatorios
\JHQHVWDUGtRVTXHFRGL¿FDQDODVSURWHtQDVHVWUXFWXUDOHV
/RVJHQHVWHPSUDQRVGHPD\RULPSRUWDQFLDVRQHO(HO(HO
(\HO(PLHQWUDVTXHHOJHQWDUGtRPiVSUHSRQGHUDQWHHVHO/
(OJHQ(UHJXODQHJDWLYDPHQWHODH[SUHVLyQGHORVJHQHV(\(
siendo estos dos últimos los RQFRJHQHVYLUDOHVPLHQWUDVTXHHO(
WDPELpQWLHQHDFWLYLGDGWUDQVIRUPDQWH SURYRFDKLSHUSODVLDVHSLWHOLDOHVHQDQLPDOHVWUDQVJpQLFRV \DXPHQWDODVtQWHVLVGH'1$\OD
proliferación de los queratinocitos. Las diferencias en la secuencia
GHOJHQ/HVODTXHGHWHUPLQDTXHH[LVWDQPiVGHWLSRV TXH
no son serotipos GHHPV, algunos de ellos altamente oncogénicos,
FRPRHOHO\HO\RWURVVyORSURGXFWRUHVGHQHRSODVLDV
benignas denominadas verrugas. Los HPV altamente oncogénicos
VHDVRFLDQDOFiQFHUGHFXHOORXWHULQRSHURWDPELpQDOGHYXOYD\DO
de pene.
$QXDOPHQWHVHUHJLVWUDQHQWRGRHOPXQGRQXHYRVFDVRV GH FiQFHU GH FXHOOR XWHULQR \ GDGR TXH OD JUDQ PD\RUtD GH
HOORVRFXUUHQHQ/DWLQRDPpULFDHOVXGHVWHDVLiWLFR\HOÈIULFDVXE
Sahariana donde las condiciones sanitarias son malas, de ese total
GHFDVRVQXHYRVVHUiQPRUWDOHV
Se acepta que la primoinfección con HPV ocurre fundamentalPHQWHOXHJRGHOFRPLHQ]RGHODDFWLYLGDGVH[XDO\TXHHOYLUXVHV
transmitido por esta vía. No obstante, se ha planteado que ésta no
es la única manera de adquirir la infección, ya que el virus puede
permanecer viable por períodos muy prolongados de tiempo en foPLWHV1RVHFRQRFHH[DFWDPHQWHGHTXpPDQHUDHOHPV interactúa
con receptores del epitelio del cuello uterino y qué mecanismos
emplea para alcanzar la capa basal de ese epitelio, pero se propone que los microtraumas producidos durante el coito facilitarían la
infección. De cualquier forma, el sector del cuello uterino donde
se originan las neoplasias es la zona de transición entre el epitelio
SODQRHVWUDWL¿FDGRGHOH[RFHUYL[\HOHSLWHOLRFLOtQGULFRVLPSOHGHO
HQGRFHUYL[8QDYH]DOFDQ]DGDODFDSDEDVDOHOHPV permanece
con su DNA circularizado en forma episomal en el núcleo de las
células y va madurando a medida que maduran los queratinocitos,
GHPDQHUDWDOTXHHQODFDSDPiVVXSHU¿FLDOGHOHSLWHOLRVHIRUPDQ
FpOXODVYDFXROL]DGDVFRQQ~FOHRVH[FpQWULFRVLUUHJXODUHV\SLFQyWLcos denominadas coilocitos que contienen virus infecciosos que una
YH]OLEHUDGRVLQIHFWDUiQDQXHYDVFpOXODVRDRWUDSHUVRQD(VWDIDVH
GHOFLFORUHSOLFDWLYRYLUDOHVOtWLFDSXHVWRTXHGHVWUX\H¿QDOPHQWH
al queratinocito.
No obstante, en un momento del ciclo de replicación y al cabo
GHXQSHUtRGRTXHSXHGHOOHYDUPiVGHDxRVHOYLUXVLQWHJUDVX
JHQRPDDOGHODFpOXODJHQHUDOPHQWHDWUDYpVGHOJHQ('HHVWD
IRUPD(HVLQDFWLYDGR\GDGRTXHQRUPDOPHQWHDFW~DLQKLELHQGR
ODH[SUHVLyQGH(\GH(HVWRVGRV~OWLPRVVHWUDQVFULELUiQVLQ
LQFRQYHQLHQWHV(OSURGXFWRGHOJHQ(LQWHUDFW~DFRQODSURWHtQD
FHOXODUSODDFRPSOHMDFRQXELTXLWLQD\ODGHJUDGDDWUDYpVGHO
proteasoma, mientras que el producto de E7 se une a la proteína
pRB inactivando su función. De este modo el HPV provoca por un
ODGRODLQDFWLYDFLyQGHXQDSURWHtQD S TXHWLHQHFRPRIXQFLyQ
detectar alteraciones en el DNA celular y, si las encontrara, llevar
a la muerte celular por apoptosis y, por el otro, hace que la célula
entre permanentemente en el ciclo de replicación. La consecutiva
acumulación de PXWDFLRQHVLQGHVHDGDVOOHYDUiFRQHOWLHPSRDOD
DGTXLVLFLyQGHXQIHQRWLSRQHRSOiVLFR1RREVWDQWHVHVDEHTXH
HVWRVIDFWRUHVVRQQHFHVDULRVSHURQRVX¿FLHQWHVSDUDODJpQHVLVGH
XQDQHRSODVLD/DH[SUHVLyQGH(\HOHIHFWRGHORVHVWUyJHQRVOD
dieta y eventualmente otras infecciones concomitantes como las
SURGXFLGDVSRUHOYLUXVKHUSHVVLPSOH[GHOWLSRWDPELpQDFWXDUtDQ
FRPRFRIDFWRUHVSDUDHOGHVDUUROORGHXQFiQFHUGHFXHOORXWHULQR
6HKDQGHVDUUROODGRSRUORPHQRVYDFXQDVTXH\DHVWiQFRPHUcializadas y que intentan evitar la infección por los tipos de virus
papiloma productores de lesiones genitales frecuentes y/o potencialmente malignas. Hasta hoy se recomienda su aplicación en niñas a
SDUWLUGHORVDxRVHQGRVGRVLVFRQVHFXWLYDV/Dvacuna parece
VHUHIHFWLYDSHURHVH[WUHPDGDPHQWHFDUDSDUDORVVHFWRUHVVRFLDOHV
TXHPiVODQHFHVLWDQ\HQFLHUUDHOULHVJRGHTXHVLIXHUDDGPLQLVtrada sin educación sanitaria concomitante, induciría a la población
TXHODUHFLELHUDDVXSRQHUTXHHVWDUiH[HQWDGHWRGDRWUDLQIHFFLyQ
venérea, lo que –obviamente– no es cierto. Conceptualmante la
vacuna puede ser administrada siempre que no se abandonen las
GHPiVPHGLGDVSUR¿OiFWLFDVGHHQIHUPHGDGHVGHWUDQVPLVLyQVH[XDO
FRPRVRQSRUHMHPSORHOXVRGHSUHVHUYDWLYRVHOFRQRFLPLHQWRGH
ORVFRPSDxHURVVH[XDOHVHOFRQWUROPpGLFRSHULyGLFR\ODGHWHFFLyQ
precoz de signos de enfermedad venérea, así como la necesidad de
la vacunación contra el virus hepatitis B.
Uno de los puntos críticos en la oncogénesis por virus con
DNA es la relación que hay entre la replicación viral y la inducFLyQGHQHRSODVLDV&RPRVHH[SOLFyDUULEDXQRGHORVSXQWRV
PiVGLItFLOHVGHFRPSUHQGHUHVFXiQGRXQDLQIHFFLyQTXHHUDSURductiva y provocaba lisis celular cambió a una infección del tipo
transformante. Este proceso ha sido estudiado empleando ratones
WUDQVJpQLFRVTXHH[SUHVDQFDGDXQDGHODVSURWHtQDVWUDQVIRUPDQtes de +39VRODVRHQFRQMXQWR\WDPELpQHPSOHDQGRYLUXVSROLRPDHQDQLPDOHVGHH[SHULPHQWDFLyQ(VWH~OWLPRYLUXVFRGL¿FDD
ORVRQFRJHQHVP7\/7TXHDFW~DQGHPDQHUDGLVWLQWDDODH[SOLFDGDSDUDORVRQFRJHQHV(\(GHO+39(ORQFRJpQP7 TXHHV
HOPiVLPSRUWDQWH VHXQHDOSURGXFWRGHOSURWRRQFRJpQFHOXODU
c-src y, mediante una serie de fosforilaciones sufre un cambio
estérico que le permite interactuar, a su vez, con varios péptidos
involucrados en los mecanismos de transducción de señales como
VRQHO6KFODVSURWHtQDVODIRVIDWLGLOLQRVLWRONLQDVDHWF
Pero lo llamativo es que esto ocurre tanto durante la fase lítica
de la infección por el virus como durante la inducción de neoSODVLDV'HWDOIRUPDTXHQRHVWiFODURFXiOHVHOSXQWRRswitch
TXHGHWHUPLQDHOSDVDMHGHXQtipo de infección a otro y que es
LQGHSHQGLHQWHGHODPHUDH[SUHVLyQGHORVoncogenes virales. En
este sentido, el estado de permisividad celular, la interacción de
proteínas virales con diferentes factores de transcripción celulares
\TXL]iVODVSURSLDVEDVHVJHQpWLFDVGHORVKXpVSHGHVHVWiQVLHQGR
intensamente estudiados en la actualidad.
Capítulo 6 / Oncogénesis viral
133
Bibliografía
‡
‡
‡
'DKO - <RX - %HQMDPLQ 7 ,QGXFWLRQ DQG XWLOL]DWLRQ RI DQ$70
signaling pathway by polyomavirus". J Virol
/DPEHUW3)2]EXQ0$&ROOLQV$+ROPJUHQ6/HH'1DNDKDUD
7 8VLQJ DQ LPPRUWDOL]HG FHOO OLQH WR VWXG\ WKH HPV life cycle in
organotypic raft cultures". Methods Mol Med
6DQMXDQ13RUUiV$2WHUR-3HUD]]R6([SUHVVLRQRIPDMRUFDSVLG
SURWHLQ93LQWKHDEVHQFHRIYLUDOSDUWLFOHVLQWK\PRPDVLQGXFHGE\
murine polyomavirus". J Virol
‡
‡
8UHQ $* .RRO - %HUQV $ YDQ /RKXL]HQ 0 5HWURYLUDO
insertional mutagenesis: past, present and future". Oncogene 6DQMXDQNA, Símula S, Casas J, Woscoff A. "Detection of polyomavirus
PDMRU FDSVLG DQWLJHQ 93 LQ KXPDQ SLORPDWULFRPDV 0HGLFLQD
%XHQRV$LUHV 7
Mecanismos de defensa del hospedador
frente a las infecciones virales
José Raúl Oubiña - María Laura Minassian - Verónica Lidia Mathet
1. INTRODUCCIÓN
1.1. HISTORIA
XQLQVWUXPHQWRFRPRVROLVWDPLHQWUDVTXHHQRWURVHVHOFRQMXQWR
LQVWUXPHQWDOHOTXHVHH[SUHVDHQVXWRWDOLGDG
En la delicada hipotética balanza que mide el "peso" de los
DWULEXWRVYLUDOHV SDWRJHQLFLGDGYLUXOHQFLDHYDVLyQDODUHVSXHVWD
LQPXQH \ORVGHOKRVSHGDGRUpVWHLPSRQHHOYLJRUGHVXUHVSXHVWD
LQPXQH )LJXUD Los términos "inmunidad" e "inmune" provienen del latín immunitas e immunis, respectivamente. Dichos vocablos eran utilizados en
pSRFDGHORVURPDQRVSDUDUHIHULUVHDDTXHOORVLQGLYLGXRVH[HQWRV
de cumplir determinados deberes, tales como pagar impuestos o
FXPSOLUHOVHUYLFLRPLOLWDU)XHHOSRHWD/XFDQR 0DUFXV$QQDHXV
/XFDQXV G& HQ VX FHOHEpUULPR SRHPD pSLFR )DUVDOLD
Virus
Bellum civile GRQGHVHQDUUDODOXFKDHQWUH&pVDU\3RPSH\RSRU
el poder de Roma, quien utilizó metafóricamente el término "in$ ( &
7 9 2
mune" para referirse a la legendaria resistencia contra mordedu$ $ 1
ras de serpientes de los integrantes de la tribu Psylli del Norte de
DEFENSA
4 6 7
8
5
,
ÈIULFD3RUH[WHQVLyQGLFKRYRFDEORVHXWLOL]DGHVGHHQWRQFHVSDUD
( Ï $
aquellos mecanismos que evitan al paciente pagar el tributo de la
1 $
7
enfermedad.
$
4
Sin embargo, la noción de que la "inmunidad" conferida por
Hospedador
8
el padecimiento de una enfermedad infecciosa puede proteger ha(
EtDVLGRSUHYLDPHQWHUHÀHMDGDSRUHOKLVWRULDGRUJULHJR7XFtGLGHV
TXLHQGHVFULELyTXHODSODJDGH$WHQDV SDUDDOJXQRVLQYHVWLJDGRUHVSUREDEOHPHQWH¿HEUHWLIRLGHD RFXUULGDKDFLDHOD&QXQca afectaba dos veces a un mismo hombre".
8Q H[SHULPHQWR QDWXUDO RFXUULGR HQ ODV UHPRWDV LVODV )HURH Figura 7.1. Relación virus-hospedador. Los mecanismos de defenFøroyar en feroés, FærøerneHQGDQpVORTXHVLJQL¿FD,VODVGH sa de éste prevalecen sobre los que promueve la infección viral.
FRUGHURV HQHOVLJOR;9,,,PRVWUDUtDODVEDVHVTXHFRUUHODFLRQDQ
KR\ OD SURWHFFLyQFRQ OD PHPRULD LQPXQROyJLFD(O H[SHULPHQWRFRPHQ]yHQFRQXQEURWHHSLGpPLFRGHsarampión en las
Uno de los mayores avances en la Medicina moderna ha sido
PHQFLRQDGDVLVODV'XUDQWHORVVXEVLJXLHQWHVDxRVQRKXERFD- el desarrollo de vacunas contra muchas de las infecciones virales
VRVGHGLFKDHQIHUPHGDGHQWUHORVLVOHxRVKDVWDTXHHQXQD graves y aun mortales. Las vacunas actúan en general induciendo
QXHYDHSLGHPLDDIHFWyHQWUHHO\HOGHORVKDELWDQWHV)XH la formación de DQWLFXHUSRVHVSHFt¿FRVFRQWUDHStWRSHVFUtWLFRVGH
el médico danés Ludwig Panum quien estudió la epidemiología del OD VXSHU¿FLH YLUDO TXH ±KDELWXDOPHQWH± LPSLGHQ VX DGHFXDGD DGbrote y relató que "entre los muchos individuos adultos o ancianos sorción a los receptores o correceptores celulares, aunque también
TXHKDEtDQSDGHFLGRODHSLGHPLDGHQLQJXQRIXHDWDFDGRSRU DFW~DQ PHGLDQWH RWURV PHFDQLVPRV YpDVH HO tWHP 'H HVWD
VHJXQGDYH](OPHMRUFRQWUROLQWHUQRGHHVWHH[SHULPHQWRQDWXUDO PDQHUDFXDQGRHOKRVSHGDGRUHVH[SXHVWRDODLQIHFFLyQQDWXUDOORV
quedó también documentado ya que "aquellas personas mayores DQWLFXHUSRVSUHIRUPDGRVQHXWUDOL]DUiQOLPLWDUiQDOYLUXVLQIHFWDQWH\
que no habían padecido sarampión con anterioridad, enfermaban DFRUWDUiQHOFXUVRGHODLQIHFFLyQ6HKDHVWLPDGRTXHODYLGDPHGLD
DOH[SRQHUVHDODLQIHFFLyQ(VWRVFOiVLFRVHVWXGLRVGH3DQXPSHU- de los anticuerpos contra ciertos virus es muy larga, alcanzando los
PLWLHURQ REWHQHU GRV YDOLRVDV FRQFOXVLRQHV D TXH OD SURWHFFLyQ DxRVSDUDHOYLUXVYDULFHOD]yVWHU\ORVDxRVSDUDsarampión y
contra el VDUDPSLyQHUDGHODUJDGXUDFLyQ\E TXHQRHUDQHFHVDULD parotiditis. Ciertas vacunas, principalmente las elaboradas con virus
OD UHH[SRVLFLyQ DO YLUXV SDUD PDQWHQHU SRU SHUtRGRV SURORQJDGRV atenuados, pueden inducir también mecanismos de FLWRWR[LFLGDG7
la inmunidad protectora. Este último aspecto proveyó una crucial dependientes, cruciales para la eliminación de virus en las células
pista acerca de lo que se conoce actualmente como memoria inmu- TXHSXGLHUHQLQIHFWDUVH0iVUHFLHQWHPHQWHHVWXGLRVUHDOL]DGRVFRQ
nológica. Esta propiedad, fue subsiguientemente corroborada en YDFXQDVH[SHULPHQWDOHVGRFXPHQWDURQTXHHVSRVLEOHORJUDUWDPELpQ
las HSLGHPLDVGH¿HEUHDPDULOODRFXUULGDVHQ9LUJLQLD((88\ XQDUHVSXHVWD7 DGHPiVGHODUHVSXHVWDKXPRUDOFRUUHVSRQGLHQWH de poliomielitis entre esquimales de Alaska.
mediante el uso de vacunas a DNA. Estos hallazgos han abierto proPHWHGRUDVH[SHFWDWLYDVSDUDVXIXWXUDXWLOL]DFLyQHQKXPDQRV
1.2. GENERALIDADES
&OiVLFDPHQWHVHFRQVLGHUDEDDORVanticuerpos como el único
factor de defensa contra los virus. Sin embargo, en las últimas déLos mecanismos de defensa del hospedador contra las infecciones FDGDVVHGHPRVWUyTXHIDFWRUHVLQHVSHFt¿FRV\ODLQPXQLGDGFHOXvirales han sido descriptos como una sinfoníaGHIDFWRUHV instru- ODUHVSHFt¿FDWLHQHQXQSDSHOIXQGDPHQWDOHQODUHFXSHUDFLyQGHO
mentos GH GLVWLQWRV PHFDQLVPRV HVSHFt¿FRV H LQHVSHFt¿FRV /D paciente en muchas enfermedades virales.
información obtenida del estudio de infecciones virales naturales
/RVPHFDQLVPRVPiVH¿FLHQWHVFRQORVTXHHOKRVSHGDGRUVH
RH[SHULPHQWDOHVSHUPLWLyHYDOXDUODLPSRUWDQFLDUHODWLYDGHDP- GH¿HQGH GH ODV LQIHFFLRQHV YLUDOHV GHSHQGHQ GHFLVLYDPHQWH GHO
bos mecanismos, ya que éstos varían de acuerdo a los diferentes modo por el cual los virus se diseminan dentro del hospedador.
virus que se consideren. Siguiendo con la imagen metafórica, al
Los virus pueden diseminarse por tres vías. El primer tipo
LJXDOTXHHQXQDVLQIRQtDH[LVWHQPRPHQWRVGRQGHGHEHDFWXDU GHGLVHPLQDFLyQHVDWUDYpVGHOOtTXLGRH[WUDFHOXODU/DSURJHQLH
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
136
YLUDO QHRIRUPDGD TXH LQFOX\H SDUWtFXODV LQIHFWDQWHV ±YLULRQHV±
\ GHIHFWLYDV QR LQIHFWDQWHV HV OLEHUDGD SRU OLVLV D HVH OtTXLGR
$WUDYpVGHOPLVPRORVYLULRQHVSRGUiQLQIHFWDUDRWUDVFpOXODV
'HELGRDHVWDWUDYHVtDYLUDOHVSRVLEOHSRUHMHPSORLQKLELU±HQ
XQFXOWLYRLQIHFWDGRH[SHULPHQWDOPHQWHin vitro– el ingreso viral
a células vecinas susceptibles a la infección con los tres serotipos
del virus polio mediante anticuerpos monoclonales antirreceptor
para este virus. Ello resulta factible merced a que la diseminación
de este agente es obligatoriamente realizada a través de una etapa
H[WUDFHOXODU'HPDQHUDDQiORJDVHSURGXFHODneutralización viral in vivo cuando interactúan anticuerpos dirigidos contra sitios
FUtWLFRVGHODHVWUXFWXUDYLUDOPiVH[WHUQDTXHHQHOFDVRGHOYLUXV
polio consiste en una neutralización de los epítopes serotipo-esSHFt¿FRVGHVXFiSVLGH$OFLUFXODUOLEUHVHQHOWRUUHQWHVDQJXtQHR
IDVH YLUpPLFD HVWRV YLULRQHV SRGUiQ VHU QHXWUDOL]DGRV SRU GLchos DQWLFXHUSRVHVSHFt¿FRV
Sin embargo, la infección por virus que promueven la lisis celular también induce in vivo una respuesta inmune mediada por
FpOXODVFLWRWy[LFDV6XSDSHOHVWiGLULJLGRDODHOLPLQDFLyQGHFpOXODVLQIHFWDGDVDXQDQWHVGHVXHYHQWXDOOLVLVORFXDOSURPRYHUiOD
erradicación de la infección.
El segundo tipo de diseminación es por brotación de célula a
FpOXODHVGHFLUSRUFRQWLJLGDG(VWHSURFHVRQRHVHQVtPLVPR
causa de un daño grave a la célula, aunque en la membrana, antes
de la brotación, se anclan las glicoproteínas virales, desplazando a
las proteínas celulares. De hecho, múltiples virus que emergen por
HVWDYtDQRVRQFLWROtWLFRV HQWUHHOORVORVWRJDYLUXVFRPRHODJHQWH
etiológico de la rubéola, los virus SDUDLQÀXHQ]DHWF 6LQHPEDUJRH[LVWHQRWURVYLUXVTXHHPHUJLHQGRSRUEURWDFLyQVtLQGXFHQOD
destrucción celular, aunque por mecanismos no vinculados a este
proceso, como lo es la DSRSWRVLV3RUHMHPSORORVYLUXVKHUSHVVH
diseminan de célula a célula por brotación en las membranas de
FpOXODV FRQWLJXDV VLQ QHFHVLGDG GH SDVDU SRU HO OtTXLGR H[WUDFHlular. Sin embargo, estos virus pueden provocar la muerte de las
FpOXODVLQIHFWDGDVSURGXFWLYDPHQWHFRPRUHVXOWDGRGHODH[SUHVLyQ
GHFLHUWRVJHQHVYLUDOHV YpDVHHOFDStWXOR+HUSHV VLPSOH[" Debido a que generalmente los anticuerpos no neutralizan viUXV HQ HO LQWHULRU FHOXODU VH FRQRFHQ ORV IDVFLQDQWHV \ H[FHSFLRQDOHVHMHPSORVHQORVTXHHOYLUXVGHODUDELDSXHGHQHXWUDOL]DUVH
en cultivo de células de neuroblastoma mediante anticuerpos mo-
A
noclonales internalizados, o el virus KHSDWLWLV% +%9 HQHOLQWHrior de hepatocitos mediante DQWLFXHUSRVHVSHFt¿FRVLQWHUQDOL]DGRV
PHGLDQWHHQGRFLWRVLV HOPHFDQLVPRGHdefensa principal frente a
YLUXVEURWDQWHVQROtWLFRVHQHVWDHWDSDGHOFLFORGHLQIHFFLyQHVWi
PHGLDGR SRU FpOXODV FLWRWy[LFDV 6LQ HPEDUJR FXDQGR DOJXQR GH
los virus envueltos no citolíticos pasa a la circulación en forma
GH SDUWtFXOD OLEUH SRU HMHPSOR DQWH HO HJUHVR SRU HO SROR EDVR
ODWHUDOGHXQDFpOXODSRODUL]DGD TXHGDH[SXHVWRDODDFFLyQGHORV
DQWLFXHUSRV QHXWUDOL]DQWHV FRPR HQ HO FDVR GHO YLUXV SDURWLWLGLV
del virus Junín o del +%9 (QPRGRDQiORJRGXUDQWHORV~OWLPRV
DxRVVHKDH[SORUDGRODSRVLELOLGDGGHTXHanticuerpos intracelulaUHV Rintracuerpos" H[SHULPHQWDOPHQWHHODERUDGRV\FRQVWLWXLGRV HQORVGHSULPHUDJHQHUDFLyQ SRUXQDFDGHQD~QLFDSHSWtGLFD
con los dominios variables de las cadenas pesada y liviana de la
,JXQLGDVSRUXQSpSWLGRSXHGDQH[SUHVDUVHHQHOLQWHULRUFHOXODU
SUHVHUYDQGRODD¿QLGDGGHODQWLFXHUSRSDUHQWDO\UHGLUHFFLRQDUVHD
diversos compartimientos e inhibir ciertos virus. Estos "intracuerSRVKDQPRVWUDGRVXYHUVDWLOLGDGHQODLQKLELFLyQH[SHULPHQWDOGH
eventos tempranos y tardíos de la replicación in vitro del HIV, lo
que es un terreno de investigación en el campo de la terapia génica
YpDVHHOtWHP En síntesis, tanto los virus desnudos como envueltos que evenWXDOPHQWHLQYDGDQHOWRUUHQWHFLUFXODWRULRSRGUiQSHUGHUVXLQIHFtividad si el hospedador desarrolla una adecuada respuesta de anticuerpos neutralizantes. Sin embargo, en muchas ocasiones sólo a
WUDYpVGHPHFDQLVPRVPHGLDGRVSRUFpOXODVSRGUiHUUDGLFDUVHGH¿nitivamente la infección. La mayoría de los virus, aunque no todos,
LQGXFHXQDUHVSXHVWDPL[WDKXPRUDO\FHOXODU(OJUDGRGHSDUWLFLSDFLyQGHFDGDXQDGHHOODVYDULDUiVHJ~QHOYLUXVHQFXHVWLyQ
El tercer tipo de diseminación es por integración del genoma viral
al de la célula. El SURYLUXVTXHGDLQWHJUDGR al genoma de la célula
hospedadora y puede permanecer en ese estado por un cierto tiempo.
&XDQGRODFpOXODVHGLYLGHGDUiOXJDUDQXHYDVFpOXODVKLMDVTXHOOHYDUiQHQVXJHQRPDHOprovirus integrado. El provirus puede activarse
GDQGROXJDUDODIRUPDFLyQGHQXHYRVYLULRQHVTXHLUiQDLQIHFWDUD
RWUDVFpOXODV YpDVHHOFDStWXOR /RVUHWURYLUXV SRUHMHPSORHOYLUXVGHODLQPXQRGH¿FLHQFLDKXPDQD±HIV-, así como diversos virus
SURGXFWRUHVGHOHXFHPLDVOLQIRPDV VRQHMHPSORVGHHVWHtipo de disePLQDFLyQ$~QVHGHVFRQRFHFXiOSRGUtDVHUXQPHFDQLVPRGHdefensa
H¿FLHQWH\VX¿FLHQWHSDUDFRQWURODUODinfección por HIV.
B
Inmunidad
innata
Inmunidad
adaptativa
Inmunidad
innata
PMN
Cel. endoteliales
ColecƟnas
Acs. naturales
TLR
IFN
MɎ
NK
NKT
C
RNAi
Galectinas
Acs
LT CD4+
LT CD8+
LB
Inmunidad
ĂĚĂƉƚĂƟǀĂ
VASOS COMUNICANTES
Figura 7.2. Inmunidad innata y adaptativa. A./DLQPXQLGDGLQQDWD\ODDGDSWDWLYDVRQFRPRGRVJUDQGHVYDVRVFRPXQLFDQWHV8QD\RWUD
HVWiQHVWUHFKDPHQWHYLQFXODGDVSDUWLFLSDQGRYDULRVGHVXVUHVSHFWLYRVFRPSRQHQWHVHQODDFWLYLGDGGHDPEDVFRPRRFXUUHFRQODVFpOXODV
GHQGUtWLFDVB. &RPSRQHQWHVGHODLQPXQLGDGLQQDWD\GHODLQPXQLGDGDGDSWDWLYD301SROLPRUIRQXFOHDUHV$FVDQWLFXHUSRV&VLVWHPD
del FRPSOHPHQWR&'FpOXODVGHQGUtWLFDV7/5UHFHSWRUHV7ROOVtPLO Toll Like Receptors ,)1LQWHUIHUyQ0ɎPDFUyIDJRV/7OLQIRFLWRV7
/%OLQIRFLWRV%51$Linterferencia de RNA mediada por siRNA (small interfering RNA) y microRNA (PL51$ 9pDVHTXHDOJXQRVHOHPHQWRVIRUPDQSDUWHGHDPERVFRPSDUWLPLHQWRV LQWHUVHFFLyQGHFRQMXQWRV DXQTXHFXPSOHQIXQFLRQHVPiVSUHSRQGHUDQWHVSDUDXQR~RWUR
2EVHUYHHOOHFWRUTXHHQODUHJLyQFRUUHVSRQGLHQWHDGLFKDLQWHUVHFFLyQGHFRQMXQWRVORVHOHPHQWRVTXHFRUUHVSRQGHQIXQGDPHQWDOPHQWH
a la LQPXQLGDGDGDSWDWLYDDXQTXHSDUWLFLSDQGHODLQQDWDVHPHQFLRQDQWDPELpQFRQOHWUDLWiOLFDORVDQWLFXHUSRVSXHGHQSDUWLFLSDUGH
la citotoxicidad mediada por FpOXODVNK, y los linfocitos T CD4+DFWLYDQWDPELpQDGLFKDVFpOXODV/RVPDFUyIDJRVODVNK, las NKT y las
FpOXODVGHQGUtWLFDVPRGHODQODDFWLYLGDGGHODLQPXQLGDGDGDSWDWLYDDWUDYpVGHODVVHxDOHVHQYLDGDVDORVlinfocitos T, dependientes de
VXLQWHUDFFLyQFRQGHWHUPLQDGRV3$03(OVLVWHPDGHOFRPSOHPHQWRQRVyORSDUWLFLSDHQODLQPXQLGDGLQQDWDVLQRWDPELpQHQODYLUyOLVLV
LQPXQHPHGLDGDSRUDQWLFXHUSRV\HQODUHJXODFLyQGHODDFWLYLGDGGHlinfocitos T CD8+
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
Característica
Inmunidad innata
137
Inmunidad adaptativa
Desarrollo en la HYROXFLyQGHODV
especies
0X\DQWLJXR
Más reciente
&RGL¿FDFLyQJHQpWLFDGHUHFHSWRUHV
Línea germinal
Recombinación somática
Característica del reconocimiento
Rígido
Flexible y con memoria
Receptores
Receptores de reconocimiento de
SDWURQHVR553 7ROO5/+>5LJ
like [email protected]
FLWRVyOLFRGH'1$HWF
5HFHSWRUHV% ,J \7 7&5
Elemento reconocido
3DWURQHVPROHFXODUHVDVRFLDGRVD
patógenos o PAMP
Epítopes lineales o conformacionales
(por el UHFHSWRU% ROLQHDOHVHQHO
FRQWH[WRGHPROpFXODVGHO&0+ SRU
el receptor T) o glicolípidos (por CD1)
(VSHFL¿FLGDG
$PSOLRUDQJR
6tDOWDPHQWHHVSHFt¿FRV 553 R1R EDUUHUDVQDWXUDOHV
6tFRQH[TXLVLWDFDSDFLGDG
discriminativa
Afectación intrínseca
por contacto previo con
antígeno
No
Sí
Tabla 7.1. Cuadro comparativo entre la inmunidad innata y la adaptativa.
$FRQWLQXDFLyQVHLQWHQWDUiSXQWXDOL]DUDOJXQRVGHORVIDFWRUHV
\ORVPHFDQLVPRVFXDQGRIXHUHQFRQRFLGRV TXHSDUWLFLSDQHQOD
resistencia a la infección viral. En dicha resistencia participan mecanismos de naturaleza no inmune e inmune, siendo ésta innata o
DGDSWDWLYD )LJXUDV$\% 3RUUD]RQHVGHHVSDFLRVyORVHKDUi
énfasis en aquellos eventos vinculados a los mecanismos inmunes
de la defensa antiviral del hospedador, y a algunos conceptos recientemente incorporados a la Inmunología. El lector es referido a
WH[WRVJHQHUDOHVGH,QPXQRORJtDSDUDDPSOLDUWHPiWLFDVSDUWLFXODres de esta ciencia fascinante.
2. RESISTENCIA
INESPECÍFICA E INMUNIDAD INNATA
6LELHQODUHVSXHVWDLQPXQHLQQDWD GHOODWtQinnatus, nacer o produFLUVHHQ IXHFRQVLGHUDGDLQHVSHFt¿FDKDVWDDxRVUHFLHQWHVHOGHVcubrimiento de receptores celulares de reconocimiento de patrones
553 SUHVHQWHVHQDJHQWHVSDWyJHQRVHVWDEOHFLyLQGXELWDEOHPHQWH OD HVSHFL¿FLGDG GHO UHFRQRFLPLHQWR DXQTXH pVWH HV GH QDWXUDleza diferente al de la LQPXQLGDGDGDSWDWLYD 7DEOD 3RUHOOR
ODUHVLVWHQFLDLQHVSHFt¿FDQRHVXQVLQyQLPRGHUHVSXHVWDLQQDWD
Sin embargo, la inmunidad innata también comprende la presencia
GHEDUUHUDVQDWXUDOHVFRPRODSLHOVLQHVSHFL¿FLGDGDOJXQD3RUOR
H[SXHVWRVHFRQVLGHUDTXHODLQPXQLGDGLQQDWDH[KLEHXQDPSOLR
UDQJR GH HVSHFL¿FLGDGHV GH¿QLpQGRVH FRPR SHUWHQHFLHQWH D OD
PLVPDDORVHOHPHQWRVFHOXODUHV\VROXEOHVTXHQRHVWiQDIHFWDGRV
intrínsecamente por el contacto previo con el antígeno.
Los factores que modelan la inmunidad innata a los virus son
múltiples: entre ellos, merece destacarse la edad del hospedador,
en casos muy especiales también el sexo, su estado nutricional y
factores genéticos. La inmunidad innata comprende fenómenos
de regulación post-transcripcional de los RNAs virales mediados por siRNA (small interfering RNA) y miRNA (micro RNA),
interferencia en la replicación viral mediados por el sistema
Interferón (IFN), actividad de colectinas, anticuerpos naturales y del sistema complemento (C), así como la función de las
células macrofágicas, dendríticas, NK y NKT, y las epiteliales
de la piel y las mucosas intestinal y pulmonar. Los componentes
más relevantes de la inmunidad innata antiviral son las células
dendríticas (CD) y NK, los diferentes RNA interferentes y el
sistema IFN.
La edad del hospedador puede determinar la susceptibilidad
R OD UHVLVWHQFLD D GHWHUPLQDGRV YLUXV 3RU HMHPSOR ORV QHRQDWRV
infectados con HBV, mediante transmisión perinatal desarrollan
infecciones persistentes, ya que no son capaces de eliminar el virus
de su organismo, probablemente por una inadecuada respuesta de
su sistema inmunológico frente a la infección y por el efecto toleURJpQLFRGHODQWtJHQRVROXEOH+%H&RPRDGYHUWLUiHOOHFWRUHQHO
FDStWXORQRWRGDVODVFHSDV ODVGHQRPLQDGDVH-, ni el genotipo
* GHO+%9H[SUHVDQGLFKRDQWtJHQRSRUORTXHHOHIHFWRWROHURJpQLFRQRSRGUiSURPRYHUVHHQHVWRVFDVRV
'HVGH HO SXQWR GH YLVWD GH ODV LQIHFFLRQHV H[SHULPHQWDOHV VH
ha observado diferente susceptibilidad de ratones a la infección con
DUHQDYLUXVVHJ~QVXHGDG/RVUDWRQHVODFWDQWHVGHKGHYLGD
inoculados por vía intracerebral con el virus Junín –agente de la ¿HEUHKHPRUUiJLFDDUJHQWLQD±VRQDOWDPHQWHVHQVLEOHV\PXHUHQFRPR
consecuencia de una encefalomielitis mediada por OLQIRFLWRV7 /7 3RUHOFRQWUDULRORVUDWRQHVDGXOWRV PiVGHGtDV GHFDVLWRGDVODV
FHSDVHVWXGLDGDVKDVWDHOSUHVHQWHH[KLEHQUHVLVWHQFLDDODLQIHFFLyQ
con el mismo virus, desarrollando una infección inaparente con síntesis de DQWLFXHUSRVHVSHFt¿FRV(VWDGLIHUHQFLDHQHOFRPSRUWDPLHQto se atribuye a la maduración de la respuesta inmune y al desarrollo
HQORVDQLPDOHVDGXOWRVGHXQDUHVSXHVWDHVSHFt¿FDVXSUHVRUD
La edad también desempeña un papel relevante en infecciones
SRUYLUXVHVWDFLRQDOHVLQÀXHQ]D$ +1 \$ +1 REVHUYiQGRVHIUHFXHQWHPHQWHXQDSURJUHVLyQPiVJUDYHGHODLQIHFFLyQHQ
DQFLDQRV TXH HQ MyYHQHV R DGXOWRV La observación en las primeras semanas de la pandemia de gripe de 2009 por LQÀXHQ]D
$ +1 GHTXHHQWUHORVFDVRVLQLFLDOHVHOJUXSRPiVDIHFWDGR
era el de niños y jóvenes (y adultos menores de 60 años) causó
VLJQL¿FDWLYDLQWULJDHQODFRPXQLGDGFLHQWt¿FD/DXOWHULRUGLOXFLGDFLyQGHODHVWUXFWXUDFULVWDORJUi¿FDGHODhemaglutinina
del virus pandémico en 2009 y su comparación con el de 1918
TXHWDPELpQKDEtDFLUFXODGRHQDxRVVXEVLJXLHQWHV , demostró esWUHFKDVVHPHMDQ]DVTXHH[SOLFDQODLQPXQLGDGREVHUYDGDHQ
un cierto porcentaje de individuos mayores de 60 años.
El sexo puede estar también asociado a una diferente evolución
GHDOJXQDVLQIHFFLRQHVYLUDOHV7DOHVHOFDVRGHODhepatitis C, en la
TXHVHKDGRFXPHQWDGRTXHH[LVWHXQDDVRFLDFLyQHQWUHXQDPHQRU
WHQGHQFLDDOGHVDUUROORGHHYHQWRVFLUUyWLFRVHQPXMHUHV SHURQR
HQYDURQHV TXHH[SUHVDQHOJHQRWLSR**GHOSURPRWRUGH,/
DVRFLDGRDDOWDSURGXFFLyQGH,/ ORTXHFRQOOHYDDOGHVHQODFH
dual de una menor capacidad de eliminar el virus del organismo
HQODLQIHFFLyQFUyQLFDSHURFRQXQDPHQRUWHQGHQFLDDOD¿EURVLV
XQRGHORVWUHVHOHPHQWRVGHOSURFHVRFLUUyWLFRMXQWRDODQHFURVLV
\ODUHJHQHUDFLyQKHSDWRFtWLFD 138
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
En total discrepancia con la hipótesis de larga data que indicaEDTXHODWUDQVIHUHQFLDSDVLYDGH,J$ RHYHQWXDOPHQWHRWUDVPROpFXODVVROXEOHV GHRULJHQPDWHUQRPHGLDQWHODODFWDQFLDFRQ¿HUH
SURWHFFLyQDDPERVVH[RVSRULJXDOPX\UHFLHQWHPHQWHVHKDREservado que dicha alimentación promueve efectos diferentes en la
SUHYHQFLyQGHLQIHFFLRQHVYLUDOHVUHVSLUDWRULDVFRQ¿ULHQGRSURWHFción a las niñas, pero no a los niños, lo que sugiere la activación de
PHFDQLVPRVUHJXODGRVSRUKRUPRQDVHVSHFt¿FDVXRWUDVPROpFXODV
GLIHUHQFLDOPHQWHH[SUHVDGDVHQDPERVVH[RV
En niños desnutridos, muchas infecciones virales revisten mayor gravedad que en QLxRVHXWUy¿FRV(OORVHREVHUYDSRUHMHPSOR
en la HYROXFLyQPiVJUDYHGHGLYHUVDVLQIHFFLRQHVJDVWURLQWHVWLQDles o respiratorias. Esto se debe a que la desnutrición implica una
GHVYHQWDMDSDUDHOQRUPDOGHVDUUROORGHODUHVSXHVWDLQPXQH
Sorprendentemente, estudios efectuados en ratones infectados
con el virus &R[VDFNLH%GHPRVWUDURQWDPELpQXQDDOWHUDFLyQGH
la respuesta a dicho virus, como consecuencia de la alimentación
hipercolesterolémica, habiéndose sugerido que la susceptibilidad
DXPHQWDGD VHUtD GHELGD D OD GLVIXQFLyQ GH PDFUyIDJRV KHSiWLFRV
y a trastornos de la movilización de monocitos desde el lecho sanguíneo.
Los factores genéticos condicionan la presencia o ausencia de
UHFHSWRUHVHQODVPHPEUDQDVFHOXODUHVTXHSHUPLWLUiQODDGVRUFLyQ
de los virus, es decir, el primer paso de la replicación viral. Por
esta razón, el ser humano no se infecta generalmente con virus de
DQLPDOHV H[FHSWRHQHOFDVRGH]RRQRVLV RFRQYLUXVGHSODQWDVR
bacterias. La susceptibilidad a formas graves de algunas infecciones
YLUDOHVVHKDDVRFLDGRDFLHUWDVHVWUXFWXUDVJHQpWLFDVSRUHMHPSOR
H[LVWHPD\RUIUHFXHQFLDGHKHSDWLWLVFUyQLFDVHQLQGLYLGXRVTXHH[SUHVDQ DOHORV HVSHFt¿FRV GHO FRPSOHMR PD\RU GH KLVWRFRPSDWLELOLGDGSRUHMHPSOR%R'5$VLPLVPRVHKDLQIRUPDGRTXHHODOHOR
'5% WDQWRHQniños como en adultos se asocia en Gambia
VLJQL¿FDWLYDPHQWHDODUHFXSHUDFLyQIUHQWHDODLQIHFFLyQFRQHBV,
en contraste con quienes desarrollan una infección persistente. Ello
ha permitido postular que ese alelo podría conferir protección. Con
respecto a la infección por +,9VHKDGRFXPHQWDGRTXHH[LVWHXQ
EDMR SRUFHQWDMH GH LQGLYLGXRV TXH SXHGH SDGHFHU P~OWLSOHV H[SRVLFLRQHVDOYLUXVVLQLQIHFWDUVH\TXHRWURVD~QLQIHFWiQGRVHVREUHviven sin disminuir o disminuyendo mínimamente su nivel de /7
CD4+HQSUHVHQFLDGHXQDEDMDFDUJDYLUDO 51$YLUDOSODVPiWLFR GXUDQWHHOGHYHQLUGHORVVXEVLJXLHQWHVDxRV KDELWXDOPHQWHPiVGH
7UDEDMDGRUDVVH[XDOHVGURJDGLFWRVSHUVRQDOGHVDOXGFRQP~Otiples accidentes laborales, hemofílicos y bebés nacidos de madres
serológicamente positivas para HIV son algunos de los grupos en
ORVTXHVHKDQGRFXPHQWDGRHOIHQyPHQRGHH[SRVLFLyQP~OWLSOHVLQ
LQIHFFLyQ7DPELpQHQWUHGURJDGLFWRVKRPEUHVKRPRVH[XDOHVPXMHUHV\niños se observó la presencia de individuos no progresores
SRUSHUtRGRVSURORQJDGRV$OJXQRVGHHVWRVFDVRVHVWiQUHODFLRQDGRV
FRQODH[SUHVLyQGHUHFHSWRUHVPXWDGRVSDUDquimioquinas como el
&&5ǻ'DGRTXHODVYDULDQWHVPDFUyIDJRWUySLFDVGHOHIV utilizan como correceptor principal la molécula &&5 XQreceptor para
TXLPLRTXLQDV XQDGHOHFLyQGHSE XQSROLPRU¿VPR HQGLFKR
FRUUHFHSWRULQÀX\HHQHOHYHQWRGHLQJUHVRYLUDODGLFKDVFpOXODVOR
cual hace resistentes a las mismas a cepas virales macrofagotrópicas
Tipo celular
CMH-II
TXHORXWLOL]DQSDUDVXLQJUHVRFHOXODU'DGRTXHFDGDLQGLYLGXRH[KLEHGRVFRSLDVDOpOLFDVGHOJHQTXHFRGL¿FD&&5SXHGHQREVHUYDUVH
FDVRVGHLQGLYLGXRVKRPRFLJRWDV &&5ǻǻ RKHWHURFLJRWRV
&&5VDOYDMHǻ (OGHODSREODFLyQFDXFiVLFDHVKRPRFLJRWDSDUDODGHOHFLyQǻ\HOHVKHWHURFLJRWDSDUDODPLVPD6L
ELHQORVLQGLYLGXRVKRPRFLJRWDVSDUD&&5ǻQRVHLQIHFWDQFRQ
cepas que utilizan dicho correceptor, sí pueden hacerlo por otras que
HPSOHHQXQFRUUHFHSWRUGLIHUHQWHSRUORTXHODVSUiFWLFDVVH[XDOHV
±DVtGHQRPLQDGDV±VHJXUDVHVWiQLJXDOPHQWHUHFRPHQGDGDVSDUD
este grupo. La heterocigosidad &&5VDOYDMHǻHVWiIXHUWHPHQWH
DVRFLDGD WDPELpQ D OD UHVLVWHQFLD D OD WUDQVPLVLyQ VH[XDO KRPEUH
KRPEUH\KRPEUHPXMHUGHOHIV, aunque no hay evidencias conclu\HQWHVDFHUFDGHVXLQÀXHQFLDHQODLQIHFFLyQGHEHEpVLQIHFWDGRVHQ
la etapa perinatal, cuando se las comparó con aquellos que portaban
ORVDOHORVVDOYDMHV
Con un efecto inverso, se ha demostrado que un número menor de copias que el correspondiente al promedio poblacional de
una región genómica de duplicación segmentaria que comprende
OD TXH FRGL¿FD OD TXLPLRTXLQD &&// 0,3 Į 3 XQ OLJDQGR
para &&5\WDPELpQXQSRWHQWHVXSUHVRUGHO+,9 VHDVRFLDD
un incremento en la susceptibilidad al HIV/SIDA.
2.1. CÉLULAS QUE PARTICIPAN EN LA INMUNIDAD INNATA
(QOD¿JXUD%VHLQGLFDQDOJXQDVGHODVFpOXODVGHODLQPXQLGDG
innata. Si bien también participan los polimorfonucleares neutró¿ORV HRVLQy¿ORV \ EDVy¿ORV ORV PDFUyIDJRV \ ODV FpOXODV HQGRWHOLDOHVVHKDUiHVSHFLDOpQIDVLVHQODSDUWLFLSDFLyQGHODVcélulas
dendríticas y las NK por su rol decisivo en la inmunidad antiviral.
/RV PHFDQLVPRV GH DFFLyQ SXHVWRV HQ HMHFXFLyQ SRU ODV FpOXODV
polimorfonucleares y macrófagos, así como el rol de las endoteliaOHVVHGHVFULEHQHQOLEURVGHWH[WRGH,QPXQRORJtD\H[FHGHQORV
REMHWLYRVGHHVWHFDStWXOR
2.1.1. Células dendríticas: su rol como "puente"
entre la respuesta inmune antiviral innata y la adaptativa
Las CD corresponden a una población heterogénea celular que
desempeñan un papel preponderante durante la transición de la
respuesta inmune antiviral innata a la adaptativa, a través de la secreción de citoquinas inmunomoduladoras y como células presentadoras de antígenos requeridas para la activación y proliferación
GHFpOXODV7$GLIHUHQFLDGHORVPDFUyIDJRV\OLQIRFLWRV% /% -las otras células presentadoras de antígenos profesionales, las CD
VRQODV~QLFDVTXHSXHGHQDFWLYDULT vírgenes, induciendo una
respuesta inmune primaria 7DEOD $GHPiVODVCD se encuentran en sitios dentro del organismo donde los virus inician su
multiplicación antes de diseminarse a otros órganos blancos de la
infección, por lo que sensan señales del medio ambiente indicativas de su presencia.
Subpoblaciones de células dendríticas. Desde el punto de
vista funcional, las &' VH FODVL¿FDQ HQ GRV HVWDGLRV LQPDGXUDV
o maduras. La CD inmaduras se especializan en la captación de
DQWtJHQRVHQWHMLGRVSHULIpULFRV\HQVHQVDUHYHQWRVGHLQÀDPDFLyQ
LQIHFFLyQPDGXUDQGRKDFLDGLIHUHQWHVSHU¿OHV/DVCD maduras
Moléculas
coestimulatorias
Función como célula
presentadora de antígeno
&pOXODGHQGUtWLFD
(CD)
&RQVWLWXWLYD
ĹĹHQ&'PDGXUDV
&RQVWLWXWLYD EDMD
ĹĹHQ&'PDGXUDV
Activación de /7YtUJHQHVHLQLFLRGH5,
Activación de LT efectores y de memoria
,QGXFFLyQGHOD5,VHFXQGDULD
Macrófago
(0Ɏ)
&RQVWLWXWLYD EDMD
ĹHQ0Ɏ activados
&RQVWLWXWLYD
PX\EDMD
ĹHQ0Ɏ activados
Activación de LT efectores y de memoria
,QGXFFLyQGHOD5,VHFXQGDULD
/LQIRFLWR%
(/%
&RQVWLWXWLYD EDMD
ĹHQ/%DFWLYDGRV
&RQVWLWXWLYD EDMD
ĹHQ/%DFWLYDGRV
Activación de LT efectores y de memoria
,QGXFFLyQGHOD5,VHFXQGDULD
Tabla 7.2. Comparación entre diferentes células presentadoras de antígeno profesionales. 5,5HVSXHVWDLQPXQH
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
Característica
CD inmaduras
CD maduras
7HMLGRVSHULIpULFRV
ÏUJDQRVOLQIiWLFRVVHFXQGDULRV
Capacidad endocítica
+++
+
Capacidad de procesamiento de
antígenos
+++
+
0ROpFXODVFRHVWLPXODWRULDV\&0+,\,,
+
+++
Capacidad de presentar antígenos a
LT vírgenes
+
+++
Expresión de CCR7+
+
+++
Ubicación
139
Tabla 7.3. Diferencias entre células dendríticas maduras e inmaduras. *La mayor expresión de CCR7 en las &'PDGXUDVVHDVRFLDD
ODFDSDFLGDGGHODVPLVPDVGHLQWHUDFWXDUFRQORVOLJDQGRV&&/\&&/GLUHFFLRQDQGRDVtDHVWDSREODFLyQFHOXODUKDFLDODVFpOXODV
endoteliales linfáticas y las +(9 High Endothelial VenulesYpQXODVGHOHQGRWHOLRDOWR GHODV]RQDV7GHORVyUJDQRVOLQIiWLFRVVHFXQGDULRV
NK
TLR-3
TLR-9
TLR-3
Virus
CpG
DNA
RIG-1
RNAsc
RNAdc
TLR-9
TLR-7
Célula
dendrítica
plasmocitoide
,)1Į, IFN-ß
IL-12
TLR-3
CD80/CD86
,)1Į‰
71)Į
IL-12
Célula
dendrítica
mieloide
IFN-ß,)1Į
IL-12
RIG-1
CD80/CD86
IFN-ß,)1Į
IL-12
Figura 7.3. Reconocimiento de la infección viral por células dendríticas (CD). /DVFpOXODV SRUHMHPSOR¿EUREOiVWLFDV LQIHFWDGDV
FRQYLUXVOLEHUDQDOPHGLRPRWLYRV'1$ELFDWHQDULRFRQWHQLHQGRPRWLYRV&S*\51$PRQRFDWHQDULR 51$VF TXHVRQUHFRQRFLGRVSRU
receptores TLR-9 y TLR-7, respectivamente, expresados en los endosomas de las &'SODVPRFLWRLGHV &'S (VWDVFpOXODVSURGXFHQSULQFLpalmente ,)1Į\WDPELpQ,)1ȕH,/ 2WUDVFpOXODVLQIHFWDGDVFRQYLUXVSXHGHQOLEHUDU51$GFTXHHVUHFRQRFLGRSRU7/5ORTXH
SXHGHHVWLPXODUODOLEHUDFLyQGH,)1ȕH,)1ĮMXQWRD,//DH[SUHVLyQGH7/5YDUtDFRQODHVWLUSHFHOXODU\DTXHVHODKDREVHUYDGR
HQODVXSHU¿FLHGH¿EUREODVWRV\HQYHVtFXODVLQWUDFHOXODUHV HQGRVRPDV GH&'P /DSURWHtQDRIG-1 (5HWLQRLFDFLG,QGXFLEOH*HQH
XQDSURWHtQDPLHPEURGHODIDPLOLDGHODVKHOLFDVDVR5/+>5LJ/[email protected] DOLJXDOTXHVXDQiORJD0GD Melanoma differentiation
DQWLJHQ SXHGHQVHQVDUODSUHVHQFLDGH51$GFFXDQGRHOPLVPRVHHQFXHQWUDHQHOFLWRVRO/DSURWHtQDDGDSWDGRUDIPS-1 (,QWHUIHURQȕ
3URPRWHU6WLPXODWRU) también denominada MAVS (Mitochondrial Anti-Viral Signalling), VISA o CARDIF media los efectos de RIG-1 en la
activación del ,)1ȕDODYH]TXHPHGLDQWHXQGRPLQLRGHWUDQVPHPEUDQDVHORFDOL]DHQPLWRFRQGULDFRQORTXHHVWDRUJDQHODSDUHFHUtD
WDPELpQSDUWLFLSDUGHODUHVSXHVWDLQQDWD6HKDSRVWXODGRODH[LVWHQFLDGHRWURVHQVRUFLWRVyOLFRSDUD'1$D~QQRLGHQWL¿FDGR /DVNK
a través de receptores TLR-3 y 7/5UHFRQRFHQODLQIHFFLyQHMHUFLHQGRHOHIHFWRFLWRWy[LFRVREUHDTXHOODVFpOXODVLQIHFWDGDVTXHH[SUHVDQ
PROpFXODVGHO&0+,GLVPLQXLGDVHQVXVXSHU¿FLH /DVFpOXODV¿EUREOiVWLFDVLQIHFWDGDVSXHGHQVHQVDUGLFKRHYHQWRXWLOL]DQGRUHFHSWRUHVSUHVHQWHVHQVXVXSHU¿FLHFHOXODUFRPRTLR-3 o en el citosol, como 5,*ORTXHLQGXFHODSURGXFFLyQGH,)1Įȕ\RWUDVFLWRTXLQDV
TXHHVWLPXODQODDFWLYLGDGGHODV&'P
H[KLEHQODFDSDFLGDG~QLFDGHDFWLYDUOLQIRFLWRV7YtUJHQHVRnaïve
7DEOD A su vez, las &'VHFODVL¿FDQVHJ~QVXPRUIRORJtDRQWRJHQLD\
PDUFDGRUHVGHVXSHU¿FLHHQ&'SODVPRFLWRLGHV &'S \PLHORLGHV
&'P R FRQYHQFLRQDOHV (VWDV ~OWLPDV LQFOX\HQ D ODV FpOXODV
HSLGpUPLFDVGH/DQJHUKDQV HQKRPHQDMHD3DXO/DQJHUKDQVTXLHQ
GHVFULELySRUYH]SULPHUDHQODVcélulas dendríticas de la epiGHUPLV \DODVGpUPLFDV\ODVLQWHUVWLFLDOHV0LHQWUDVODVcélulas
GHQGUtWLFDVPLHORLGHVLQPDGXUDV &'F+&'EDMR UHVLGHQHQOD
SLHO\PXFRVDVODVSODVPRFLWRLGHVLQPDGXUDV &'F-&'alto ORKDFHQHQODFLUFXODFLyQ\HQORVyUJDQRVOLQIiWLFRVVHFXQGDULRV
Estas últimas no pueden activar OLQIRFLWRV7YtUJHQHV/DH[SUHVLyQ
intracelular de los receptores 7/5\7/5 YpDVHPiVDGHODQWH en las células plasmocitoides, les permite reconocer tanto el DNA
viral como el RNA viral monocatenario. Estas células desempeñan
un papel central en la producción de ,)1tipo I, que alcanza niveOHV D YHFHV VXSHULRUHV D ORV GH RWUDV FpOXODV QXFOHDGDV
del organismo, por lo cual cumplen un rol decisivo en la respuesta
antiviral ante una infección aguda.
Reconocimiento de la infección viral por las CD. Estas
células son capaces de detectar a los virus a través de los 7/5
Toll Like Receptors, los receptores WLSR7ROOR7ROOVtPLO \GH
RWURVUHFHSWRUHV )LJXUD SURFHVDU\SUHVHQWDUORVDQWtJHQRV
YLUDOHV HQ HO FRQWH[WR GH ODV PROpFXODV &0+ GH FODVH ,, D ODV
FpOXODV7ODVFXDOHV±DVXYH]±SURPRYHUiQODUHVSXHVWDLQPXQH
adaptativa.
140
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
HSV-1 / 2
RSV
HSV-1 / 2
TLR-2
TLR-4
TLR-9
Influenza
TLR-7/ -8
Rotavirus
TLR-3
Superficie
celular
Intracelular
endosoma y RE
Mal/TRAP
Mal/TRAP
MyD88
TRIF
MyD88
MyD88
IRAK 1/2
IKK -α, -β, -γ
NFkB
TBK-1
IKK -ε
IRF-3,-5,-7
TRIF
IL-6, IL-8, MCPI, RANTES
IFN-α, IFN-β, RANTES
Figura 7.4. Vías de señalización intracelular a través de los receptores TLR, a nivel de la membrana citoplasmática (TLR-2 y TLR-4)
y en el intracelular (endosoma o RE). 2EVpUYHVHHOSDSHOGHODPROpFXODDGDSWDGRUD0\'HQODVYtDVGHVHxDOL]DFLyQGHWRGRVHOORV
excepto con 7/5TXHORKDFHH[FOXVLYDPHQWHDWUDYpVGHODPROpFXOD75,)$WUDYpVGHVXFHVLYRVHYHQWRVGHIRVIRULODFLyQLQLFLDGRVSRU
ODVTXLQDVDV,5$.\7%.ORVIDFWRUHVWUDQVFULSFLRQDOHV1)ț%H,5) Interferon Regulatory Factor) -3, -5 y -7 son translocados al
Q~FOHRGRQGHLQGXFHQODH[SUHVLyQGHFLWRTXLQDVSURLQÀDPDWRULDVHIFN de WLSR,/DLQWHUDFFLyQHQWUHSDWURQHVPROHFXODUHVDVRFLDGRVD
patógenos (PAMP) con el receptor 7/5SURPXHYHODDFWLYDFLyQGHOLQIRFLWRV7K3RUHOFRQWUDULRODLQWHUDFFLyQHQWUHGLFKRV3$03FRQ
TLR-4, TLR-7/-8, TLR-9 y 7/5VHDVRFLDDOGHVDUUROORGHXQDUHVSXHVWD7K(QFLHUWDVRFDVLRQHVHO7/5SXHGHWDPELpQSURPRYHUXQD
UHVSXHVWDPHGLDGDSRU,/TXHFRQGXFHDODDFWLYDFLyQGH7UHJ
No
Lisis
IFN
Lisis y
eliminación
viral no lítica
Lisis
NK
CTL
IFN
Figura 7.5. Reconocimiento de la infección viral por células NK y linfocitos T citotóxicos (CTL) CD8+. &pOXODVSHUPLVLYDVDODLQIHFFLyQYLUDOVRQDWDFDGDVSRUXQYLUXVGHWHUPLQDGR&RPRUHVXOWDGRLQLFLDOGHODLQIHFFLyQGLVPLQX\HODH[SUHVLyQGHPROpFXODVGHKLVWRFRPSDWLELOLGDGGHFODVH,HQODVXSHU¿FLHFHOXODU(VWRWRUQDDODVFpOXODVLQIHFWDGDVLQLFLDOPHQWHSDVLEOHVGHODDFWLYLGDGFLWRWy[LFDGHODV1.
/DFpOXODLQIHFWDGDSURPXHYHODOLEHUDFLyQGH,)1TXHHVWLPXODDODV1.\SURPXHYHODH[SUHVLyQGHPROpFXODVGHO&0+,HQODVFpOXODV
LQIHFWDGDV(OORFRQVWLWX\HXQDVHxDOLQKLELWRULDSDUDODV1.\HVWLPXODWRULDSDUDORV&7/TXHUHFRQRFHQSpSWLGRVYLUDOHVHQHOFRQWH[WRGH
GLFKDVPROpFXODV/DHOLPLQDFLyQYLUDOVHSURGXFHPHGLDQWHPHFDQLVPRVOtWLFRV Fas/)DV/SHUIRULQDJUDQ]LPD% RGHLQKLELFLyQQROtWLFD
de la replicación viral, mediada por FLWRTXLQDV ,)1Ȗ\71)Į (OWpUPLQR7ROOIXHLQWURGXFLGRSRU&1VVOHLQ9ROKDUG\(
Wieschaus al descubrir una mutante letal que afectaba el desarrollo
embrionario de la mosca blanca de la fruta Drosophila melanogaster &XDQGR :LHVFKDXV PRVWUy HO SHU¿O GH OD FXWtFXOD GH ORV
HPEULRQHVLQIpUWLOHVD1VVOHLQ9ROKDUGpVWHH[FODPy£7ROOTXH
HQHOLGLRPDDOHPiQVLJQL¿FD¡Fantástico!. Subsiguientemente, se
GHPRVWUyTXHODPROpFXOD7ROOHUDFUXFLDOHQHOGHVDUUROORGHLQPXQLGDGDQWLI~QJLFD(QORVPDPtIHURVVHKDUHFRQRFLGRODH[LVWHQFLDGHXQDIDPLOLDGHSURWHtQDVVLPLODUHVD7ROOORVUHFHSWRUHVtipo
7ROOR7ROOVtPLO(VWRVUHFHSWRUHVHVWiQSUHVHQWHVHQODVFpOXODVGH
la respuesta innata así como en células endoteliales, epiteliales y
¿EUREODVWRV
Los 7/5 VRQ XQD FODVH GH UHFHSWRUHV GH UHFRQRFLPLHQWR GH
SDWURQHV 553 GHVFULSWRVUHFLHQWHPHQWH,QWHJUDQXQDIDPLOLDGH
UHFHSWRUHV±WDQWRH[WUDFRPRLQWUDFHOXODUHV– que es responsable del
reconocimiento de agentes infecciosos permitiendo la iniciación de
ODUHVSXHVWDLQPXQHSULPDULDPHQWHLQQDWD\OXHJRDGDSWDWLYD )LJXUD Si bien todas las células del organismo pueden producir y secretar ,)1ĮȕOXHJRGHXQDFRUUHFWDHVWLPXODFLyQODVCD luego
de la estimulación viral son las mayores productoras de ,)1/DV
&'S\ODV&'PGL¿HUHQHQVXKDELOLGDGSDUDUHFRQRFHUGLIHUHQcias asociadas con los patrones moleculares asociados a patógenos
R3$03V Pathogen-Associated Molecular Patterns DWUDYpVGH
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
141
Célula presentadora de antígeno
CD80 / CD86
CMH-I
Antígeno viral
Señal 1
Señal 2
Citoquinas
Señal 3
Receptor de LT
CD28
Receptor de
citoquinas
Linfocito T
Figura 7.6. Señales requeridas para la activación de un linfocito T. (QODVLQDSVLVLQPXQHHQWUHXQDFpOXODSUHVHQWDGRUDGHDQWtJHQR
&3$ \XQOLQIRFLWR7VHUHTXLHUHQWUHVVHxDOHVSDUDDFWLYDUDHVWH~OWLPR/DVHxDOFRQVLVWHHQODSUHVHQWDFLyQGHOSpSWLGRDQWLJpQLFR
HQHOFRQWH[WRGHPROpFXODVGHO&0+,GHOD&3$8QDVHJXQGDVHxDOGHDFWLYDFLyQHVSURYLVWDSRUODFpOXODSUHVHQWDGRUDDWUDYpVGHOD
LQWHUDFFLyQHQWUHODVPROpFXODVFRHVWLPXODWRULDV&'&'FRQ&' 6LODLQWHUDFFLyQVHSURGXFHFRQ&7/$>Cytotoxic T Lymphocyte
Antigen [email protected] /DVHxDOHVSURYLVWDSRUODVFLWRTXLQDVOLEHUDGDVTXHLQWHUDFW~DQFRQORVUHFHSWRUHVSUHVHQWHVHQHO
OLQIRFLWR7
diversos 7/5 SUHVHQWHV HQ OD VXSHU¿FLH GH ODV &' 3RU HMHPSOR
ODV &'S H[SUHVDQ 7/5 TXH UHFRQRFH '1$ EDFWHULDQR \ YLUDO
PLHQWUDV TXH ODV &'P H[SUHVDQ7/5 TXH UHVSRQGH D ORV /36
pero no al DNA microbiano. De aquí que la respuesta innata no
GHEDFRQVLGHUDUVHYHUGDGHUDPHQWHLQHVSHFt¿FD
$O PHQRV 7/5 HVWiQ FRGL¿FDGRV HQ HO JHQRPD KXPDQR
FDGDXQRGHORVFXDOHVHVFDSD]GHGHWHFWDUDXQ3$03HVSHFL¿FR
pero sólo diversos 7/5 KDQ VLGR DVRFLDGRV D OD LQGXFFLyQ GH OD
síntesis de ,)1Įȕ(QWUHHOORVVHSXHGHQPHQFLRQDUD7/5
\7/5HVWiLQYROXFUDGRHQHOUHFRQRFLPLHQWRGHRNAdc
H[WUDFHOXODUHVSRUHVWRTXHHVWH7/5QRHVWiDVRFLDGRDODGHWHFción de virus intracelular. 7/5 GHWHFWD 3$03 HQ SURWHtQDV WDO
FRPRVHGHVFULELySDUDODSURWHtQD)GHOvirus sincicial respiratorio
\ODSURWHtQD(QYGHOYLUXVGHOWXPRUPDPDULRPXULQR 0079 A su vez, los 7/5\KDQVLGRUHFLHQWHPHQWHGHVFULSWRVFRPR
PROpFXODVDVRFLDGDVDHQGRVRPDVPLHQWUDVTXHHOSULPHURGHWHFWD51$VFHOVHJXQGRHVDFWLYDGRSRU'1$GFQRPHWLODGR &S*
'1$ Luego del reconocimiento de un PAMP por un 7/5HVSHFt¿FR
la porción intracelular del UHFHSWRU GHQRPLQDGD7,5 LQWHUDFW~DFRQ
GLYHUVDVPROpFXODVDGDSWDGRUDVWDOHVFRPR0\' Myeloid Differentiation factor 7,5$3 Toll-Interleukin 1 Receptor domaincontaining Adaptor Protein 75,)7,&$0 TIR domain-Containing
Adaptor Molecules R 75$0 TRIF Related Adaptor Molecules (VWDVPROpFXODVDGDSWDGRUDVDVXYH]LQWHUDFW~DQFRQ,5$. IL-1
Receptor-Associated Kinase SDUDWUDQVGXFLUODVHxDOTXHYDDFXOPLQDUFRQODIRVIRULODFLyQGHOLQKLELGRUGH1)N% ,N% \ODFRQVLJXLHQWH
WUDQVORFDFLzQGH1)N%DOQ~FOHRSDUDHVWLPXODUODWUDQVFULSFLyQGHODV
FLWRTXLQDVSURLQÀDPDWRULDV\GH,)1Įȕ6HKDGHVFULSWRWDPELpQ
TXHODH[SUHVLyQGH,)1ȕSXHGHRFXUULUDWUDYpVGH7/5\7/5
SRUXQDYtDLQGHSHQGLHQWHGH0\' )LJXUD &RPRVHOHHUiPiVDGHODQWHODVHFUHFLyQGH,)1QRHVVRODmente esencial para establecer una adecuada respuesta inmune
antiviral innata, sino que es igualmente crucial para disparar la
VXEVLJXLHQWHUHVSXHVWDLQPXQHDGDSWDWLYD/DH[SUHVLyQGH,)1ȕ
\ȖHVWDPELpQGHYLWDOLPSRUWDQFLDSDUDODPDGXUDFLyQGHODVCD
\ODVXEVLJXLHQWHH[SUHVLyQGHORVJHQHVHVWLPXODGRVSRU,)1FRQRFLGRVFRPR,6* Interferon Stimulated Genes /DPDGXUDFLyQ
GH HVWDV FpOXODV HVWi FDUDFWHUL]DGD SRU OD SURGXFFLyQ GH citoquiQDVSURLQÀDPDWRULDVWDOHVFRPR,/\71)Į Tumor necrosis
factorĮ \ODUHJXODFLyQSRVLWLYDGHPROpFXODVFRHVWLPXODGRUDV
&'&'\&' ,/±DVXYH]±SURPXHYHODGLIHUHQFLDción de /7KDFLDHOSHU¿O7KVHJXLGDGHODVHFUHFLyQGH,)1Ȗ(Q
este proceso de promoción de la respuesta 7KWDPELpQSDUWLFLSDQ
OD,/OD,/\OD,/
Interacción de las CD con otras células. Las células dendrítiFDVWLHQHQXQGLiORJRFUX]DGRFRQFpOXODVGHODLQPXQLGDGLQQDWD
SRUHMHPSORNK, 1.7\/7Ȗį \DGDSWDWLYD /7\/% $FRQWLQXDFLyQVHGHVFULELUiQDOJXQRVDVSHFWRVGHODVLQWHUDFFLQHVFRQ
células NK y /7
Interacción con las células NK. Ante la captura de un antígeno ORFXDOSXHGHRFXUULUPHGLDQWHHQGRFLWRVLVRPDFURSLQRFLWRVLV , las CD maduras liberan IL-12, IL-15 e IL-18 activando a
las NK y promoviendo mediante contactos receptor-ligando su
maduración (&'bright >[email protected]&'dim >GHOLQJOpV
[email protected]) A su vez, las NK secretan 71)ĮH,)1ȖORFXDOSURmueve la maduración de las CD, y destruyen a las CD inmaduras PHGLDQWHHOUHFRQRFLPLHQWRDWUDYpVGHVXUHFHSWRU1.S Este diálogo intercelular es crucial para el devenir de la respuesta inmune. Por una parte, a la función inicialmente conocida
de las dendríticas de activar /7naïve, se le agrega la de hacerlo
también con las 1.3RURWUDHVWDVFpOXODVGH¿QHQHOSHU¿OGHCD
TXHPLJUDUiDORVyUJDQRVOLQIiWLFRVVHFXQGDULRVGRQGHGLFKDVCD
SRGUiQLQLFLDUODUHVSXHVWDDGDSWDWLYDDOSUHVHQWDUORVDQWtJHQRVD
los /7naïve CD maduras), o bien promover efectos tolerogénicos
CD inmaduras no eliminadas por las 1. Las células NK constituyen un pilar esencial de la respuesta inmune innata. Según las
GH¿QLHUD.DUUHPHWDIyULFDPHQWHHQHVWDVFpOXODVreconocen
al submarino extrañoTXHSRGUtDVLJQL¿FDUODSUHVHQFLDGHXQSDWyJHQR GHQWUR GH XQD FpOXOD DVt FRPR WDPELpQ HO DGYHQLPLHQWR
GH XQD FpOXOD WXPRUDO (V GHFLU VRQ FDSDFHV GH UHFRQRFHU SRU
HMHPSORODSUHVHQFLDGHXQYLUXVHQXQDFpOXODVLQQHFHVLGDGGH
HVDVVHxDOHVHQVXSHU¿FLH ORVSpSWLGRVSUHVHQWDGRVHQHOFRQWH[WR
de &0+,R,, SURSLRVGHODUHVSXHVWDDGDSWDWLYDPHGLDGDSRUORV
/7(QOXJDUGHWHQHUTXHUHFRQRFHUXQDFRQVWHODFLyQGHSpSWLGRV
diferentes provenientes de un número incontable de patógenos, la
142
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
CD
LT CD4+
naïve
IFN- Ȗ (NK)
IL-12, IL-18,
IL-6 ,
IL-23, IL-27
IL-4
(Mĭ, CD)
(NKT,
mastocitos)
IL-21, IL-23,
(CD, LT activados)
TGF-ȕ
TGF-ȕ
(CD, Treg )
(CD)
IL-12r
IL-23r
Th 1
Th 2
Th reg
Th 17
T-beW
GATA-3
FoxP3
ROR-ȖW
Figura 7.7. Subpoblaciones de linfocitos T CD4+. Los linfocitos T (LT) CD4+ naïve interactúan con las FpOXODVGHQGUtWLFDV &' /XHJRGH
UHFLELUODVVHxDOHVGHDFWLYDFLyQ\LQGLFDGDVHQOD¿JXUD\GHSHQGLHQGRGHODPELHQWHGHFLWRTXLQDVORFDO VHxDO VHSURGXFLUiOD
GLIHUHQFLDFLyQKDFLDORVOLQDMHV7K7KTreg o 7K6HLQGLFDHORULJHQSULQFLSDOGHGLFKDVFLWRTXLQDVHQOHWUDFXUVLYDHQWUHSDUpQWHVLV/RV
IDFWRUHVWUDQVFULSFLRQDOHVGHFLVLYRVSDUDODGLIHUHQFLDFLyQGHFDGDOLQDMHVHLQGLFDQDOSLHGHFDGDVXESREODFLyQGH/7/DVVXSREODFLRQHV
7KH[SUHVDQHOreceptor para IL-12 (IL-12r) y las 7KHOUHFHSWRUSDUD,/ ,/U /DVSDODEUDVVXEUD\DGDVHQIDWL]DQXQUROSUHHPLQHQWH
señal a detectar consiste en la disminución o ausencia de moléculas del &0+, HQ OD VXSHU¿FLH FHOXODU OLJDQGRV GH UHFHSWRUHV
inhibitorios de las 1. LUUHVSHFWLYDPHQWHGHOSDWyJHQRLQYROXFUDGR )LJXUD $VLPLVPRORVYLUXVSXHGHQSURPRYHUORVHIHFWRV
FLWRWy[LFRVGHODV1.PHGLDQWHODH[SUHVLyQGHOLJDQGRVSDUDORV
receptores activadores de las mismas. En general, esta respuesta
de las NK ocurre tempranamente durante la infección viral, lo cual
VLJQL¿FDXQREYLREHQH¿FLRSDUDHOKRVSHGDGRUPLHQWUDVVHIRUMD
la respuesta adaptativa.
Las células NK comprenden –VHJ~QODH[SUHVLyQGHPROpFXODVGHVXSHU¿FLH– las subpoblaciones en 1.&'dim &'bright y
1. &'bright &'dim, las que contribuyen -respectivamente- en
XQDSURSRUFLyQDODSREODFLyQGHNK circulantes en sangre periférica. La primera subpoblación corresponde a la que promueYH HYHQWRV FLWRWy[LFRV PHGLDGRV SRU SHUIRULQDV \ SRU HO VLVWHPD
)DV/)DV PROpFXODV H[SUHVDGDV ±UHVSHFWLYDPHQWH± HQ ODV NK y
HQODVFpOXODVEODQFR TXHFRQGXFHDODapoptosis, mientras que la
segunda estirpe es responsable de la secreción de citoquinas regulatorias, fundamentalmente ,)1Ȗ$PEDVVXESREODFLRQHVHVWiQ
involucradas crucialmente en la respuesta inmune antiviral. Por
WRGRORH[SXHVWRVHDFHSWDTXHlas células NK cumplen un rol
decisivo en la respuesta innata, y modulan el inicio de la respuesta adaptativa.
Interacción con los LT. Las CD son las responsables de de¿QLUWUHVDVSHFWRVFUXFLDOHVGHODUHVSXHVWDGHORVLT: si deben o
no responder, cómo responder y dónde hacerlo. Para ello las CD
GLVSRQHQGHXQVLVWHPDVXVWHQWDGRHQDOPHQRVWUHV \SDUDDOJXQRVDXWRUHVSUREDEOHPHQWHFXDWUR VHxDOHV LQWHUDFFLyQHQWUHHO
7&5\ODVPROpFXODVGHO&0+ LQWHUDFFLyQHQWUHODVPROpFXODV
FRHVWLPXODWRULDV&'&'\HOOLJDQGRHVSHFt¿FR&'GHORV
/7\ DFWLYDFLyQGHODVVXESREODFLRQHV7K7K7UHJR7K
)LJXUD Una vez que la CD reconoce la presencia de un PAMP determinado a través de un 7/5HVSHFt¿FRODVHxDOUHFLELGDSURGXFHXQD
impronta en dicha célula. Dependiendo del PAMP reconocido, las
&'SURGXFLUiQVHxDOHVGLIHUHQFLDOHVTXHLQWHUDFWXDUiQFRQGLVWLQWDV
poblaciones linfoideas.
Las &'PLHORLGHVLQPDGXUDVGLVWULEXLGDVHQORVWHMLGRVSHULféricos reconocen la presencia de patógenos antigénicos mediante
IDJRFLWRVLVPDFURSLQRFLWRVLV\DWUDYpVGHODH[SUHVLyQGHOHFWLQDV
"WLSR&\GHUHFHSWRUHVSDUD)F İ\Ȗ /DVCD llegan hasta los
VLWLRV GH OD LQÀDPDFLyQ GDGR TXH H[SUHVDQ UHFHSWRUHV SDUD quiPLRTXLQDVLQÀDPDWRULDVWDOHVFRPR&&5&&5&&5&&5
&&5&;&5\&;&5TXHJXtDQDODVFpOXODVKDFLDORVVLWLRV
GRQGHHVWiQSUHVHQWHVVXVOLJDQGRV ,/0&35$17(6HQWUH
RWURV 8QDYH]DOOt\DQWHHVWtPXORVGLYHUVRVTXHLQFOX\HQSULQFLpalmente al reconocimiento de PAMP por los 7/5ODVCD dismiQX\HQODH[SUHVLyQGHORVUHFHSWRUHVPHQFLRQDGRV\FRPLHQ]DQHO
proceso de maduración incrementando la del receptor CCR7, para
HOTXHH[LVWHQGRVOLJDQGRV8QRHVODTXLPLRTXtQDGHORVyUJDQRV
OLQIiWLFRV VHFXQGDULRV 6/& Secondary Lymphoid Chemokine &&/ \ HO RWUR HO OLJDQGR GH XQD TXLPLRTXLQD LQGXFLGD SRU HO
YLUXV(SVWHLQ±%DUU Epstein Barr virus-induced molecule 1 Ligand
Chemokine; ELC / &&/ SURGXFLGDSRUODV&'HQODViUHDV7
dependientes de los ganglios regionales.
Según el 7/5 LQYROXFUDGR HQ HO UHFRQRFLPLHQWR GHO 3$03
VH SURGXFLUiQ GLYHUVDV FLWRTXLQDV ODV TXH SURPRYHUiQ XQD PDduración de &' GH GLIHUHQWHV SHU¿OHV 6XEVLJXLHQWHPHQWH FRPR
UHVXOWDGRGHOGDxRKtVWLFRLQÀDPDWRULR SRULQIHFFLyQRQHFURVLV ODV &'P TXH H[SUHVDQ &&5 PLJUDQ GHVGH OD UHJLyQ LQÀDPDWRULDDWUDYpVGHOYDVROLQIiWLFRDIHUHQWHKDFLDODUHJLyQSDUDFRUWLFDO
7GHSHQGLHQWH GH ORV JDQJOLRV OLQIiWLFRV UHJLRQDOHV DWUDtGDV SRU
&'PDGXUDVUHVLGHQWHVTXHSURGXFHQ(/&&&/\TXHDWUDHQ
también a /7YtUJHQHVRUHFLpQDFWLYDGRV6HSURGXFHHQWRQFHVXQ
mayor nivel de moléculas &0+,,GHODVFRHVWLPXODWRULDV&'
&' % \&' % DVtFRPRGHGLYHUVDVPROpFXODVGH
adhesión. Merced a la actividad aumentada de 1)ț%VHLQFUHPHQta la producción de ciertas FLWRTXLQDV ,/71)Į,/ y[LGR
nítrico sintetasa inducible, y diversas quimioquinas. La maduración de las CD puede ocurrir también como respuesta a citoquinas
y otros mediadores producidos por leucocitos presentes en el sitio
GHODLQIHFFLyQRSRUFpOXODVUHVLGHQWHVWDOHVFRPR,/Į,/ȕ
71)Į,)1WLSR,R3J(DVtFRPRSRUFRQWDFWRFRQRWUDVFpOXODV
GHODUHVSXHVWDLQQDWD SRUHMHPSORNK, 1.7R/7Ȗį (QHOJDQJOLROLQIiWLFRODPDGXUDFLyQGHODCD es completa sólo al producirse la interacción con los /7/RV/7CD4+ y los /7&'+ utilizan
GLIHUHQWHVPHFDQLVPRVTXHLQFOX\HQ LQWHUDFFLRQHVHQWUH&'
HQ OD &' &'/ HQ HO /7 CD4+ DFWLYDGR LQWHUDFFLRQHV
entre )DV HQOD&' \)DV/ HQHO/7CD4+ DFWLYDGR \ ODVHcreción de ,)1Ȗ\71)ĮSURGXFLGRVSRU/7&'+ activado. Los
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
105
1
2
3
CD56
104
4
103
5
102
102
103
104
105
CD16
Figura 7.8. Subpoblaciones de células NK en sangre periférica
humana, según la expresión relativa de CD16 y CD56. LinfoPRQRQXFOHDUHV GH VDQJUH SHULIpULFD IXHURQ WHxLGRV FRQ DQWLFXHUpos monoclonales anti-CD3, anti-CD14, anti-CD16, anti-CD19, y
DQWL&' FRQMXJDGRV FRQ FLQFR ÀXRURFURPRV GLIHUHQWHV 6H VHleccionó la población CD3- y CD19- (FpOXODV1. SDUDYLVXDOL]DUOD
H[SUHVLyQGH&'YHUVXV&'1: CD56EULJKW CD16-2: CD56EULJKW
CD16dim 3: CD56dim CD16- 4: CD56dim CD16+ 5: CD56- CD16+
)XHQWH3ROL$et al; Immunology5HSURGXFLGR
FRQDXWRUL]DFLyQ
OLQIRFLWRV7DFWLYDGRVVHFUHWDQWDPELpQXQDFLWRTXLQDGHODVXSHUIDPLOLD 71) GHQRPLQDGD 5$1./ Receptor Activator of N)ț%
LigandWDPELpQGHVLJQDGD&'R75$1&( TXHFRQWULEX\HD
la maduración de las CD y prolonga la sobrevida de éstas, al perPLWLUXQDLQWHUDFFLyQPiVSURORQJDGDFRQORV/7/DH[SUHVLyQGHO
SpSWLGR SRUHMHPSORYLUDO HQHOFRQWH[WRHVSDFLDOGHPROpFXODV
&0+,,SURPXHYHXQDVLJQL¿FDWLYDSUROLIHUDFLyQGH/7D\XGDGRUHV /7helper FX\RSHU¿O7K7K7KR7UHJGHSHQGHUiGH
la producción y combinación de ciertas citoquinas en el microamELHQWH FHOXODU SRU HMHPSOR ,/ ,/ ,/ ,/ 7*)ȕ H
,)1ȖHQWUHRWUDV)LJXUD (OSHU¿O7KHVLPSUHVFLQGLEOHSDUD
la defensa antiviral contra la mayoría –aunque no todas– las infecciones virales del hospedador.
Las CD también activan /7&'+ mediante la presentación de
SpSWLGRV SRUHMHPSORYLUDOHV HQHOFRQWH[WRGHPROpFXODVCMH, OR FXDO SURPXHYH OD JHQHUDFLyQ GH XQ Q~PHUR VLJQL¿FDWLYR GH
FpOXODVFLWRWy[LFDV6LELHQHVLQQHFHVDULDODVHxDOL]DFLyQDWUDYpV
GH&'ORV/7CD4+ participan de esta activación, probablemente mediante otras señales, como las mediadas por algún miembro
GHODVXSHUIDPLOLDGH71)
(Q DXVHQFLD GH LQÀDPDFLyQ XQD SHTXHxD SURSRUFLyQ GH ODV
&'WDPELpQPLJUDGHVGHORVWHMLGRVSHULIpULFRVKDFLDORVJDQJOLRV
OLQIiWLFRV UHJLRQDOHV PLJUDFLyQ EDVDO KDELpQGRVH VXJHULGR TXH
dichas células son responsables de inducir un efecto tolerogénico.
Recientemente, se han dilucidado las bases de su funcionamiento,
HOTXHHVWiPHGLDGRSRUODJDOHFWLQDFRQSURGXFFLyQGH,/
por las CD, la que –a su vez–LQGXFHODVtQWHVLVGH,/SRUlinfoFLWRV7 YpDVHHOtWHP Las CDp migran desde la circulación sanguínea atravesando
ODVYpQXODVGHOHQGRWHOLRDOWRKDFLDODViUHDV7GHORVyUJDQRVOLQIiWLFRVVHFXQGDULRVDOWHMLGROLQIiWLFRDVRFLDGRDODVPXFRVDV\D
OD]RQDPDUJLQDOHVSOpQLFD3DUDORJUDUORH[SUHVDQ/VHOHFWLQD\
CCR7, lo que les permite interactuar con los ligandos de L-selectiQDH[SUHVDGRVHQODVYpQXODVPHQFLRQDGDV\FRQELC / &&/\
6/&&&/H[SUHVDGRVSRUODVFpOXODVHVWURPDOHVGHODViUHDV7
GHSHQGLHQWHVGHORVyUJDQRVOLQIiWLFRVVHFXQGDULRV/DPDGXUDFLyQ
143
de las CDp acontece merced a la actividad autócrina del 71)Į\
del ,)1ȖSURGXFLGRVSRUHOODVPLVPDVDVtFRPRDORVQLYHOHVGH
,/SURGXFLGRVSRUHRVLQy¿ORVEDVy¿ORV\PDVWRFLWRVDQWHLQIHFciones parasitarias. La primera vía de maduración, promueve la
VtQWHVLV GH PiV ,)1Ȗ \ FRQVLJXLHQWHPHQWH OD GLIHUHQFLDFLyQ GH
/7CD4+ KDFLDHOSHU¿O7K(QFRQWUDSRVLFLyQODVtQWHVLVGH,/
SURPXHYHODSURGXFFLyQGH,/,/H,/TXHLQGXFHODGLIHrenciación de /7CD4+ KDFLDHOSHU¿O7K(VWDRSFLyQELROyJLFD\
la subsiguiente "decisión" celular tiene críticas implicancias en la
respuesta inmune antiviral.
2.1.2. Células NK. Esta población celular constituye una muy
importante barrera para limitar las infecciones virales. RepresentanGRDSUR[LPDGDPHQWHXQGHORVlinfocitos, estas células granulosas participan tanto de la respuesta innata como en la inmunorregulación de la respuesta adaptativa )LJXUD $O LJXDO
que las &' GHEHQ HMHUFHU PXFKDV YHFHV VX ODERU HQ XQ VROLWDULR
ambiente de células aún no infectadas. Sin embargo, a diferencia de
aquéllas, el mecanismo de reconocimiento es totalmente diferente.
&XHQWDQSDUDHOORFRQODH[SUHVLyQGHDOPHQRVGRVWLSRVGHUHFHSWRUHVTXHGHWHFWDQODVFpOXODVLQIHFWDGDV \WDPELpQODVWXPRUDOHV ORVUHFHSWRUHVGHDFWLYDFLyQ.$5 Killer cell Activating Receptor \
ORVUHFHSWRUHVGHLQDFWLYDFLyQ.,5 Killer cell Immunoglobulin-like
Receptor H ,/7 Immunoglobulin Like Transcript 0HGLDQWH
los receptores de activación, las NK son capaces de reconocer soEUHODVFpOXODVLQIHFWDGDVODH[SUHVLyQGHFRPSRQHQWHVYLUDOHVWDOHV
FRPRODVJOLFRSURWHtQDVDQFODGDVHQODPHPEUDQDFLWRSODVPiWLFDGH
DTXHOORVYLUXVTXHEURWDQGHVGHODFpOXODDOPHGLRH[WUDFHOXODU0HGLDQWH ORV UHFHSWRUHV .,5 H ,/7 ODV NK evitan su activación al
UHFRQRFHUVREUHODVXSHU¿FLHGHODVFpOXODVLQIHFWDGDVODH[SUHVLyQ
de moléculas CMH-I. La transducción de señales generada por la vía
GHLQDFWLYDFLyQDOUHFRQRFHUODH[SUHVLyQGHPROpFXODVGHOCMH-I
bloquea la respuesta a los receptores de activación.
Habitualmente, las infecciones virales se asocian a una dismiQXFLyQGHODH[SUHVLyQGHPROpFXODVCMH-I, lo que permite a las
células NK -al detectar la pérdida de la "señal de lo propio"- inIHULU TXH HVD FpOXOD VH FRPSRUWD H[WUDxDPHQWH (O UHVXOWDGR HV
la activación de una cascada de señales que culminan con la liberación de perforinas y JUDQ]LPDVTXHSURPRYHUiQODapoptosis
de la célula diana mediante la activación de caspasas. Asimismo,
se produce una masiva secreción de FLWRTXLQDV SULQFLSDOPHQWH
,)1Ȗ\71)Į TXHFRQWULEX\HDODOLPLWDFLyQGHODLQIHFFLyQYLral. Las 1.SXHGHQSURGXFLUHOHIHFWRFLWRWy[LFRODVHFUHFLyQGH
citoquinas o ambos mecanismos. Estas funciones se asocian a la
H[SUHVLyQIHQRWtSLFDGLIHUHQFLDOGHORVPDUFDGRUHV&' receptor
GHEDMDD¿QLGDGSDUDODSRUFLyQ)FGH,J* \&' PROpFXODGH
DGKHVLyQTXHPHGLDODDGKHUHQFLDKRPRWtSLFD ([LVWHQDOPHQRV
VXESREODFLRQHV )LJXUD >@ &'bright &'- , que constiWX\H HO GH OD SREODFLyQ &'bright >@ &'bright &'dim
TXHUHSUHVHQWDHOUHVWDQWHGHGLFKDSREODFLyQ>@&'dim
&'- >@&'dim&'bright \>@&'-&'bright . La subpoEODFLyQ &'bright &'dim promueve el efecto mediado por citoTXLQDVPLHQWUDVTXHODVXESREODFLyQ&'dim&'bright se asocia
a la FLWRWR[LFLGDGQDWXUDO\DODTXHHVGHSHQGLHQWHGHanticuerpos.
$SUR[LPDGDPHQWHXQGHODVNK circulantes en sangre periférica corresponden a estas últimas, mientras que en los ganglios
OLQIiWLFRVSUHYDOHFHODVXESREODFLyQ&'bright &'dim\DTXHH[presan el receptor CCR7 para las TXLPLRTXLQDV&&/\&&/
que promueven su atracción hacia dichos órganos.
Las células NK pueden también reconocer un tipo especial de
PROpFXODGHKLVWRFRPSDWLELOLGDGGHFODVH,ODVPROpFXODVQRFOiVLFDV+/$((VWDVPROpFXODVH[SUHVDQHQVXVXSHU¿FLHSpSWLGRVGH
las secuencias de señalización correspondientes a otras moléculas
de histocompatibilidad. Sorprendentemente, agentes como el citoPHJDORYLUXVKXPDQR +&09 DXPHQWDQODH[SUHVLyQGH+/$(
lo cual logra "engañar" a las NK que reconocen un número imporWDQWHGHPROpFXODVGHKLVWRFRPSDWLELOGDGHQODVXSHU¿FLHFHOXODU
SRUORTXHQRVHDFWLYDQ$QiORJDPHQWH+,9LQKLEHODH[SUHVLyQ
de HLA-A, HLA-B y HLA-C, pero no HLA-E, lo que contribuye a
la evasión de dicho virus a la respuesta inmune.
144
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
Por otra parte, las NK participan de la respuesta adaptativa al
UHFRQRFHUPHGLDQWHUHFHSWRUHVSDUD)FODSUHVHQFLDGH,J*HVSHFt¿FDSDUDORVDQWtJHQRVYLUDOHVUHFRQRFLGRVVREUHVXSHU¿FLHVFHOXlares. Esta interacción IgG-NK deviene en un evento de FLWRWR[LFLGDG FLWRWR[LFLGDGFHOXODUDQWLFXHUSRGHSHQGLHQWHR$'&&VHJ~Q
VXVVLJODHQLQJOpV La respuesta inmune mediada por las células NK es especialmente importante para el control de virus de la familia Herpesviridae SRUHMHPSORYDULFHOD]yVWHUKHUSHVVLPSOH[,+&09 \DTXH
se ha documentado que en su ausencia dichas infecciones siguen
un curso grave.
2.1.3. Células NKT
(VWDVFpOXODVHVWiQSUHVHQWHVHQWRGRVORVyUJDQRVOLQIRLGHVSHURVX
concentración es mayor en la médula ósea y el hígado, constituyenGR HQ pVWH ~OWLPR yUJDQR DSUR[LPDGDPHQWH HO GH ODV FpOXODV
OLQIRLGHDV YpDVHOD¿JXUD 3RVHHQORVUHFHSWRUHVGHODVNK
y de los /76HDFWLYDQPHGLDQWHODLQWHUDFFLyQGHVXUHFHSWRU7FRQ
JOLFROtSLGRV FRPR OD EHWDJOLFRVLOFHUDPLGD XQ PHWDEROLWR GH ODV
YtDV DQDEyOLFD \ FDWDEyOLFD GH JOLFRHV¿QJROtSLGRV FRPSOHMRV SUHVHQWDGRV SRU &'G XQD PROpFXOD QR SROLPyU¿FD &0+, VtPLO H[SUHVDGDSRUFpOXODVSUHVHQWDGRUDVGHDQWtJHQRFRPRODVCD, los
macrófagos y los LB de la zona marginal. Su activación promueve
señales madurativas a las CD, las NK y los linfocitos, por lo cual
participa tanto en la respuesta innata como en la adaptativa.
Una vez activadas, las NKT pueden secretar en minutos / horas
,)1Ȗ\71)Į SURPRYLHQGRODGLIHUHQFLDFLyQKDFLDODUHVSXHVta adaptativa Th1), o IL-4 e IL-13 (inductoras de la respuesta
7K /DSDUDGRMDGHHVWDHVWLUSHFHOXODUUHJXODWRULDHVTXHSXHde tanto promover como suprimir la respuesta inmune. Las 1.7
incluyen tanto subpoblaciones CD4+ como CD4- . La subpoblación
CD4+ promueve respuestas Th1 y 7KPLHQWUDVTXHODV&'- inducen principalmente respuestas Th1. La subpoblación CD8+ se
comporta como las doblemente negativas CD4- CD8- NKT, proGXFLHQGRD~QPHQRV,/TXHHVWDV~OWLPDV
Otra subpoblación de NKT exhibe el receptor para IL-25,
importante para promover la respuesta Th2 LQFOX\HQGRODDOHUJLD\ODKLSHUUHDFWLYLGDGDpUHD (VWDVXESREODFLyQFHOXODU ~QLFD
que posee tal UHFHSWRU es crítica para la producción de IL-4 e
IL-13 \HVFDVDFXDQWtDGH,)1Ȗ \KDVLGRUHFLHQWHPHQWHYLQFXODGDFRQHOGHVHQFDGHQDPLHQWRGHSURFHVRVDVPiWLFRVOXHJRGHOD
infección por YLUXVVLQFLFLDOUHVSLUDWRULR 569 )LQDOPHQWHotra
subpoblación de 1.7HVSURGXFWRUDGHODFLWRTXLQDSURLQÀDmatoria IL-17. Al igual que los /7 CD4+ productores de dicha
PROpFXOD H[KLEHQ HO IDFWRU WUDQVFULSFLRQDO 525ȖW \ HO receptor
SDUD,/
'H OR H[SXHVWR VH GHVSUHQGH TXH H[LVWHQ múltiples subpoblaciones funcionales de NKT: las mismas varían ampliamente
entre individuos, y pueden participar tanto de mecanismos de
defensa como de lesión tisular.
La mayoría de las células 1.7KXPDQDVH[SUHVDQODFDGHQD
LQYDULDQWHĮGHO7&5FRGL¿FDGDSRUORVJHQHV9Į-Į\XQQ~PHUR UHVWULQJLGR SHUR QR LQYDULDQWH GH FDGHQDV ȕ GH GLFKR 7&5
Estas 1.7LQYDULDQWHVRFOiVLFDVVHFRQRFHQFRPR1.7GHtipo
I. Las de WLSR ,, VL ELHQ VRQ WDPELpQ UHVWULQJLGDV SRU ODV &'G
H[SUHVDQXQVHWPiVDPSOLRGHFDGHQDVĮHQVX7&5\UHFRQRFHQ
DQWtJHQRVKLGURIyELFRVLQFOX\HQGRVXOIiWLGRVOLVRIRVIDWLGLOFROLQD
\ DXQ SHTXHxDV PROpFXODV DURPiWLFDV QR OLStGLFDV ([LVWHQ RWUDV
subpoblaciones de 1.7 DJUXSDGDVFRPRODVGRVDQWHULRUHVGHQWUR
de las denominadas 1.7VtPLO UHVWULQJLGDVSRUGLYHUVDVPROpFXODV&' &'D&'E&'F RSRU05 FRPRVRQODVFpOXODV
0$,7 Mucosal Associated Invariant T FX\DIXQFLyQUHFLpQFRmienza a dilucidarse.
Habiéndose descripto que diversos virus tales como HIV, herSHVVLPSOH[\++9 DJHQWHGHOVDUFRPDGH.DSRVL KDQGHVDUUROODGRHVWUDWHJLDVSDUDLQKLELUODDGHFXDGDH[SUHVLyQGH&'GHQ
ODVXSHU¿FLHGHODVFpOXODVLQIHFWDGDVVHKDLQIHULGRTXHODV1.7
podrían desempeñar un rol trascendente en la inmunidad antiviral.
6L ELHQ ORV YLUXV QR H[KLEHQ JOLFROtSLGRV HQ VX HVWUXFWXUD VH KD
demostrado que las 1.7SDUWLFLSDQHQODUHVSXHVWDLQQDWD\HQOD
regulación de la adaptativa. Las 1.7LQYDULDQWHV 1.7GHWLSR, regulan la actividad de las NK, las células mieloide-derivadas supresoras, las CDm y las CDp.
Muchos pacientes que padecen una enfermedad linfoprolifeUDWLYD OLJDGD D ; H[KLEHQmutaciones en la línea germinal de la
SURWHtQD6$3 Signaling lymphocyte activation molecule Associated Protein o SLAM Adaptor Protein) y carecen de 1.7GHWSR,
Dado que dicha molécula también regula la actividad de las NK y
de los /7FRQYHQFLRQDOHVODVXVFHSWLELOLGDGDXPHQWDGDDODLQIHFción por EBV no debe ser relacionada únicamente con el defecto
de las primeras. Otros pacientes con enfermedad linfoproliferativa
ligada a X, ostentan una PXWDFLyQHQODSURWHtQD;,$3 X-linked
Inhibitor of Apoptosis Protein) la que se asocia a una disminución selectiva del número de 1.7$QWHODLQIHFFLyQSRUEBV, se
produce también un aumento de la apoptosis de otras poblaciones
OLQIRLGHDV(QPRGRDQiORJRHQHOVtQGURPHGH:LVNRWW$OGULFK
H[LVWHXQDGH¿FLHQFLDGHODV1.7GHtipo I, asociada a la mutación
de la proteína WAS, la que afecta tanto al funcionamiento de la respuesta innata como adaptativa. Este defecto torna a los pacientes
especialmente susceptibles a las infecciones y al linfoma B asociado a EBV.
Pacientes infectados con +,9 H[KLEHQ GHQWUR GHO SULPHU DxR
después de la seroconversión, una disminución selectiva de las
1.7GHtipo I. Estas células CD4+ son especialmente sensibles a
las cepas con tropismo por el correceptor &&5\DTXHSUHVHQWDQ
XQDXPHQWRGHVXH[SUHVLyQHQODPHPEUDQDSODVPiWLFD/DGLVminución de las 1.7SDUHFHUtDSURGXFLUVHSRUXQDVREUHH[SUHVLyQ
del receptor )DVTXHODVWRUQDVXVFHSWLEOHVDODDSRSWRVLV YpDVHHO
tWHP (QODHWDSDFUyQLFDGHODinfección por HIV, el compromiso
IXQFLRQDOGHHVWDHVWLUSHFHOXODUHVWiDVRFLDGRDODVREUHH[SUHVLyQ
de la proteína pro-apoptótica 3' Programmed Death-1 Las células 1.7 MXQWRDODV1. GHVHPSHxDQXQSDSHOUHOHvante en la detección inicial de la infección por HBV por la resSXHVWDLQQDWDORFXDOSUHFHGHDODRSRUWXQD\H¿FD]VXEVLJXLHQWH
respuesta adaptativa. En pacientes con hepatitis C crónica, las células 1.7DFWLYDGDVH[KLEHQXQDXPHQWRHQODSURGXFFLyQGH,/
y cantidades equivalentes de ,)1ȖDODVSURGXFLGDVHQLQGLYLGXRV
QRUPDOHVORTXHLQGLFDVXGHVYLDFLyQKDFLDXQSHU¿OGHrespuesta
7K
2.1.4. /LQIRFLWRV7Ȗį
Su denominación tiene en cuenta que a diferencia de la mayoría de
los /7PDGXURVTXHH[KLEHQHQVXVXSHU¿FLHXQUHFHSWRU7 7&5 constituido por un heterodímero compuesto por cadenas proteicas
alfa y beta FRPSOHMRĮȕ HQHVWDVSREODFLyQ&'+HO7&5HVWi
formado por cadenas gamma y delta FRPSOHMRȖį En la sangre periférica de individuos adultos sanos, los /7Ȗį
UHSUHVHQWDQHOGHORV/7FLUFXODQWHVPLHQWUDVTXHHVWDSURporción es mucho mayor en otras localizaciones anatómicas, como
el epitelio de la piel o el intestino delgado.
$O LJXDO TXH HO7&5 Įȕ ODV FDGHQDV SURWHLFDV Ȗ \ į VRQ FRGL¿FDGDVSRUJHQHVVRPHWLGRVDUHDUUHJORVGXUDQWHODPDGXUDFLyQ
intratímica de los /7DSDUWLUGHXQFRQMXQWRGHJHQHVJHUPLQDOHV
9'-\& 6LQHPEDUJR\HQFRQWUDVWHFRQODVFpOXODV7ĮȕHO
UHSHUWRULRGHJHQHVJHUPLQDOHV9Ȗ\9įGLVSRQLEOHVHVPX\OLPLWDGR(QKXPDQRVVyORKD\JHQHV9ȖH[SUHVDGRVFLQFRGHORV
FXDOHV 9Ȗ SHUWHQHFHQDODIDPLOLD9Ȗ,PLHQWUDVTXHOD
IDPLOLD9Ȗ,,FRQWLHQHXQ~QLFRPLHPEUR9Ȗ(OQ~PHURGHJHQHV
9įGLVSRQLEOHVHVLJXDOPHQWHSHTXHxR1RREVWDQWHODGLYHUVLGDG
FRPELQDWRULDGHOUHSHUWRULRGHORV7&5ȖįHVWDQJUDQGHFRPROD
GHOUHSHUWRULRGHORV7&5Įȕ
(QODVDQJUHSHULIpULFDGHLQGLYLGXRVVDQRVH[LVWHXQPDUFDGR
predominio dentro de la población de /7ȖįGHFpOXODVTXHH[SUHVDQ9ȖMXQWRFRQ9į(QODPD\RUtDGHORVLQGLYLGXRVODVFpOXODV
9Ȗ9įUHSUHVHQWDQHOGHORV/7ȖįHQVDQJUHSHULIpULFD
En cambio, entre los /7ȖįGHOSXOPyQODSLHOHLQWHVWLQRGHOJDGRSUHGRPLQDQDTXHOODVFpOXODVTXHH[SUHVDQ9įHQFRPELQDFLyQ
FRQYDULRVHOHPHQWRV9Ȗ
145
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
Tipo
IFN
Interferón
Virus
Título
Los /7 Ȗį VRQ FpOXODV GH LQPXQRYLJLODQFLD LPSOLFDGDV HQ HO
desarrollo de respuestas innatas en enfermedades infecciosas y
tumores y en la iniciación de repuestas inmunes adaptativas,
que actúan durante la presentación antigénica, el reclutamiento y
ODDFWLYDFLyQFHOXODUHQSURFHVRVLQÀDPDWRULRV\HQODUHSDUDFLyQ
tisular.
Con respecto a la selectividad y el modo de reconocimiento
antigénico, los /79Ȗ9įSDUHFHQKDEHUHYROXFLRQDGRSDUDUHVSRQGHU D XQ FRQMXQWR ~QLFR GH PROpFXODV TXH QR GHVHQFDGHQDQ
respuesta en los /7Įȕ/RV/7ȖįQRUHFRQRFHQ RUDUDPHQWHOR
KDFHQ SpSWLGRVSURFHVDGRVSRUFpOXODVSUHVHQWDGRUDVGHDQWtJHQRV
&3$ DSDUWLUGHFRPSOHMRVSURWHLFRVDQWLJpQLFRVVLQRTXHGHWHFWDQFRPSXHVWRVDQWLJpQLFRVQRSHSWtGLFRVGHEDMRSHVRPROHFXODU
tales como metabolitos fosforilados y antígenos lipídicos.
0iVD~QQRUHTXLHUHQODSUHVHQWDFLyQGHGLFKRVOLJDQGRVSRU
moléculas del CMH de clase I o II, lo que se correlaciona con la
DXVHQFLDGHH[SUHVLyQGH&'R&'HQODPD\RUtDGHORV/7Ȗį
La activación de los /79Ȗ9įPHGLDGDSRUHO7&5UHTXLHUHGHO
reconocimiento de fosfoantígenos.
Al igual que los /7ĮȕGLFKDDFWLYDFLyQHVPRGXODGDWDPELpQ
por señales coestimulatorias. Los /79Ȗ9įH[SUHVDQIUHFXHQWHPHQWH1.*'PLHPEURGHOJUXSRGHORVUHFHSWRUHVGHFLWRWR[Lcidad natural que lleva una señal de activación luego de su unión
HVSHFt¿FD D ORV OLJDQGRV FRUUHVSRQGLHQWHV FRPR 0,&$ $% R
PLHPEURVGHODIDPLOLDGHSURWHtQDVGHXQLyQD8/ 8/%3 ([LVWHQHYLGHQFLDVTXHLQGLFDQTXHlos /7ȖįH[SUHVDQWDPELpQ
HQVXVXSHU¿FLHYDULRVWLSRVGHUHFHSWRUHVGHtipo Toll, siendo los
TLR- 1, -2 y -3ORVPiVDEXQGDQWHVORVFXDOHVSXHGHQUHFRQRFHU
el RNA viral y el RNAm endógeno liberado por células necróticas.
La activación de los /7ȖįSXHGHVHUSRWHQFLDGDGLUHFWDPHQWHSRU
ciertos ligandos de 7/5GHVHQFDGHQDQGRXQHIHFWRFRHVWLPXODWRULR
GLUHFWRFRPRXQDXPHQWRHQODH[SUHVLyQGH&'\VHFUHFLyQGH
citoquinas como ,)1Ȗ2ELHQGLFKDDFWLYDFLyQSXHGHRFXUULULQGLrectamente mediante la liberación de ,)1tipo I, como producto de la
activación de células dendríticas por ligandos de 7/5
Las respuestas inmunes desencadenadas por los /7 Ȗį
comprenden tanto acciones citotóxicas y no citotóxicas. Los /7
ȖįDFWLYDGRVGHVSOLHJDQXQDDPSOLDDFWLYLGDGFLWRWy[LFDXWLOL]DQGR
tanto mecanismos dependientes de la vía de )DV)DV/FRPRODGH
perforinas/granzimas. Por lo tanto, los /7ȖįSXHGHQOLVDUXQDDPplia variedad de células tumorales, o bien, lisar macrófagos infectados y de esta manera, limitar la propagación de microorganismos
LQIHFFLRVRV/DVDFFLRQHVQRFLWRWy[LFDVLQFOX\HQODSURGXFFLyQ\
liberación de varias moléculas solubles, como FLWRTXLQDV ,)1Ȗ
7)1Į ,/Į ,/ ,/ *0&6) HWF \ TXLPLRTXLQDV 0,3
Įȕ 5$17(6 6') 0&3 HWF (VWD UHVSXHVWD LQQDWD HV
seguida por respuestas inmunes adaptativas humorales y celulares
Anticuerpos
2
4
6
Días post-infección
Figura 7.9. Cinética de la producción de interferón ante una infección viral. &OiVLFRH[SHULPHQWRGRQGHVHREVHUYDTXHODLQIHFFLyQH[SHULPHQWDOGHUDWRQHVFRQYLUXVLQÀXHQ]DHVOLPLWDGDD~QDQtes de la detección de DQWLFXHUSRVHVSHFt¿FRV(Ointerferón sérico
FRPLHQ]DDHOHYDUVHDODVSRFDVKRUDVGHLQLFLDGDODLQIHFFLyQD~Q
DQWHVGHTXHSXHGDGHWHFWDUVHHOYLUXVLQIHFFLRVRHQORVSXOPRQHV
GHODQLPDOLQIHFWDGRFRPRUHVXOWDGRGHOUHFRQRFLPLHQWRGHSDWURQHV
PROHFXODUHVGHSDWyJHQRV(OWtWXORGHYLUXVFRPLHQ]DDGHVFHQGHU
coincidiendo con los elevados niveles de LQWHUIHUyQ
LQÀXHQFLDGDVSRUPXFKRVGHHVWRVIDFWRUHV&LWRTXLQDVSURLQÀDmatorias como ,)1ȖFRQWLQ~DQVXSULPLHQGRHOSURFHVRLQIHFFLRVR
en órganos vitales sin destruir células importantes y también pueden estimular la potencia antiviral de los /7ĮȕFLWRWy[LFRV0iV
aún, se ha demostrado que ciertos /7ȖįSURGXFHQcitoquinas como
el factor de crecimiento de queratinocitos y factor de crecimiento
GHWHMLGRFRQHFWLYR &7*) DWULEX\pQGRVHDORV/7ȖįSRUORWDQWR
una función especializada en el control de la integridad epitelial,
fribrinogénesis y reparación de heridas.
Merece destacarse la interacción continua existente entre
los /7Ȗį\ODVCD. Como fue mencionado anteriormente, las células dendríticas pueden activar mediante ,)1GHtipo I a los /7Ȗį
al mismo tiempo que éstos son capaces de sensar la presencia de
patógenos e inducir la maduración, activación funcional, migración y presentación antigénica de las dendríticas.
Receptor
Función
Célula productora
IFNAR
Actividad antiviral
0RGXODGRUGHODUHVSXHVWDLQPXQH
7RGDFpOXODQXFOHDGD
NK
NKT
CD4+ (7K
CD8+ (CTL)
&pOXODVQXFOHDGDV
DĮ
(dependiendo de
la especie)
I
ȕ
IJ
Ȧ
ț
II
Ȗ
IFNGR
0RGXODGRUGHODUHVSXHVWDLQPXQH
Actividad antiviral
III
DȜ
CRFII
Actividad antiviral
0RGXODGRUGHODUHVSXHVWDLQPXQH
Tabla 7.4. Principales características de los interferones correspondientes a los tipos I, II y III.
146
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
VIRUS
IKK
p38
JNK
NFk-B
ATF
IKK/TBK-1
IkB
IRF-3
JUN
NFk-B
JNK
JNK
+1
AP-1
ISRE
NFk-B
,)1ȕ
+1
+1
ISRE
,)1Į
IRF-3
IRF-3
ISG
Figura 7.10. Eventos tempranos de la regulación transcripcional del ,QWHUIHUyQĮȕ9pDVHHOWH[WR
Los /7ȖįDFWLYDGRVSURGXFHQJUDQGHVFDQWLGDGHVGH,)1Ȗ\
71)ĮHQUHVSXHVWDDIRVIRDQWtJHQRV71)ĮHVWLPXODODH[SUHVLyQ
GH+/$'5&'\&'HQODVXSHU¿FLHGHODVcélulas dendríticas, facilitando su maduración. Mientras tanto, el ,)1ȖWHQGUtD
un papel importante en la inducción de ,/SRUSDUWHGHODVCD,
lo cual sería responsable de la producción de ,)1ȖSRUORV/7Įȕ
0iVD~QHVWXGLRVUHFLHQWHVKDQVXJHULGRTXHORV/7ȖįFXPplirían funciones como CPA. Los /79Ȗ9įDFWLYDGRVH[SUHVDUtDQHQVXVXSHU¿FLHPROpFXODVQRUPDOPHQWHDVRFLDGDVDODV&3$
FRPR ODV SURWHtQDV FRHVWLPXODWRULDV &'&' HO OLJDQGR GH
LQWHJULQD&'\HOUHFHSWRUFRHVWLPXODWRULR&''HKHFKRVH
ha demostrado, utilizando /7CD4+ como células respondedoras,
que los /7ȖįDFWLYDGRVVRQIRUPLGDEOHVFpOXODVSURFHVDGRUDV\
SUHVHQWDGRUDV GH DQWtJHQRV VLHQGR PXFKDV YHFHV PiV HIHFWLYRV
que los /7 Įȕ \ PRQRFLWRV 0iV D~Q ORV /7 Ȗį ± &3$ VHUtDQ
comparables a las células dendríticas maduras con respecto a su
capacidad de incorporar y procesar antígenos proteicos solubles,
e inducir la proliferación de los /7 CD4+. De esta manera, los
/7ȖįFRQVWLWXLUtDQun nuevo nexo entre la inmunidad innata
y adaptativa.
Actividad antiviral de los /7ȖįLos /7ȖįGHVHPSHxDQXQD
amplia actividad antiviral contra diferentes agentes como retroYLUXV ÀDYLYLUXV SDUDPL[RYLUXV RUWRPL[RYLUXV SLFRUQDYLUXV coronavirus, rhabdovirus, arenavirus, herpesvirus, hepadnavirus, y
RUWRSR[YLUXV'LFKDDFWLYLGDGGHVHPSHxDUtDXQUROGHIHQVLYRFUXcial, especialmente considerando que por su número relativamente
JUDQGH DSUR[LPDGDPHQWHXQRGHFDGDlinfocitos de sangre periférica en adultos es un /79Ȗ9į SXHGHQUHVSRQGHUUiSLGDPHQWH
WtSLFDPHQWHQRVHUHTXLHUHSURFHVDPLHQWRDQWLJpQLFRSDUDODDFtivación irrestricta del CMH en los /79Ȗ9į \OLEHUDUIDFWRUHV
antivirales solubles.
Varios estudios sugieren una acción antiviral potente de los
/7 9Ȗ9į FRQWUD +,9 (VWD DFFLyQ SXHGH VHU HMHUFLGD PHGLDQWH PHFDQLVPRV FLWRWy[LFRV \ QR FLWRWy[LFRV FRPR OD OLEHUDFLyQ
GH ȕquimioquinas inhibitorias del +,9 &&/ >0,3Į@ &&/
>0,3ȕ@ \ &&/ >5$17([email protected] TXH EORTXHDQ ORV FRUUHFHSWRUHV
&&5/DH¿FDFLDGHODLQKLELFLyQYLUDOHVFRPSDUDEOHFRQODGH
los /7&'+.
Se ha descripto en la sangre periférica y mucosas de individuos infectados con +,9XQDH[SDQVLyQGHORV/79įDH[SHQsas de un descenso en los niveles de los /79Ȗ9į(VWRVLQFUHmentos de los /79įUHVSRQGHUtDQDXQDDFWLYDFLyQFUyQLFDGH
dichas células o a un efecto inducido por cambios en los niveles
de citoquinas que ocurren durante la progresión de la infección
YLUDO0iVD~QODVXESREODFLyQGH/79įHVFDSD]GHOLVDU/7
CD4+ no infectados, lo cual indicaría que este incremento contribuye directamente a la imnunopatogénesis asociada al HIV. Cabe
destacar que la pérdida de los /79Ȗ9įWDPELpQVHUtDXQIDFWRU
contribuyente en el establecimiento de la persistencia viral en la
etapa SIDA mediante una reducción de los niveles de citoquinas
de WLSR,$GHPiVODSURWHtQD7DWFRGL¿FDGDSRUHOJHQRPDGHO
HIV interferiría con la homeostasis de los /7ȖįDOFRPSHWLUFRQ
las TXLPLRTXLQDV SRU OD XQLyQ D UHFHSWRUHV &;&5 \ CXCR4
H[SUHVDGRVSRUORV/7Ȗį
/DH[SDQVLyQ\DFWLYDFLyQGHODVVXESREODFLRQHVGHORV/7ȖįKD
sido observada en pacientes infectados con HCV. En estos casos,
los /7 Ȗį KHSiWLFRV H[KLEHQ QLYHOHV HOHYDGRV GH DFWLYLGDG FLWRWy[LFDFRQWUDGLIHUHQWHVEODQFRV LQFOXVLYHKHSDWRFLWRVSULPDULRV Asimismo, los /7ȖįVHFUHWDQ7)1Į,/H,)1Ȗ(VWD~OWLPDHV
una citoquina clave en el reclutamiento y activación de /7 FLWRWy[LFRVcélulas NK y macrófagos, y de mecanismos intracelulares
TXHVXSULPHQODUHSOLFDFLyQYLUDOVLQHMHUFHUXQGDxRGLUHFWRVREUH
la célula infectada. Durante la infección crónica, los /79įOLEHrarían citoquinas 7KFRQWULEX\HQGRDORVSURFHVRVGHLQÀDPDFLyQ
\QHFURVLVKHSiWLFD(QFRPSDUDFLyQFRQRWURVSDFLHQWHVORVLQGLviduos coinfectados con HIV y HCV muestran un número aumentado de /79įSHULIpULFRVHLQWUDKHSiWLFRVORFXDOH[SOLFDUtDHO
PD\RUJUDGRGHLQÀDPDFLyQKHSiWLFDTXHVHREVHUYDHQpVWRV(Q
FRQMXQWRHVWRVUHVXOWDGRVVXJHULUtDQTXHORV/79įGHVHPSHxDrían un papel en la SDWRJHQLDKHSiWLFDDVRFLDGDDOHCV. En cambio,
±\HQIRUPDDQiORJDDORTXHDFRQWHFHFRQHIV– se ha observado
una disminución de los /79Ȗ9įORTXHFRQWULEX\HDOGHVDUUROOR
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
147
,)1Įȕ
Virus
JAK-1
TYK-2
IRF-5
,..7%.
IRF-7
IRF-7
IRF-3
IRF-9
ISGF3
STAT-2
SAT-1
IRF-7 IRF-7
+1
+1
ISRE
IRF-7
IRF-7 IRF-3
IRF
IRF
,)1Į
Figura 7.11. Eventos tardíos de la regulación transcripcional del ,QWHUIHUyQĮȕ9pDVHHOWH[WR
tuyen una familia de proteínas que ha sido subdividida en tipo I
FRPSUHQGHORV,)1Į\ȕ WLSR,,RLQPXQH ,)1Ȗ \XQDQXHYD
familia de ,)1 ,)1Ȝ /RV,)1GHtipo I abarcan una variedad de
genes de WLSRĮ ±VHJ~QODHVSHFLH XQ~QLFRJHQGHtipo
2.2. FACTORES SOLUBLES QUE PARTICIPAN EN LA INMUNIDAD INNATA
ȕ \ ORV PHQRV HVWXGLDGRV ,)1ț NDSSD IJ WDX \ Ȧ RPHJD Los ,)1ȜKDQVLGRUHFRQRFLGRVUHFLHQWHPHQWH\FRPSUHQGHQODV
2.2.1. Interferones
(OHVWXGLRGHORVÀXtGRVGHcultivos celulares infectados con virus LQLFLDOPHQWHGHQRPLQDGDVLQWHUOHXTXLQDV\(QHVWHFDStWXOR
SHUPLWLyD,VDDFV\/LQGHQPDQQGHPRVWUDUHQODSUHVHQFLDGH VyORVHGHVDUUROODUiQDTXHOORVDVSHFWRVVDOLHQWHVYLQFXODGRVFRQORV
"una proteína" que protegía contra una amplia variedad de virus y ,)1ĮȕȖ\Ȧ
6HGHVFULELUiQDFRQWLQXDFLyQORVPHFDQLVPRVGHUHJXODFLyQGH
que fue entonces designada con el nombre de Interferón.
Hoy se sabe que los ,)1VRQSpSWLGRVTXHSURPXHYHQODDFWLYL- la producción de interferones, las células que los producen y el rol
dad antiviral en células tratadas con los mismos. Los efectos antivi- que aquellos cumplen en las infecciones virales
Esta familia de citoquinas comprende a los ,)1GHWLSR, Įȕ
rales de los ,)1VRQLQHVSHFt¿FRVFRQUHVSHFWRDODJHQWHLQGXFWRU
ya que activan las células sobre las que actúan, contra todos los IJȦ\ț GHWLSR,, Ȗ \ORVGHWLSR,,, Ȝ 7DEOD 0LHQWUDV
virus. La inducción de esta activación es genéticamente restringi- que los ,)1GHWLSR,HMHUFHQVXVHIHFWRVELROyJLFRVDWUDYpVGHXQ
da: a diferencia de las interleuquinas, los ,)1VRODPHQWHSXHGHQVHU UHFHSWRUFRP~Q ,)1$5 ORVGHOVHJXQGRtipo lo hacen a través
activos en limitado grado sobre células de una especie diferente a GHXQRHVSHFt¿FR ,)1*5 /DQXHYDIDPLOLDGH,)1ȜHVWiFRPSXHVWDSRUPLHPEURV,)1Ȝ R,/ ,)1Ȝ R,/$% la de las que originaron su síntesis.
Los ,)1FRQVWLWX\HQHOSULPHUPHFDQLVPRGHIHQVLYRFRQWUDOD Estos ,)1DFW~DQDWUDYpVGHXQUHFHSWRUKHWHURGLPpULFR &5),,
infección viral que opera en el hospedador. Su acción comienza al Class II cytokine Receptor Family TXHFRPSUHQGHODFDGHQDĮGHO
cabo de pocas horas de iniciada la infección. Los ,)1SDUWLFLSDQ UHFHSWRUSDUD,/ ,/5Į ±ODFXDOHVHVSHFt¿FDSDUDHVWHtipo
VLJQL¿FDWLYDPHQWH HQ OD OLPLWDFLyQ GH ODV LQIHFFLRQHV YLUDOHV OR de ,)1\ODFDGHQDȕGHOUHFHSWRUSDUD,/ ,/5ȕ cual contribuye a la ocurrencia de un gran número de infecciones
Interferones de tipo I. Inducción del ,)1Įȕ
subclínicas.
&OiVLFRVHVWXGLRVH[SHULPHQWDOHVUHDOL]DGRVHQUDWRQHVHQORV Los ,)1Į\ȕVRQORVSULPHURVHQSURGXFLUVHDQWHXQDLQIHFFLyQ
DxRVGHOVLJOR;;GHPRVWUDURQTXHORVWtWXORVPi[LPRVGHYL- YLUDO /D DFWLYDFLyQ GH OD H[SUHVLyQ GH ,)1Į ȕ SXHGH RFXUULU
UXVLQÀXHQ]DDOFDQ]DGRVHQHOSXOPyQGHFUHFtDQDQWHHODXPHQWR como consecuencia de la detección celular de:
a. determinantes virales presentes en el virión que interactúan con
del título de interferón en una infección primaria, aun antes que
UHFHSWRUHVH[WUDFHOXODUHVRGHOFRPSDUWLPLHQWRHQGRVyPLFR
se detectara la síntesis de DQWLFXHUSRV QHXWUDOL]DQWHV HVSHFt¿FRV
b. factores virales liberados al citoplasma luego de la infección o
contra la hemaglutinina de envoltura. Es decir, en este caso la eliproducidos en alguna etapa del ciclo de replicación viral, que
minación viral ocurría antes de transcurrida una semana, previo al
VHXQHQDUHFHSWRUHVLQWUDFHOXODUHV\
PRPHQWRGHODVHURFRQYHUVLyQ )LJXUD c. factores virales transportados / liberados desde el citoplasma
Durante las infecciones virales, los IFN participan en nuTXHLQWHUDFFLRQDQFRQUHFHSWRUHVH[WUDFHOXODUHV
merosas interacciones inmunes como inductores, reguladores y
Como se puede observar en los casos "b" y "c" es necesario
efectores, ya sea de mecanismos antivirales correspondientes a
que la célula se infecte para que se produzca la inducción de la
la respuesta innata como a la adaptativa )LJXUD%
7HQLHQGR HQ FXHQWD OD QDWXUDOH]D GH ORV UHFHSWRUHV TXH ORV síntesis de ,)1ĮȕPLHQWUDVTXHHQHOSULPHUFDVRHVWHHYHQWRHV
reconocen así como su homología aminoacídica, los ,)1 FRQVWL- LQQHFHVDULR(QHVWH~OWLPRHMHPSORIDFWRUHVYLUDOHVH[WUDFHOXODUHV
de una respuesta inmune celular debilitada y a la naturaleza persistente de la infección por HCV.
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
148
LT CD4+
NK y LT
,/,)1Įȕ
IL-21, IL-23,
IL-27
IL-18
IL-12
LT CD8+
CMH-II
CMH-I
TCR
NFkB
STATs
STAT-4
T-bet
TCR
NFAT
NFAT
T-bet
IFN-γ
Figura 7.12. Inducción de ,QWHUIHUyQȖ9pDVHHOWH[WR
,)1Ȗ
,)1Įȕ
IFNAR
,)1Ȝ
IFNGR
JAK-1
TYK-2
CRFII
JAK-2
JAK-1
JAK-2
JAK-1
TYK-2
STAT-1
STAT-2
STAT-1
STAT-3
STAT-2
STAT-4
STAT-1
STAT-5
STAT-3
STAT-4
STAT-5
IRF-9
IRF-9
STAT-2
STAT-1
STAT-1
MAPKs
STAT-1
ISGF-3
GAF
+1
ISRE
ISG
+1
GAS
ISG
Figura 7.13. Vías de señalización de los interferones tipo I, II, y III. 9pDVHHOWH[WR
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
ISG
Mx
¶¶2$651$VD/
PKR
Función
*73DVDLQKLEHODUHSOLFDFLyQGHFLHUWRVYLUXVFRQJHQRPDD51$
(Q]LPDV
D ¶¶2$6HVWLPXODD51$VD/
E 51$VD/GHJUDGD51$VYLUDOHV\FHOXODUHV
6HULQDWUHRQLQDSURWHtQDTXLQDVD
D IRVIRULODH,)ĮHLPSLGHODWUDGXFFLyQGH51$PYLUDOHV\FHOXODUHV
E SURPXHYHODDSRSWRVLV
ISG 15
8ELTXLWLQDVtPLO3HUPLWHODGHJUDGDFLyQGHODVSURWHtQDVSRUHOSURWHDVRPD
ISG 20
¶¶H[RQXFOHDVDGHJUDGDHVSHFt¿FDPHQWH51$VF
P56
ADAR
PML
*%3
149
8QHDODVXEXQLGDGHGHOH,)LPSLGLHQGRODWUDGXFFLyQGHORV51$PYLUDOHV
(Q]LPDPRGL¿FDGRUDGH51$GFFDWDOL]DODGHVDPLQDFLyQGHODVDGHQLQDVDLQRVLQDV
GHVHVWDELOL]DQGRODHVWUXFWXUDVHFXQGDULDGHORNAdc
0LHPEURGHODIDPLOLDSURWHLFD75,0
a) interviene en la apoptosis
E LQKLEHODWUDQVFULSFLyQ
F SDUWLFLSDHQORVHYHQWRVFHOXODUHVSURGXFLGRVFRPRUHVSXHVWDDO'1$GDxDGR
*73DVD
D LQKLEHODUHSOLFDFLyQGHYLUXVFRQJHQRPD51$
E HVSUHGRPLQDQWHPHQWHLQGXFLGDSRU,1)Ȗ
Tabla 7.5. Diversos genes inducidos por interferón. ISGs: (Interferon Stimulated Genes JHQHVHVWLPXODGRVSRULQWHUIHUyQ¶¶2$6
¶¶ROLJRDGHQLODWR VLQWHWDVD PKR: SURWHtQDTXLQDVD GHSHQGLHQWH GH 51$ ADAR (RNA sSHFL¿F Adenosine Deaminase. DGHQRVLQD
GHVDPLQDVDHVSHFt¿FDGH51$PML (Promyelocytic Leukemia protein SURWHtQDGHOHXFHPLDSURPLHORFtWLFDGBP-1 (Guanylate-Binding
PURWHLQ SURWHtQDGHXQLyQDJXDQLODWRH,)ĮIDFWRUHXFDULyWLFRGHLQLFLDFLyQGHODWUDGXFFLyQĮeIF3:IDFWRUHXFDULyWLFRGHLQLFLDFLyQ
GHODWUDGXFFLyQRNAsc:51$GHVLPSOHFDGHQDRNAdc:51$GHGREOHFDGHQD
pueden activar la síntesis de ,)1ĮȕDOLQWHUDFWXDUFRQUHFHSWRUHV
H[WUDFHOXODUHV553TXHUHFRQRFHQFLHUWRV3$03HQODVPROpFXODV
virales.
Regulación transcripcional del ,)1Įȕ
/DUHJXODFLyQGHODWUDQVFULSFLyQGHORVJHQHVTXHFRGL¿FDQSDUD
los ,)1Į \ ȕ SXHGH GLYLGLUVH WHPSRUDOPHQWH HQ GRV SDUWHV ODV
correspondientes a eventos tempranos y a tardíos.
Eventos tempranos. En los eventos tempranos la regulación
transcripcional de los ,)1ĮȕVHSURGXFHDWUDYpVGHGLYHUVDV
vías de transducción de señales, las cuales no requieren síntesis
proteica de novo. En todas estas vías el último paso es la activación
de un factor de transcripción que se transloca del citoplasma al núFOHR\DFWLYDODWUDQVFULSFLyQGHGLYHUVRVJHQHV/DVYtDVKDVWDHO
SUHVHQWHPHMRUHVWXGLDGDVVRQODVVLJXLHQWHV )LJXUD a. /DV SURWHtQDTXLQDVDV DFWLYDGDV SRU HO HVWUpV 6$3.V FRPR
-1. c-JUN N-terminal Kinase \0$3.SVRQUHFOXWDGDV
para activar por fosforilación los factores de transcripción JUN
\$7)UHVSHFWLYDPHQWHHOORUHVXOWDHQODIRUPDFLyQGHOIDFWRUGHWUDQVFULSFLyQ$3 Activated Protein-1 TXHVHWUDQVORca al núcleo y activa la transcripción de los genes de ,)1Įȕ
b. (OFRPSOHMRKHWHURGLPpULFR,.. Įȕ\Ȗ DODFWLYDUVHIRVIRULODD,N%ODFXDOOLEHUD\GHMDDFWLYRD1)N%8QDYH]DFWLYD
1)N% VH WUDQVORFD DO Q~FOHR \ DFWLYD OD WUDQVFULSFLyQ GH ORV
genes de ,)1Įȕ
c. /DHVWLPXODFLyQGHOFRPSOHMR,..İ7%. TANK- Binding
Kinase 1 SURGXFHODIRVIRULODFLyQSRUSDUWHGHpVWHGHOIDFWRU
SUHH[LVWHQWH,5) IFN Regulatory Factor-3 HOFXDODODFWLvarse se transloca al núcleo y activa la transcripción de difeUHQWHVJHQHV,6* IFN Stimulated Genes 15, 54 y 56 ,3
,)1ȖInducible Protein-10 L126 Inducible Nitric Oxide
Synthase \&&/ 5$17(6 Eventos tardíos. Los eventos tardíos de regulación de la transcripción de los genes de ,)1Į \ ȕ VRQ DFWLYDGRV SRU OD DFFLyQ
FRQMXQWDGHGHWHUPLQDQWHVYLUDOHV\GHORVPLVPRV,)1Į\ȕHQ
XQSURFHVRGHUHWURDOLPHQWDFLyQSRVLWLYD feed-backSRVLWLYR 8QD
vez secretados estos ,)1VHXQHQDVXUHFHSWRU,)1$5\HVWLPXODQ OD WUDQVFULSFLyQ GH ,5) D WUDYpV GHO IDFWRU GH WUDQVFULSFLyQ
,6*)8QDYH]HQHOFLWRSODVPD,5)MXQWRFRQ,5)VRQIRVIRULODGRVSRUHOFRPSOHMRGHTXLQDVDVDFWLYDGDVSRUYLUXV,..İ
7%.(OKHWHURGtPHUR,5),5)DODFWLYDUVHPLJUDDOQ~FOHR
donde induce la transcripción de diversos genes, entre ellos ,)1Į
ȕ )LJXUD Interferones de tipo II. Inducción del ,)1Ȗ
El ,)1ȖHVXQDFLWRTXLQDTXHQRHVWiLQGXFLGDGLUHFWDPHQWHSRU
los agentes microbianos, sino que se encuentra dentro del segundo
grupo de moléculas que son inducidas en respuesta a la estimulación de un receptor por una CPA o por citoquinas que se secretaron
previamente durante la infección.
Diversas citoquinas han sido implicadas en la inducción de la
H[SUHVLyQ GH ,)1Ȗ HQWUH HOODV VH HQFXHQWUDQ ODV VLJXLHQWHV ,/
,/ ,/ ,/ ,/ ,/ ,/ ,/ ,)1 Į ȕ \
71)Į'HQWURGHHVWDVcitoquinas, el inductor primario de ,)1Ȗ
es la ,/HVWDLQWHUOHXTXLQDVRODHVVX¿FLHQWHSDUDLQGXFLULPSRUtantes cantidades de ,)1ȖHQFpOXODV7\1.QRREVWDQWHWDPELpQ
actúa de manera sinérgica con otras FLWRTXLQDVFRPR,/71)Į
\HQSDUWLFXODUFRQ,/$VXYH]HQODVFpOXODV7ODDFFLyQFRQMXQWDGH,/H,/SXHGHHVWLPXODUODSURGXFFLyQGH,)1ȖVLQ
la necesidad de estimulación antigénica.
Cabe mencionar que los ,)1Į\ȕSXHGHQWDQWRLQGXFLUFRPR
LQKLELUODH[SUHVLyQGH,)1ȖGHSHQGLHQGRGHOFRQWH[WRHQHOFXDO
actúen. En este sentido, se observó que los ,)1ĮȕSXHGHQLQKLELU
ODH[SUHVLyQGH,/\SURGXFLUGLVPLQXFLyQHQODH[SUHVLyQGH
,)1ȖPHGLDGDSRU67$7 Signal Transducer and Activator of
Transcription GHPDQHUDWUDQVLWRULDSRURWUDSDUWHHVWRVPLVPRV
,)1DFW~DQHVWLPXODQGRODH[SUHVLyQGH,)1ȖDFWLYDQGR67$7
El tipo de efecto que producen los ,)1Į ȕ VREUH OD H[SUHVLyQ
de ,)1Ȗ SDUHFH HVWDU LQÀXHQFLDGR SRU HO QLYHO GH H[SUHVLyQ GH
67$7\DTXHVHREVHUYyTXHDOWRVQLYHOHVGHHVWHIDFWRUGHWUDQVcripción favorecen la regulación negativa, mientras que niveles
PHQRUHVSURGXFLUiQXQDUHJXODFLyQSRVLWLYD
150
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
Como en las infecciones virales en las cuales se producen grandes cantidades ,)1ĮȕQRVHLQGXFH,/GHELGRDODUHJXODFLyQQHJDWLYDHMHUFLGDSRUGLFKRV,)1ODLQGXFFLyQGH,)1ȖVHYH
estimulada directamente por ,)1Įȕ
$GHPiV GH OD HVWLPXODFLyQ GH OD H[SUHVLyQ GH ,)1Ȗ SRU OD
unión de las citoquinas a su UHFHSWRUODVFpOXODV7\ODVNK pueGHQH[SUHVDUHVWHtipo de ,)1SRUHVWLPXODFLyQGHRWURVWLSRVGH
UHFHSWRUHVFHOXODUHVFRPRHVHOFDVRGHO7&56LELHQODVYtDVGH
HVWLPXODFLyQ PHGLDGDV SRU HO 7&5 VRQ GLIHUHQWHV pVWDV SXHGHQ
actuar de manera sinérgica con las vías inducidas por citoquinas
)LJXUD Regulación transcripcional del ,)1±Ȗ
/DH[SUHVLyQGH,)1ȖHVWiUHJXODGDDQLYHOWUDQVFULSFLRQDO\SRVW
WUDQVFULSFLRQDO(OFRQWUROWUDQVFULSFLRQDOGHODH[SUHVLyQGHHVWD
citoquina esta dado por la acción de diferentes factores de transFULSFLyQ HQWUH HOORV 1)N% 1)$7 Nuclear Factor Activating
Transcription 67$77EHW$3&5(%$7)*$7$\\LQJ
\DQJ )LJXUD ([LVWH XQ UHTXHULPLHQWR GLIHUHQFLDO GH ORV
diversos factores de transcripción mencionados, dependiendo del
tipo celular y de la vía de señalización inducida, pero en general
WRGRVDFW~DQFRPRUHJXODGRUHVSRVLWLYRVGHODH[SUHVLyQGH,)1Ȗ
LQGXFLHQGRVXH[SUHVLyQ
Fracción
Actividad
&T
2SVRQL]DFLyQSDUDIDFLOLWDUODIDJRFLWRVLV
HOLPLQDFLyQGHORVFXHUSRVDSRSWyWLFRV
procesamiento y eliminación de los
LQPXQRFRPSOHMRV
C3a
0HGLDGRUSHSWtGLFRGHODLQÀDPDFLyQ
SURPXHYHODFRQWUDFFLyQGHOP~VFXOROLVR
HODXPHQWRGHODSHUPHDELOLGDGYDVFXODU
ODGHJUDQXODFLyQGHHRVLQy¿ORVEDVy¿ORV
\FpOXODVFHEDGDV
ODOLEHUDFLyQGHKLVWDPLQD
\ODDJUDJDFLyQSODTXHWDULD
C3b
2SVRQL]DFLyQGHSDUWtFXODVSDUDIDFLOLWDUOD
IDJRFLWRVLV
VROXELOL]DFLyQGHLQPXQRFRPSOHMRV
C3c
/LEHUDFLyQGHQHXWUy¿ORVGHVGHODPpGXOD
yVHD
OLVLVGHOHXFRFLWRV
C3dg
$G\XYDQWHPROHFXODU
UHJXODFLyQGHODUHVSXHVWDDGDSWDWLYD
C4a
3URPXHYHODFRQWUDFFLyQGHOP~VFXOROLVR
\HODXPHQWRGHODSHUPHDELOLGDGYDVFXODU
C4b
2SVRQL]DFLyQSDUDIDFLOLWDUODIDJRFLWRVLV
procesamiento y eliminación de los
LQPXQRFRPSOHMRV
C5a
0HGLDGRUSHSWtGLFRGHODLQÀDPDFLyQ
SURPXHYHODFRQWUDFFLyQGHOP~VFXOROLVR
HODXPHQWRGHODSHUPHDELOLGDGYDVFXODU
ODGHJUDQXODFLyQGHHRVLQy¿ORVEDVy¿ORV
QHXWUy¿ORVPRQRFLWRV\FpOXODVFHEDGDV
\ODOLEHUDFLyQGHHQ]LPDVKLGUROtWLFDVGHORV
QHXWUy¿ORV
C5b, C6,
&RPSOHMROtWLFRGHDWDTXHDPHPEUDQDV
C7, C8, C9 FHOXODUHVRYLUDOHV
%E
,QKLELGRUGHODPLJUDFLyQFHOXODUH
LQGXFWRUGHODGLVHPLQDFLyQGHPRQRFLWRV\
macrófagos
Tabla 7.6. Funciones biológicas de las diferentes fracciones del
sistema Complemento.
$GHPiVGHODUHJXODFLyQWUDQVFULSFLRQDO±DQWHVPHQFLRQDGD±
OD H[SUHVLyQ GH ,)1Ȗ HVWi UHJXODGD SRU PHFDQLVPRV SRVWWUDQVcripcionales. Recientemente, se documentó que el RNAm de ,)1Ȗ
humano puede controlar su propio nivel de traducción. En este sentido, se observó que la formación de una estructura tridimensional
HQHVWHPHQVDMHURPHGLDODDFWLYDFLyQGHODPKR, la cual a su vez
inhibe la síntesis de proteínas.
IFN de tipo III. Inducción de ,)1Ȝ
Hasta la actualidad, no se ha podido dilucidar los mecanismos
H[DFWRVTXHJRELHUQDQODH[SUHVLyQGH,)1Ȝ1RREVWDQWHVHKD
demostrado que al igual que los ,)1ĮȕODH[SUHVLyQGHO,)1Ȝ
es inducida por factores virales, siendo las primeras citoquinas en
sintetizarse ante una infección viral. Estos inductores virales pueden ser intracelulares como en el caso de ,)1ĮȕFRPRFRQVHFXHQFLD GH OD UHSOLFDFLyQ YLUDO R H[WUDFHOXODUHV (VWRV ~OWLPRV
pueden activar la síntesis del ,)1Ȝ DO LQWHUDFWXDU FRQ ORV UHFHStores RRP que reconocen diferentes PAMP. Del mismo modo que
ocurre con los ,)1ĮȕORV7/5\SXHGHQLQGXFLU
ODH[SUHVLyQGH,)1Ȝ
El ,)1ȜIXHGHWHFWDGRKDVWDHOPRPHQWRHQODVPLVPDVFpOXODV
HQODVTXHVHGHWHFWDODH[SUHVLyQGH,)1Įȕ&3$&'S&'P
y diversas células nucleadas.
Cascadas de transducción de señales activadas
por los interferones de tipo I, II y III
Luego de la unión a su UHFHSWRUHVSHFt¿FRORVGLVWLQWRVWLSRVGH
,)1HVWLPXODQODWUDQVFULSFLyQGHGLIHUHQWHVJHQHV ,6* SDUDOOHvar a cabo las diversas funciones biológicas asociadas a estas citoTXLQDV )LJXUD Luego de la interacción ,)1receptor se activa la cascada de
transducción de señales de las proteína-quinasas denominadas
-$.V6$7V$ODFWLYDUVHVHGLULJHQDOQ~FOHRSDUDXQLUVHDUHJLRQHV
UHJXODWRULDVGHORVJHQHV,6*GHQRPLQDGDV,65( IFN-Stimulated
Response Element SDUDDTXHOORVJHQHVTXHUHVSRQGHQDORV,)1
de WLSR,R*$6 IFN-Gamma Activated Sequence SDUDDTXHOORV
que responden a los de tipo II. El ,)1ȜWDPELpQHVWLPXODODVUHJLRnes regulatorias ISRE y GAS a través de la vía de transducción de
VHxDOHVGHODV-$.67$7
Los ,)1GHtipo I –principalmente ,)1ĮȕVHXQHQDVXVUHFHSWRUHVHVSHFt¿FRV,)1$5WUDVORFXDOVHDFWLYDQODVWLURVLQD
TXLQDVDV7<.\-$.SRUIRVIRULODFLyQODVTXHDVXYH]IRVIRULODQ
D,)1$5\UHFOXWDQD67$7SDUDTXHVHXQDDOUHFHSWRU67$7HV
IRVIRULODGRIDFLOLWDQGRVXLQWHUDFFLyQFRQ67$7±DWUDYpVGHVXGRPLQLR6+±\ODFRQVLJXLHQWHDFWLYDFLyQGHHVWH~OWLPRIDFWRU(OKHWHURGtPHURDFWLYR67$767$7GHMDHOVLWLRGHOreceptor para unirse
D,5)\IRUPDUHOFRPSOHMR,6*)(VWHFRPSOHMRPLJUDDOQ~FOHR
y actúa como factor de transcripción al unirse a la región regulatoria
genómica ISRE estimulando la transcripción de los genes ISG.
'HPDQHUDDQiORJDDOXQLUVHHO,)1ȖDVXUHFHSWRU ,)1*5
,)1*5 SHUPLWHODDFWLYDFLyQGHODVWLURVLQDTXLQDVDV-$.\
-$.8QDYH]DFWLYDVODV-$.IRVIRULODQDOreceptor, el que -a
VXYH]UHFOXWD\DFWLYDD67$767$7IRUPDKRPRGtPHURVDFWLYRVGHQRPLQDGRV*$)pVWRVPLJUDQDOQ~FOHRSDUDXQLUVHDOD
secuencia genómica regulatoria GAS y promover la transcripción
de los genes ISG.
Luego de la interacción de ,)1ȜFRQVXUHFHSWRUHVSHFt¿FRVH
induce una cascada de transducción de señales que culmina con la
IRUPDFLyQGHORVFRPSOHMRV,6*)\*$6DVtFRPRODDFWLYDFLyQ
GH GLIHUHQWHV 67$7 67$7 \ /RV IDFWRUHV GH WUDQVcripción antes mencionados se unen a las secuencias regulatorias
ISRE y GAS, las cuales regulan la transcripción de los genes ISG.
Estudios recientes implican al ,)1ȜHQODDFWLYDFLyQGHODV0$3.
Mitogen-Activated Protein Kinase SRUXQDYtDLQGHSHQGLHQWHGH
ODV67$7
Genes estimulados por interferones de tipo I, II y III
Los ,)1HVWLPXODQPiVGHJHQHV GHQRPLQDGRVJOREDOPHQWH
,6* VHJ~Q VX DEUHYLDWXUD HQ LQJOpV ORV FXDOHV WLHQHQ IXQFLR-
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
151
Diversos genes inducidos por Interferón
(ISGs)
p56
PKR
2´5´
OA
S
Mx
ADAR
ISG20
Síntesis de novo
de Mx
RNAdc
2´5´
OA
S
IPK
PKR
Activación de 2´5´ OAS
Interfiere en el
transporte de las
nucleocápsides
durante el ciclo de
replicación viral
Activación de PKR
Secuestro de la subunidad 3e
RLI
elF3
RNAsaL
elF3 activo
elF2α
elF3
Inactivación de elF3
Activación de RNAsaL elF2α activo
3´5´ exonucleasa
Edición de RNAdc
Degradación de
los RNAsc
Inestabilidad de
los RNAdc
elF2α
Fosforilación e inhibición
de elF2α
Degradación de
los RNAs
Inhibición de la traducción
de los RNAm
Figura 7.14. Genes inducidos por Interferón y efectos producidos por la expresión de los mismos. 9pDVHHOWH[WR
A
Apoptosis
C3a
C5b
C3b
fB
C1q
Bb
C3b
FcRȖ
II
C3
fD
C5a
FcRȖ
III
C3a
B
C3b
fB
C3
fD
Bb
C3b
C3b
D
A
F
I
Bb
C3b
MCP
(CD46)
I
C3b i
C3d
Figura 7.15. Interacciones entre componentes del sistema Complemento y las células presentadoras de antígenos. Los macrófagos
y las FpOXODVGHQGUtWLFDV &' LQPDGXUDVHODERUDQWRGRVORVFRPSRQHQWHVGHODYtDFOiVLFD\DOWHUQDWLYDGHDFWLYDFLyQGHOVLVWHPD$GHPiV
GLFKDVFpOXODVH[SUHVDQUHFHSWRUHVSDUD&T&EL&E&D&D\SDUDODIUDFFLyQ)FGHODV,JVA.&THVIXQGDPHQWDOSDUDHOUHFRQRFLPLHQWR\HOLPLQDFLyQGHODVFpOXODVDSRSWyWLFDVSRUSDUWHGHORVPDFUyIDJRV\&'/DSURGXFFLyQGH&E)DFWRU%\IDFWRU'SURPXHYHHO
GHSyVLWRGH&E%EVREUHODVXSHU¿FLHFHOXODUORFXDOSXHGHFOLYDUPiV&ESDUDIRUPDU&E%E&EOD&FRQYHUWDVDGHODYtDDOWHUQDWLYD
(VWDSURWHDVDXRWUDVVHULQDSURWHDVDVVLQWHWL]DGDVSRUORVPDFUyIDJRVSXHGHQFOLYDU&SURGXFLHQGR&D\&E([LVWHXQFLUFXLWRGHUHtroalimentación entre C5a y el FcR (UHFHSWRUSDUD)F SRUHOFXDOODVtQWHVLVGH&\VXFOLYDMHHVWiQDXPHQWDGRVSRUORVDQWLFXHUSRVXQLGRV
D)FȖ5,,,$VXYH]ODXQLyQGH&DDORVUHFHSWRUHVH[SUHVDGRVVREUHODVXSHU¿FLHGHORVPDFUyIDJRVDXPHQWDODH[SUHVLyQGH)FȖ5,,,H
LQKLEHODGHOUHFHSWRULQKLELWRULR)FȖ5,,%B./DVSURWHtQDVUHJXODWRULDVGHOVLVWHPDcomplemento depositadas sobre la membrana plasmática de macrófagos y &'PRGXODQODLQWHUDFFLyQFRQORVlinfocitos T (LT) y los OLQIRFLWRV% /% (OIDFWRUDFHOHUDGRUGHOGHFDLPLHQWR GHQRminado DAF o CD55) de la actividad del FRPSOHPHQWRHVXQDPROpFXODGHJOLFRVLOIRVIDWLGLOLQRVLWRODQFODGDHQODPHPEUDQDTXHSURPXHYH
XQDPiVUiSLGDGLVRFLDFLyQGH%EGHOFRPSOHMR&E%E(OORUHVWULQJHODFDQWLGDGGH&EXQLGDDODVXSHU¿FLHGHODVFpOXODVSUHVHQWDGRUDV
GHDQWtJHQRV(OFRIDFWRUSURWHLFRGHPHPEUDQD HQLQJOpV0&3 WDPELpQGHQRPLQDGR&'HVXQDJOLFRSURWHtQDTXHUHJXODODDFWLYLGDG
del FRPSOHPHQWRDFWXDQGRFRPRFRIDFWRUGH,SDUDFOLYDU&ESURGXFLHQGRODSURWHtQDHQ]LPiWLFDPHQWHLQDFWLYD&EL\OXHJR&G'$)
y MCP están también expresadas en los /7PRGXODQGRVXUHVSXHVWD&RPRFRQVHFXHQFLDGHOFRUWH\HPSDOPH splicing) alternativo, MCP
VHH[SUHVDFRQGRVFRODVFLWRSODVPiWLFDVGLIHUHQWHVTXHPRGXODQGLYHUJHQWHPHQWHODUHVSXHVWD7 $GDSWDGRGH:DVQRZVNDet al VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
152
Pri-miRNA
Drosha
RNAdc
viral
Pre-miRNA
N
ú
c
l
e
o
Imperfecta
complementariedad
ExporƟna 5
Dicer
Inhibición
traduccional
AAA
RISC
(Argonauta)
Pre-miRNA
siRNA ó miRNA
AAA
RISC
(Argonauta)
Reconocimiento
de la secuencia
blanco
Perfecta
complementariedad
RISC
(Argonauta)
AAA
Clivaje
de la
secuencia
blanco
Figura 7.16. Generación de miRNA o siRNA. Los miRNA primarios (pri-miRNA) –FRQVLVWHQWHVHQKHEUDVGHYDULRVFLHQWRVDYDULRVPLOHV
GHQXFOHyWLGRV QW GH51$PRQRFDWHQDULRVTXHIRUPDQUHJLRQHVFRPSOHPHQWDULDVHQDVD\RWUDVQRFRPSOHPHQWDULDVFRPREXFOHV–, son
SURFHVDGRVHQHOQ~FOHRSRUODULERQXFOHDVD'URVKDTXHORVWUDQVIRUPDHQHVWUXFWXUDVHQDVDEXFOHGHXQRVQW SUHPL51$ (VWDV
PROpFXODVHJUHVDQGHOQ~FOHRDWUDYpVGHODH[SRUWLQD(QHOFLWRSODVPDHVWRVSUHmiRNA o el RNA viral bicatenario son procesados
SRUODHQ]LPD'LFHU XQD51$VD,,,FRQXQVLWLRDFWLYRGH51$VD+VtPLO TXHODVWUDQVIRUPDHQSHTXHxDVPROpFXODVGH51$ELFDWHQDULDV
GHDSUR[LPDGDPHQWHQW/DVPLVPDVVRQHQVDPEODGDVHQHOFRPSOHMRGHVLOHQFLDPLHQWRLQGXFLGRSRU51$R5,6& RNA-Induced
Silencing Complex 8QDGHODVFDGHQDVHVHOLPLQDGDGHO5,6&TXHGDQGRHOFRPSOHMROLVWRSDUDVXHQFXHQWURFRQHO51$EODQFR$OOtOD
HQ]LPD$UJRQDXWD $JR HVUHVSRQVDEOHGHODDFWLYLGDGGHOFRPSOHMR/RVPL51$HQJHQHUDOVyORH[KLEHQFRPSOHPHQWDULHGDGSDUFLDO
FRQHO51$PEODQFRORTXHFRQGXFHDXQDLQKLELFLyQGHODWUDGXFFLyQGHOPLVPR6LQHPEDUJRDOJXQRVmiRNA y los VL51$PXHVWUDQ
FRPSOHPHQWDULHGDGH[DFWDFRQODVHFXHQFLDGHO51$PEODQFRORTXHSURPXHYHHOFOLYDMHGHODVPROpFXODVGHGREOHFDGHQDIRUPDGDV(O
SURFHVRGHVFULSWRVHUHSLWHHQFLFORVVXFHVLYRV(QDxRVUHFLHQWHVVHKDGRFXPHQWDGRTXHDOJXQRVYLUXVFRGL¿FDQPL51$HQVXVJHQHV\
TXHFLHUWRVVL51$SXHGHQWDPELpQRULJLQDUVHDSDUWLUGHSVHXGRJHQHVFHOXODUHV
nes antivirales, antiproliferativas e inmunomoduladoras. Los ,)1
inducen proteínas como enzimas, factores de transcripción, glicoSURWHtQDVGHVXSHU¿FLHcitoquinas, quimioquinas y un gran número
de factores que aún no han sido caracterizados. Hasta el presente,
sólo algunas proteínas con funciones antivirales han sido caracteri]DGDV/DVPiVHVWXGLDGDVVRQODVVLJXLHQWHV )LJXUD ODVSURteínas 0[OD¶¶ROLJRDGHQLODWRVLQWHWDVD ¶¶2$6 51DVD/
XQD 51DVD HQ HVWDGR ODWHQWH \ OD SURWHtQDTXLQDVD GHSHQGLHQWH
GH51$ 3.5 Las proteínas 0[ VRQ *73DVDV TXH LQKLEHQ OD UHSOLFDFLyQ
de diversos virus con genoma RNA pertenecientes a las familias
Orthomyxo- Paramyxo-, Rhabdo-, Picorna- (Hepatovirus) y Bunyaviridae, de un modo no totalmente dilucidado. A diferencia de
otros ISG, las proteínas 0[QRVHH[SUHVDQFRQVWLWXWLYDPHQWHHQ
ODVFpOXODV\VXH[SUHVLyQQRHVLQGXFLGDGLUHFWDPHQWHSRUORVYLUXV
o las moléculas de 51$GF3RUHOFRQWUDULRODH[SUHVLyQGHHVWDV
SURWHtQDVHVHVWLPXODGDH[FOXVLYDPHQWHSRUDFFLyQGHO,)1ĮȕD
WUDYpVGHODFDVFDGDGHWUDQVGXFFLyQGHVHxDOHVGHODV-$.67$7
'HPDQHUDLQYHUVDODVSURWHtQDV¶¶2$6\OD3.5VHH[SUHVDQ
constitutivamente en la célula en una forma inactiva. Los niveles
basales de estas proteínas son estimulados por ,)1ĮȕR,)1Ȗ
y la actividad de ambas enzimas es activada por 51$GF/D¶¶
2$6FDWDOL]DODVtQWHVLVGH¶¶ROLJRDGHQLODWRVTXHDFWLYDQDODHQzima RNAasa L, la cual –a su vez- degrada los RNA tanto virales,
como celulares dando lugar a la inhibición de la replicación viral.
La PKR es una serina-treonina proteína-quinasa que fosforila al
IDFWRUHXFDULyWLFRGHLQLFLDFLyQGHODWUDGXFFLyQĮ H,)Į FRPR
consecuencia de lo cual se bloquea la traducción de los RNAm
virales y celulares. Una síntesis de los diversos ISG se detalla en
OD7DEOD
2.2.2. El sistema Complemento
(VWHVLVWHPDHVWiFRPSXHVWRSRUal menos 18 proteínas séricas y
XQQ~PHURFDVLLJXDOGHSURWHtQDVTXHVHXQHQDPHPEUDQDV\
actúan secuencialmente. El C participa tanto en la respuesta
innata como en la adaptativa )LJXUD\7DEOD (VWHVLVWHPDIXQFLRQDDWUDYpVGHWUHVYtDVODFOiVLFDODDOWHUQDWLYD\ODGH
unión a mananos. Su nombre deriva de las observaciones iniciales
en las que su actividad fue considerada como complementaria a
la de los anticuerpos y por lo tanto, un componente crítico de la
respuesta adaptativa. Actualmente, se considera a este sistema también como una herramienta central de la respuesta innata, así como
de la modulación de la respuesta de /7
(VWHVLVWHPDH[KLEHDFFLRQHVELROyJLFDVSULQFLSDOHV ODlisis
osmótica de las células o de los virus envueltos, al promover la formación de poros en las respectivas membranas por polimerización
GHORVFRPSRQHQWHV&E&&&\& FRPSOHMRGHDWDTXH ODDFWLYDFLyQGHODLQÀDPDFLyQ\DTXH&D&D\&DVHXQHQ
DODVVXSHU¿FLHVHQGRWHOLDOHV\DGLYHUVDVFODVHVGHlinfocitos, para
SRWHQFLDUODUHVSXHVWDDQWHDQWtJHQRVH[WUDxRV ODopsonización
GHDJHQWHVH[yJHQRVFRPRORVYLUXVPHGLDQWHODXQLyQDVXVXSHU¿FLHGH&E\&TTXHVRQUHFRQRFLGRVSRUFpOXODVIDJRFtWLFDVTXH
SRUWDQUHFHSWRUHVSDUDORVPLVPRV SRUHMHPSORHOUHFHSWRU&5 HQVXVVXSHU¿FLHVORVTXH±DVXYH]±SURPXHYHQODHQGRFLWRVLV
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
153
MECANISMOS
DE ACCIÓN DE LOS
miRNA
Degradación
de los RNAm
Inhibición de
la traducción
ModiĮcación
de histonas
ModiĮcaciones posttranscripcionales
MeƟlación
del DNA
ModiĮcaciones
transcripcionales
Figura 7.17. Mecanismos de regulación génica mediados por miRNA.
Respuesta adaptativa
Respuesta innata
Linfocitos B
Linfocitos T
convencionales
Linfocitos T regulatorios
miR-17~92
miR-101
miR-150
miR-155
miR-181a
miR-17~92
miR-101
miR-150
miR-155
miR-181a
miR-146
miR-150
miR-155
miR-125b
miR-132
miR-146
miR-155
miR-223
Tabla 7.7. Participación de diversos miRNAs en la regulación de la respuesta adaptativa e innata.
\ ODsolubilización de los inmunocomplejos formados por los
DQWtJHQRVGHYLUXVQRFLWRSiWLFRV\DQWLFXHUSRVHVSHFt¿FRVTXHVH
depositan en riñón ú órganos linfoides.
Dado que el sistema C puede tanto promover el daño como
la curación ante una infección, debe ser delicadamente regulado,
lo cual es particularmente relevante ante la vía alternativa que se
DFWLYDHVSRQWiQHDPHQWH/Dregulación de la cascada del C ocurre
merced a al menos 3 mecanismos HOgran tamaño de algunas
de las proteínasFRQVWLWXWLYDVTXHQROHVSHUPLWHGHMDUHOWRUUHQWH
FLUFXODWRULR DQWH XQD LQIHFFLyQ \ TXH SURPRYHUi OD OLVLV FHOXODU
VyORVLH[LVWHXQVLJQL¿FDWLYRGDxRTXHH[SRQJDDODVFpOXODVLQIHFWDGDVDODFLUFXODFLyQ ODbrevísima vida media (milisegundos)
de ciertas fracciones, que les impide actuar a distancia del sitio
GH XQD LQIHFFLyQ OD H[LVWHQFLD GH proteínas inhibitorias del
VXHUR\RWUDV¿MDGDVDODVXSHU¿FLHGHPHPEUDQDV &'>[email protected]&'R'$)>IDFWRUDFHOHUDGRUGH
ODFDtGDGHODDFWLYLGDGGH&\&FRQYHUWDVD &'>[email protected]
\&5>UHFHSWRUGHO&@ TXHVHXQHQDFLHUWDVIUDFFLRQHVGHO&
FRPR&E\&E LPSLGLHQGRVXDFFLyQ3RUHVWDUD]yQODXQLyQ
HVSRQWiQHDGH&EDODVVXSHU¿FLHVGHODVFpOXODVGHORUJDQLVPR
QRSURPXHYHODDFWLYDFLyQGHODFDVFDGDGHO& )LJXUD HYHQto que sí ocurre en las envolturas de muchos virus que al carecer
GHSURWHtQDVLQKLELWRULDVFRPR'$)\&5VRQVXVFHSWLEOHVDOD
actividad lítica del C, promovida especialmente por la vía alternativa. Sorprendentemente, HIV es resistente a dicha acción, ya que
SRUWDHQVXHQYROWXUDODVSURWHtQDV&''$)\&'GHRULJHQ
FHOXODU/DDFWLYDFLyQDWUDYpVGHODYtDFOiVLFDDOWHUQDWLYDRGHODV
OHFWLQDVFRQGXFHDOFOLYDMHGHODVIUDFFLRQHV&\&GHOVLVWHPD
GHO&ORTXHJHQHUDORVSURGXFWRV&D&E&D\&E/RVUHFHSWRUHVSDUD&D\&DSHUWHQHFHQDPLHPEURVGHODIDPLOLDGHODV
rodopsinas unidas a proteínas G de transmembrana, mientras que
ORVUHFHSWRUHVSDUD&ESHUWHQHFHQDODVIDPLOLDVUHJXODGRUDVGHOD
DFWLYDFLyQGHO& FRPR'$) \DODVȕLQWHJULQDV'$)HVLPSRUtante para restringir la activación del C sobre células seleccionadas.
'$)WDPELpQHVWiLQYROXFUDGDHQODDFWLYDFLyQFHOXODUPHGLDGDSRU
tirosina-quinasas de los /7DOSURGXFLUVHHOHQWUHFUX]DPLHQWRVREUH
ODVXSHU¿FLHGHHVWDVFpOXODV )LJXUD 2.2.3. Colectinas
6X QRPEUH GHULYD GHO LQJOpV Collagenous C-type lectins) Estas
SURWHtQDVSODVPiWLFDVWLHQHQVLPLOLWXGHVWUXFWXUDO\ELROyJLFDFRQ
&TSRUORTXHSXHGHQDFWLYDUHOVLVWHPD&(VWDVOHFWLQDVtipo C
con capacidad de unión a carbohidratos incluyen a las conglutiniQDVODSURWHtQDGHXQLyQDPDQRVD 0%3 &/\ODVSURWHtQDV
SXOPRQDUHVVXUIDFWDQWHV 63 63$\63'6HXQHQDODVXSHU¿FLH
de células y –presumiblemente- de virus, pudiendo a veces sustituir
ODDFWLYLGDGGH&TSDUDDFWLYDUODFDVFDGDGHOcomplemento. En algunos casos pueden inhibir o potenciar la infectividad de diferentes
YLUXV/DVFRQJOXWLQLQDVERYLQDVLQKLEHQDOYLUXVLQÀXHQ]DGHORV
VXEWLSRV+\+0%3HQDXVHQFLDGHcomplemento inhibe la infectividad del +,9VLQHPEDUJRODDGLFLyQGH0%3DODJSGHO
HIV activa la cascada del complemento, lo cual puede incrementar su infectividad, al promover la infección productiva de células
FRQUHFHSWRUHV&5R&5WRUQDQGRORTXHHQRWURVFDVRVHVXQD
barrera de GHIHQVDDQWLYLUDOHQXQH[FHOHQWHWUDPSROtQSRWHQFLDGRU
de la infección.
El verdadero rol de las colectinas in vivo aún no ha sido adeFXDGDPHQWHGH¿QLGR
2.2.4. Anticuerpos naturales
&RUUHVSRQGHQ D DSUR[LPDGDPHQWH HO GHO WRWDO GH ,J* H ,J0
séricas. Su formación –previa a la infección viral– obedece a la
UHVSXHVWDLQGXFLGDFRQWUDDQWtJHQRVULFRVHQJDODFWRVD *DOĮ *DO SUHVHQWHVHQODVSURWHtQDVGHVXSHU¿FLHJOLVRVLODGDV(VWRVDQtígenos se forman por la actividad de la enzima galactosil transferasa, ausente en el hombre y en primates superiores, pero presente en
primates inferiores, otros animales y también en bacterias. La proGXFFLyQGH*DOĮ *DOHQHOLQWHVWLQRKXPDQRSRUSDUWHGHODV
bacterias que lo colonizan, promueve una respuesta del hospedador
que se traduce en la formación de DQWLFXHUSRVHVSHFt¿FRV/RVYL-
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
154
TLR-2
TLR-9
TLR-4
TLR-3
SuperĮcie
Intracelular:
endosoma
y RE
celular
miR125b
miR146a
miR155
NFțB
TNF-Į
Figura 7.18. Regulación de la respuesta inmune innata por miRNA. Los receptores tipo Toll (TLR) reconocen componentes virales y
DFWLYDQODVFDVFDGDVGHVHxDOL]DFLyQLQWUDFHOXODUTXHSURPXHYHQODVUHVSXHVWDLQÀDPDWRULDV )LJXUD \RODOLEHUDFLyQGHPROpFXODV
DQWLYLUDOHV5HFLHQWHVHYLGHQFLDVPXHVWUDQTXHODLQGXFFLyQGHPL5SRUFRPSRQHQWHVEDFWHULDQRVVLUYHFRPRXQDPROpFXODGHUHWURDOLPHQWDFLyQQHJDWLYDHQGLFKDYtD/DLQGXFFLyQGHPL5HQORVPRQRFLWRVDFW~DFRPRVXSUHVRUGHODYtDGHVHxDOL]DFLyQHQWUHORVTLR
y el 71)Į7DQWRFRPSRQHQWHVEDFWHULDQRVFRPRYLUDOHVLQGXFHQPL5ORFXDOSXHGHSURPRYHUWDQWRODVXSUHVLyQFRPRODDFWLYDFLyQ
GHHVWDYtD(QFRQWUDSRVLFLyQORVOLSRSROLVDFiULGRVEDFWHULDQRVDWUDYpVGHODLQWHUDFFLyQFRQ7/5VXSULPHQPL5EHOTXHLQKLEHOD
SURGXFFLyQGH71)ĮDQLYHOSRVWWUDQVFULSFLRQDOPL5EGHVHPSHxD–DVXYH]–XQUROHVHQFLDOHQHOPDQWHQLPLHQWRGHODlatencia del
+,9HQORVlinfocitos T CD4+GHUHSRVR/DVÀHFKDVFRQERUGHVFRQWLQXRVLQGLFDQYtDVHVWLPXODWRULDVODVTXHH[KLEHQERUGHVGLVFRQWLQXRV
UHÀHMDQYtDVLQKLELWRULDV
Figura 7.19. Generación de miRNA en la infección por HCV. /DHVWLPXODFLyQSURPRYLGDSRUHOInterferón (IFN) sobre receptores especí¿FRVLQGXFHODH[SUHVLyQGHJHQHVHVWLPXODGRVSRUGLFKDPROpFXOD ,6* \ODJHQHUDFLyQGHPL51$eVWRVSXHGHQLQKLELUODH[SUHVLyQGHO
JHQRPDYLUDOSRUPHFDQLVPRVQRWRWDOPHQWHGLOXFLGDGRV(QFRQWUDSRVLFLyQHOPL5FHOXODUHVUHTXHULGRSDUDODUHSOLFDFLyQYLUDOORTXH
ORFRQVWLWX\HHQXQSRWHQFLDOEODQFRWHUDSpXWLFR
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
UXV\ODVFpOXODVH[WUDxDVTXHH[KLEHQORVPHQFLRQDGRVD]~FDUHVHQ
VXVXSHU¿FLHVRQUHFRQRFLGRVSRUORVanticuerpos naturales, que al
¿MDUHOFRPSOHPHQWRSURPXHYHQXQQH[RGHFRODERUDFLyQLQPHdiata entre la respuesta innata y la adaptativa. Es probablemente
atribuible a estos "anticuerpos naturales", que muchos virus que
infectan otros hospedadores, no afectan al hombre.
155
precursores endógenos de unos 70 nucleótidos. Se estima que
HO GH ORV JHQHV KXPDQRV HVWi UHJXODGR SRU 51$L (Q XQD
TXLQFHQD GH YLUXV SHUWHQHFLHQWHV D IDPLOLDV Herpesviridae,
Polyomaviridae y Retroviridae VHKDQGHVFULSWRWDPELpQPiVGH
miRNA que intentan favorecer la infección.
/RV PiV GH PL51$ LGHQWL¿FDGRV KDVWD HO PRPHQWR HQ
FpOXODVGHPDPtIHURVVRQWUDQVFULSWRVFDVLH[FOXVLYDPHQWHSRUOD
51$ SROLPHUDVD ,, VH KD GHVFULSWR XQ cluster de miRNA en el
2.3. RNA INTERFERENTES: MIRNA Y SIRNA
FURPRVRPDKXPDQRGLVHPLQDGRHQWUHVHFXHQFLDV$OXTXHVRQ
La regulación de la H[SUHVLyQ JpQLFD WDQWR HQ SURFDULRWDV FRPR sintetizados por la 51$SROLPHUDVD,,, /DVPROpFXODVSUHFXUVRUDV
en eucariotas se lleva a cabo mediante mecanismos pre- y post- primarias de PL51$ SULPL51$ VRQSURFHVDGDVSRUODHQ]LPD
transcripcionales. Entre los primeros se encuentran implicadas las Drosha FRQFRPLWDQWHPHQWH FRQ '*&5 Di George-syndrome
secuencias genómicas encargadas de direccionar la transcripción Critical RHJLRQSURWHLQ para producir moléculas de pre-miRNA,
JpQLFD SURPRWRUHVVLOHQFLDGRUHV\SRWHQFLDGRUHV>[email protected] \ ODVFXDOHVVRQH[SRUWDGDVGHVGHHOQ~FOHRYtDH[SRUWLQD 5 hacia el
ODDFFLyQGLIHUHQFLDOGHORVIDFWRUHVGHWUDQVFULSFLyQHQWUHRWURV citoplasma, donde son liberadas PHGLDQWHKLGUyOLVLVGH*73.
Las moléculas de pre-miRNA son procesadas en el citoplasDentro de los mecanismos de regulación post-transcripcional de la
H[SUHVLyQJpQLFDVHHQFXHQWUDODinterferenciaGH51$ 51$L OD ma por la enzima Dicer XQD51$VD,,, JHQHUDQGRORVG~SOH[GH
FXDOHVLPSOHPHQWDGDSRUGLYHUVDVHQ]LPDV 3ROLPHUDVDV51$VDV QXFOHyWLGRVGHQRPLQDGRVmiRNA que son incorporados al
y otras proteínas, así como por moléculas de RNA complementa- RISC. La actividad de Dicer UHTXLHUH GHO FRIDFWRU75%3 Tranrias a los RNAm que se pretende regular. Hasta el momento se han sactivating Region RNA-Binding Protein; región transactivadora
GHVFULSWR YDULRV WLSRV GH PROpFXODV GH 51$ QR FRGL¿FDQWHV FRQ de la proteína de unión al RNA). El RISC contiene un componente
polaridad anti-RNAm –ODVFXDOHVWLHQHQXQDH[WHQVLyQGHXQRVSR- central: la proteína Argonauta. El RISC utiliza al miRNA asociado
cos nucleótidos– como es el caso de los small –también designados DVXHVWUXFWXUDSDUDUHFRQRFHUDO51$PTXHH[KLEDXQDVHFXHQFLD
short– interfering 51$ VL51$ \ GHORV PLFUR51$ PL51$ complementaria. En base al grado de complementariedad entre
(VWDV PROpFXODV GH 51$ FRQ SRODULGDG DQWLPHQVDMHUR VH XQHQ las moléculas de miRNA y de RNAm, RISC puede promover la
SRUFRPSOHPHQWDULHGDG H[DFWDRSDUFLDO DODPROpFXODGH51$P degradación del mensajero o la inhibición de su traducción )Lblanco e inhiben su eventual traducción por diversos mecanismos, JXUD 7DPELpQORVPL51$SURPXHYHQPRGL¿FDFLRQHVWUDQVcomo son la degradación de la molécula diana por acción de las FULSFLRQDOHVDOLQGXFLUODPRGL¿FDFLyQGHKLVWRQDVGHODFURPDWLQD
51$VDV PHFDQLVPRGLVSDUDGRSRUORVVL51$ RODLQKLELFLyQGH \ODPHWLODFLyQGHO'1$ )LJXUD Estos mecanismos de silenciamiento génico post-transcripla correcta acción de la maquinaria de traducción por un impediPHQWRHVWpULFR DFFLyQSURGXFLGDSRUORVPL51$ 5HFLHQWHPHQWH cional son utilizados tanto por algunos agentes virales (HSVse ha documentado la acción reguladora positiva de los miRNA 1, HSV-2, EBV, HCMV, HPV, etc.) para regular la expresión
sobre algunas moléculas de RNAm al promover o facilitar la tra- de genes propios y/o genes del hospedero –en mecanismos de
persistencia, regulación de la latencia, oncogénesis y evasión
ducción de los mismos.
+DVWDVHFRQVLGHUDEDHVWDEOHFLGRTXHlos miRNA y los a la respuesta inmune–, como por la propia célula hospedasiRNA diferían en al menos dos aspectos. Los primeros, habían dora para silenciar/estimular tanto genes propios como virales
sido considerados el resultado de un mecanismo endógeno de (HIV, HBV, HCV). Si bien los mecanismos de regulación génica
regulación epigenética de los propios genes celulares. En con- post-transcripcional se conocen hace varios años, la importancia
traposición, los VL51$KDEtDQVLGRGH¿QLGRVFRPRODH[SUHVLyQ GHORVPLVPRVHQODUHVSXHVWDLQPXQHDQWLYLUDOUHFLpQHVWiVLHQGR
de una respuesta defensiva de la célula para preservar la pro- GLOXFLGDGD0iVD~QVLELHQKDFH\DYDULRVDxRVVHGHWHUPLQyTXH
pia integridad de su genoma, ante el ingreso de ácidos nuclei- la RNAi representa un componente vital de la respuesta inmune
cos "intrusos" YLUXVWUDQVSRVRQHVWUDQVJHQHVHWF $VLPLVPR innata antiviral en plantas y animales invertebrados, sólo recientelos miRNA aparecían como resultado de la síntesis a partir de mente se ha logrado determinar la importancia de este mecanismo
moléculas precursoras de RNA con estructura de asa (bicate- de defensa en los animales vertebrados.
Los miRNA cumplen un rol preponderante en los procesos cenaria) - bucle (monocatenaria). Como contrapartida, se establecía que los siRNA eran sintetizados a partir de largas hélices lulares de proliferación, diferenciación y apoptosis, así como en el
de RNA bicatenario. Sin embargo, dada la similitud del tamaño desarrollo del sistema inmune y su respuesta frente a los patógeH[KLELGRSRUORVmiRNA y siRNA, así como las funciones inhibi- nos. Algunas de estas moléculas son cruciales tanto para el desarroWRULDVVHFXHQFLDHVSHFt¿FDLQPHGLDWDPHQWHVHVXJLULyVXUHODFLyQ OORGHOVLVWHPDLQPXQH±FRPRSRUHMHPSORPL5D\PL5
biogenética y mecanística. Ambas moléculas son dependientes de mientras que otras regulan procesos importantes de la respuesta
la actividad de dos familias de proteínas: la ribonucleasa Dicer HV- DGDSWDWLYD FRPR VRQ OD SUHVHQWDFLyQ DQWLJpQLFD PL5 \ OD
FLQGH HO 51$ SUHFXUVRU \ Ago $UJRQDXWD TXH HV IXQGDPHQWDO señalización desde el UHFHSWRU7 PL5D $OJXQRVHMHPSORVVH
SDUDODIXQFLyQHIHFWRUDGHVLOHQFLDPLHQWRJpQLFRHQHOFRPSOHMR REVHUYDQHQOD7DEOD
Luego de una infección viral, los hongos, las plantas y los ani5,6& RNA-Induced Silencing Complexes La tríada constituida
por Dicer, Ago y las moléculas de RNA de 21-23 nucleótidos males invertebrados producen siRNA como principal mecanismo
constituyen la base del sistema de silenciamiento de los RNAs. de defensa antiviral. Por el contrario, cuando una célula de mamí(Q GRV JUXSRV GH LQYHVWLJDFLyQ GHPRVWUDURQ LQGHSHQ- fero es infectada por un virus se induce la producción de miRNA
dientemente que los siRNA de mamíferos no sólo pueden tener un capaces de eventualmente silenciar los RNAm virales. Esta inducRULJHQH[yJHQR H[RVL51$ FRPRRFXUUHDQWHHOLQJUHVRGH51$ ción se produce tanto como consecuencia de la activación de diELFDWHQDULRYLUDOVLQRWDPELpQHQGyJHQR HQGRVL51$ SRUHMHP- versos 7/5FRPRSRUODXQLyQGHORV,)1Įȕ\ȖDVXreceptor.
6HKDGHWHUPLQDGRTXHPL5MXQWRFRQPL5\PL5
SOR D SDUWLU GH G~SOH[ TXH FRPSUHQGHQ WUDQVFULSWRV DQWLVHQWLGR
derivados de pseudogenes apareados con RNAm de los genes em- HVWiQ LQYROXFUDGRV HQ OD LQPXQLGDG LQQDWD DO UHJXODU OD UHVSXHVWDLQÀDPDWRULDDJXGDOXHJRGHOUHFRQRFLPLHQWRGHOSDWyJHQRSRU
parentados.
Los VL51$TXHVHJHQHUDQDSDUWLUGHOFOLYDMHGHPROpFXODV los 7/5HQPRQRFLWRV\PDFUyIDJRV )LJXUD /DH[SUHVLyQ
de RNA bicatenario viral, tienen la capacidad de suprimir la LQGXFLEOHGHPL5VHREVHUYyWDQWRGXUDQWHODVLQIHFFLRQHVEDFinfección por virus, tal como se ha documentado en la mayoría WHULDQDV\YLUDOHVDVtFRPROXHJRGHODH[SRVLFLyQGHODVFpOXODVD
de los linajes eucarióticos incluyendo plantas, nematodes y FLWRTXLQDVSURLQÀDPDWRULDVFRPRORV,)1R71)3RUHOFRQWUDKRQJRV$XQTXHDOJXQRVGDWRVD~QVRQPRWLYRGHFRQWURYHUVLD ULRHOLQFUHPHQWRGHPL5VHREVHUYyUHVWULFWDPHQWHOXHJRGH
VHKDHVWDEOHFLGRTXHORVmiRNA celulares provienen de RNA XQDLQIHFFLyQEDFWHULDQDRGHODLQGXFFLyQFRQ,/R71)$P-
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
156
LT citotóxicos
T
Í
T
NK
IFN-Į/ȕ
U
L
O
Acs
TGF-ȕ
IL-2 o
IFN-Ȗ
2
4
6
8
DÍAS POST-INFECCIÓN
10
Figura 7.20. Cinética de la respuesta inmune innata y adaptativa. (QXQDUHVSXHVWDLQPXQHSULPDULDORVLQWHUIHURQHV ,)1 Į\ȕVH
HOHYDQWHPSUDQDPHQWHHQHOFXUVRGHODLQIHFFLyQ(OORHVWLPXODODDFWLYLGDGGHODVFpOXODV1.6XVPHFDQLVPRVGHUHFRQRFLPLHQWRGHODV
FpOXODVLQIHFWDGDVSUHFHGHQDODGHORVLT citotóxicos CD8+TXHUHTXLHUHQXQDDGHFXDGDSUHVHQWDFLyQGHSpSWLGRVYLUDOHVDQWLJpQLFRVHQ
el contexto del &0+,/RVDQWLFXHUSRVFRPLHQ]DQDVHUGHWHFWDEOHVDOUHGHGRUGHODSULPHUDVHPDQDSRVWLQIHFFLyQ/RVQLYHOHVVpULFRV
de las FLWRTXLQDV,OH,)1ȖFXUVDQHQSDUDOHORFRQODDFWLYLGDGGHORV/7FLWRWy[LFRVVLHQGRSUHFHGLGRVSRUHOGH7)*ȕHOTXHFRQWLQ~D
GHWHFWDEOHXQRVSRFRVGtDVGHVSXpVGHWRUQDUVHLQGHWHFWDEOHVORVSULPHURV
bos miRNA son componentes de la cascada de retroalimentación
negativa que atenúa la vía de señalización de los 7/5 0LHQWUDV
TXHPL5OLPLWDODH[SUHVLyQGH,5$.\75$)PL5
UHVWULQJH OD H[SUHVLyQ GH )$'' 5,3 H ,.. YpDQVH ODV YtDV GH
señalización de la DSRSWRVLVDO¿QDOGHOFDStWXOR PL5EGHVempeña un rol esencial en la mantención de la latencia del HIV en
los OLQIRFLWRV7CD4+ en reposo.
La unión de los ,)1Įȕ\ȖDVXVUHVSHFWLYRVUHFHSWRUHVQR
VyORHVWLPXODODH[SUHVLyQGHXQJUDQQ~PHURGHJHQHV SRUHMHPSOR,6* VLQRTXHDGHPiVUHFLHQWHPHQWHVHSXGRGHWHUPLQDUTXH
estas citoquinas inducen la síntesis de diversos miRNA. A su vez,
se ha establecido que diversos PL51$FRQWURODQODH[SUHVLyQGH
diferentes ISG, como un mecanismo de retroalimentación negativa
que limitaría los efectos nocivos de los ,)1VREUHORVWHMLGRVLQfectados. Como era de esperar, algunos virus portan en su genoma
VHFXHQFLDVFRGL¿FDQWHVSDUDPLFUR51$YLUDOHVTXHFRPRVHPHQFLRQyDQWHULRUPHQWHVRQXWLOL]DGRVWDQWRSDUDUHJXODUODH[SUHVLyQ
de genes virales como para evadir la respuesta antiviral montada
por los miRNA celulares.
'HWRGRORH[SXHVWRVHGHGXFHTXHlos miRNA celulares pueden regular la respuesta inmune PRGXODQGRODSUROLIHUDFLyQDFtivación y apoptosis de los LB, los /7FRQYHQFLRQDOHV\ORV7UHJV y formar parte de la msima.
$ FRQWLQXDFLyQ VH PHQFLRQDUiQ DOJXQRV HMHPSORV UHFLHQWHmente conocidos donde los PL51$SRVHHQXQDVLJQL¿FDWLYDSDUWLcipación en el curso de la infección viral correspondiente.
2.3.1. Los RNAi en las infecciones virales
HCV. En pos de determinar la contribución de los miRNA en
el efecto antiviral desencadenado por los ,)13HGHUVRQ\FROHVtudiaron células estimuladas con ,)1ȕ PHGLDQWH OD WHFQRORJtD GH
microdisposiciones de RNA. Estos estudios pioneros determinaron
que debido a la acción del ,)1ȕVHLQGXFHHQODVFpOXODV±DGHPiV
GHODH[SUHVLyQGHORV,6*\DFRQRFLGRV±ODSURGXFFLyQGHGLYHUVRV
PL51$ PL5 PL5 PL5 PL5 PL5 PL5
PL5DQGPL5 ORVFXDOHVSUHVHQWDURQSHUIHFWDFRPSOHPHQtariedad con el genoma de +&9 )LJXUD (ODOLQHDPLHQWRGH
secuencias nucleotídicas de cepas de +&9 SHUWHQHFLHQWHV D genotipos diferentes mostró que el sitio de unión de los miRNA antes
mencionados podría producirse tanto en regiones del genoma viral
conservadas entre todos los genotipos, así como en regiones especí¿FDVGHFLHUWRVJHQRWLSRV$GHPiVHVWRVmiRNA fueron inducidos
UiSLGDPHQWH±DOFDERGHPLQXWRV±OXHJRGHODDGPLQLVWUDFLyQD
las células del ,)1ȕ\GHXQDPDQHUDGRVLVGHSHQGLHQWH&DEHGHV-
WDFDUTXHODLQGXFFLyQGHODH[SUHVLyQGHORV,6*FRUUHVSRQGLHQWHV
VHSURGXFHKRUDVGHVSXpVGHODXQLyQGHO,)1FRQVXreceptor, lo
TXHVXJLHUHTXHHOPHFDQLVPRDQWLYLUDOHMHUFLGRSRUORVmiRNA representa la primera línea de GHIHQVDFRQWUDORVSDWyJHQRV0iVD~Q
FRQMXQWDPHQWH FRQ ORV PHFDQLVPRV antivirales antes mencionados
se observó que el ,QWHUIHUyQȕLQKLEHODVtQWHVLVGHPL5(VWH
PL51$HVSHFt¿FRGHOKtJDGRHVWLPXODODUHSOLFDFLyQGHOHCV en las
FpOXODVLQIHFWDGDVDOXQLUVHDOH[WUHPR¶875GHOJHQRPDYLUDO(VWH
mecanismo favorecería la acumulación del genoma viral en el comSOHMRUHSOLFDWLYR\RFRQWURODUtDODWUDGXFFLyQGHODSROLSURWHtQDYLUDO
(VFRQFHELEOHTXHPL5VHWUDQVIRUPHHQXQEODQFRWHUDSpXWLFR
en pacientes infectados con HCV.
HIV. Recientemente se ha podido determinar que diversos
PL51$ FHOXODUHV PL5S PL5S PL5 PL5D
PL5DPL5E\PL5 OLPLWDQODUHSOLFDFLyQGHOHIV,
y que éste a su vez inhibe la síntesis de los miRNA antes mencioQDGRV6HKDSRGLGRGHWHUPLQDUTXHPL5S\PL5DLQKLEHQ
la traducción de los RNAm virales. De manera inversa, el HIV
estimula la síntesis de diversos miRNA celulares que favorecerían
VX UHSOLFDFLyQ HQ WDO VHQWLGR VH KD UHSRUWDGR HO DXPHQWR GH ORV
QLYHOHVGHPL5PL5PL5\PL5HQODLQIHFFLyQ
con +,9(QHVWXGLRVGHPLFURGLVSRVLFLRQHVGH51$HQFpOXODV7
de pacientes infectados con HIV se pudo determinar no sólo que
los niveles de miRNA son variables entre los distintos pacientes,
sino que se vio disminuida la síntesis de varios miRNA celulares.
Recientemente, Chable-Bessia y cols. determinaron que la acción antiviral de los PL51$ QR VyOR HVWi OOHYDGD D FDER SRU ODV
PROpFXODVGHPLFUR51$VLQRTXHDGHPiVYDULRVGHORVFRPSRnentes de la maquinaria celular de RNAi serían los responsables
de la inhibición de la replicación del HIV. En tal sentido, dichos
autores determinaron que las RNAsas celulares y algunos de las
PROpFXODV DVRFLDGDV 'URVKD 'LFHU \ '*&5 UHVSRQVDEOHV GHO
procesamiento de las moléculas de miRNA inhiben la replicación
viral en células mononucleares de sangre periférica de pacientes
infectados con HIV. Se ha podido observar también que los mRNA
YLUDOHVVHDVRFLDQ\FRORFDOL]DQFRQFRPSRQHQWHVGHO5,6& 5&.
S*:/6P\;51 ORVFXDOHVUHJXODQQHJDWLYDPHQWHOD
WUDGXFFLyQGHORVPHQVDMHURVYLUDOHV,QWHUHVDQWHPHQWHHOknockdown GH 5&.S R '*&5 UHVXOWD HQ OD UHDFWLYDFLyQ YLUDO HQ
los linfo-mononucleares de sangre periférica aislados de pacientes
infectados con +,9WUDWDGRVFRQ+$$57
,QÀXHQ]D0HGLDQWHDQiOLVLVFRPSXWDFLRQDOVHKDSRGLGRGHterminar que varios PL51$FHOXODUHVHVWiQLPSOLFDGRVHQODpato-
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
JpQHVLV\HOWURSLVPRGHOYLUXVLQÀXHQ]D$ subtipo +1 (QWDO
VHQWLGRVHHVWLPDTXHPL5\PL5WLHQHQSRWHQFLDOHVVLWLRV
GHXQLyQDORVPHQVDMHURVGHODSROLPHUDVDEiVLFDYLUDO3%\DOD
KHPDJOXWLQLQDUHVSHFWLYDPHQWH0iVD~QPHGLDQWHODXWLOL]DFLyQ
de la metodología de microdisposiciones de RNA para estudiar la
H[SUHVLyQ GH ORV PL51$ HQ GLIHUHQWHV WHMLGRV KXPDQRV VH SXGR
GHWHUPLQDU TXH PL5 HV HVSHFt¿FR GH SXOPyQ 2WUD FXHVWLyQ
interesante es que estos PL51$HVWiQDXVHQWHVHQHOJHQRPDGHORV
pollos, mientras que un gran número de los PL51$KXPDQRV GH ORV DQDOL]DGRV WLHQHQ miRNA homólogos en el genoma
DYLDU(VWHKDOOD]JR±HQWUHRWURVIDFWRUHV±SRGUtDH[SOLFDUODVGLIHrencias en la infectividad y letalidad del virus en pollos y humanos.
IgG
T
Í
T
IgM
U
L
O
Virus
Virus
2
4
6
8
10
12
14
157
16
18
20
DÍAS POST-INFECCIÓN
Figura 7.21. Cinética de la respuesta humoral mediada por IgM
e IgG ante una infección aguda viral.
3. INMUNIDAD
ADAPTATIVA
La infección viral desencadena en el hospedador inmunocompeWHQWHHOGHVDUUROORGHPHFDQLVPRVHVSHFt¿FRVGHLQPXQLGDGDGTXLULGD WDQWR D QLYHO KXPRUDO DQWLFXHUSRV FRPR FHOXODU GLULJLGRV
contra distintos constituyentes del virión, así como contra proteínas
)LJXUD,PDJHQFULVWDORJUi¿FDGHODKHPDJOXWLQLQDGHOYLUXVLQÀXHQ]D$ +1 GHXQLGDDXQDQWLFXHUSRTXHWDPELpQ
promueve la neutralización cruzada con la hemaglutinina del virus pandémico 2009. A. Interacción entre el sitio Sa de la KHPDJOXWLQLQD
YLUDO YpUWLFHGHOGRPLQLRGHXQLyQDOUHFHSWRU \HOIUDJPHQWR)DEGHXQDQWLFXHUSRDQWLKHPDJOXWLQLQDSURYHQLHQWHGHXQVREUHYLYLHQWHDOD
LQIHFFLyQSRUHOYLUXVSDQGpPLFRGH/DVXSHU¿FLHGHLQWHUDFFLyQFRPSUHQGH$2 sobre la KHPDJOXWLQLQD\$2VREUHHO)DE(Q
DPDULOORVHPXHVWUDQODVFDGHQDVSHVDGDV+\HQURMRODVOLYLDQDV/(QPDJHQWDVHH[KLEHODVXEXQLGDG+$\HQFHOHVWHODVXEXQLGDG+$
GHXQRGHORVWUHVPRQyPHURVGHODHVWUXFWXUDWULPpULFDGHODKHPDJOXWLQLQDHOUHVWRGHFX\DVXSHU¿FLHVHREVHUYDHQJULV/DVFDGHQDVKLGURFDUERQDGDV1XQLGDVVHLQGLFDQHQDPDULOOR iWRPRGHFDUERQR \HQURMR iWRPRGHR[tJHQR B.$PD\RUDXPHQWRVHREVHUYDQORVUHVLGXRV
GHOVLWLRDQWLJpQLFR6D\VXUHODFLyQFRQODVKXHOODVGHO)DEDOLQWHUDFWXDUFRQODKHPDJOXWLQLQD(OHStWRSHFRQIRUPDFLRQDOGHODKHPDJOXWLQLQD
HVWiFRQVWLWXLGRSRUORVUHVLGXRVD\D/RVDPLQRiFLGRVTXHIRUPDQODVXSHU¿FLHGHLQWHUDFFLyQFRQOD,JVHH[KLEHQHQ
PDJHQWDPLHQWUDVTXHORVTXHIRUPDQSDUWHGHOHStWRSHFRQIRUPDFLRQDOSHURHVWiQIXHUDGHOVLWLRFDQyQLFR6DHVWiQSLQWDGRVHQDPDULOOR
/RVDPLQRiFLGRVGHOVLWLR6DTXHQRHVWiQHQFRQWDFWRFRQOD,JVHYHQHQFRORUPDUUyQFODUR/DVFHSDV6&\&$QRH[KLEHQVLWLRV
GH1JOLFRVLODFLyQHQHOVLWLR6DPLHQWUDVTXHODFHSDYDFXQDO%ULVEDQHFRPRWDQWDVRWUDVGHLQÀXHQ]DHVWDFLRQDOKDQDGTXLULGRVLWLRVGH
SRWHQFLDOJOLFRVLODFLyQHQORVDPLQRiFLGRV\ HQLWiOLFD C.(ODQWLFXHUSR'H[KLEHHQHQVD\RVGH(/,6$XQDIXHUWHD¿QLGDGSRUODV
KHPDJOXWLQLQDVGHORVYLUXVSDQGpPLFRVGH +$ \ &$+$ SHURQRSRUORVYLUXV35 3XHUWR5LFR \RWUDVKHPDJOXWLQLQDV
GHGLYHUVDVVXEWLSRVGHLQÀXHQ]D)XHQWH;Xet alScience 5HSURGXFLGRFRQDXWRUL]DFLyQ
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
158
Inmunización
pasiva protectora
Fuente
Rabia
Sí
6XHURKLSHULQPXQHHTXLQRR
JDPPDJOREXOLQDKLSHULQPXQHKXPDQD
+HSDWLWLV$
Sí
*DPPDJOREXOLQDHVWiQGDUKXPDQD
+HSDWLWLV%
Sí
*DPPDJOREXOLQDKLSHULQPXQHKXPDQD
-XQtQ
Sí
3ODVPDKXPDQRGHFRQYDOHFLHQWH
de ¿HEUHKHPRUUiJLFDDUJHQWLQD
Virus
Tabla 7.8. Inmunidad humoral en infecciones virales: DOJXQRVHMHPSORVHQORVTXHODLQPXQL]DFLyQSDVLYDDUWL¿FLDOHVVX¿FLHQWHSDUD
FRQIHULUSURWHFFLyQ7DPELpQVHKDHVWDEOHFLGRHOFDUiFWHUSURWHFWRUGHODDGPLQLVWUDFLyQSUR¿OiFWLFDGHJDPPDJOREXOLQDHVSHFt¿FDKXPDQD
DQWHODH[SRVLFLyQDOYLUXVVDUDPSLyQDVtFRPRGHORVDQWLFXHUSRVHVSHFt¿FRVHQODprevención de la SROLRPLHOLWLV
QRHVWUXFWXUDOHVH[SUHVDGDVGXUDQWHODLQIHFFLyQ/DPDJQLWXGGHOD
UHVSXHVWDGHSHQGHUiGHP~OWLSOHVIDFWRUHVWDOHVFRPRODQDWXUDOH]D
del virus, la puerta de entrada del mismo, su forma de diseminaFLyQHWF7DQWRODinmunidad humoral como la celular son fundamentales para limitar y eliminar la infección e inducir resistencia
duradera a las reinfecciones.
'LIHUHQWHV HVWUXFWXUDV YLUDOHV DQWLJpQLFDV SXHGHQ VHU H[SXHVtas al sistema inmune del hospedador como consecuencia de una
LQIHFFLyQYLUDO(OORSXHGHGHEHUVHDODFLUFXODFLyQOLQIRKHPiWLFD
GHYLUXVOLEUHV RGHDOJ~QFRPSRQHQWHVXEYLUDOSDUWLFXODGRRVROXEOH RDODH[SUHVLyQGHDQWtJHQRVYLUDOHVSURFHVDGRVHQODVFpOXODV
LQIHFWDGDV\H[SXHVWRVHQODVXSHU¿FLHGHVXPHPEUDQDFLWRSODVPiWLFD(QHOFDVRGHODVSDUWtFXODVYLUDOHVLQWDFWDVHQFLUFXODFLyQ
se produce la estimulación del sistema inmune humoral por parte
GHORVDQWtJHQRVGHVXSHU¿FLH SUHVHQWHVHQODHQYROWXUDGHDOJXQRVYLUXVRELHQHQODFiSVLGHGHDTXHOORVTXHVRQGHVQXGRV (Q
otros casos, también se detectan anticuerpos contra productos de
GHJUDGDFLyQRFOLYDMHGHFRPSRQHQWHVYLUDOHVFLUFXODQWHV/RV/7
FLWRWy[LFRVQRSXHGHQUHFRQRFHUODVSURWHtQDVYLUDOHV DLVODGDV HQ
FLUFXODFLyQ\DTXHQRHVWiQSUHVHQWDGDVHQHOFRQWH[WRGHDQWtJHnos del CMH-I.
/DH[SUHVLyQGHDQWtJHQRVGHVXSHU¿FLHGHOYLULyQRELHQGH
SURWHtQDVLQWHUQDV SRUHMHPSORQXFOHRSURWHtQDVGHYLUXVHQYXHOWRV
\DOJXQDVSROLPHUDVDV XRWUDVQRHVWUXFWXUDOHVSURGXFLGDVGXUDQWH
la replicación viral luego de su procesamiento, como péptidos en la
PHPEUDQDFLWRSODVPiWLFDGHODVFpOXODVLQIHFWDGDVHQHOFRQWH[WR
del &0+, LQGXFLUi HO UHFRQRFLPLHQWR GH ODV FpOXODV LQIHFWDGDV
por los /7 FLWRWy[LFRV HIHFWRUHV (V SRU HOOR TXH ODV LQIHFFLRQHV
FDXVDGDVSRUYLUXVTXHHJUHVDQGHODFpOXODDOOtTXLGRH[WUDFHOXODU
mediante lisis son fundamentalmente controladas por la respuesta
humoral, mientras que aquellos que lo hacen por brotación sin lisis
son limitadas principalmente por mecanismos de inmunidad mediada por células. En este caso, los anticuerpos pueden participar
en la QHXWUDOL]DFLyQYLUDO SRUHMHPSORVLH[LVWHYLUHPLD RHQOD
lisis de células infectadas con participación del sistema del C o de
FLHUWDVFpOXODVFLWRWy[LFDVFRQUHFHSWRUSDUD)FFRPRPDFUyIDJRV
y NK.
Dos son las características principales de la respuesta inPXQH DGDSWDWLYD OD HVSHFL¿FLGDG \ OD PHPRULD Ante un primer encuentro con el virus, la respuesta adaptativa puede demorar
YDULRVGtDVHQDSDUHFHUHQFRQWUDSRVLFLyQDQWHXQUHLQJUHVRSRU
HO PLVPR YLUXV R D~Q SRU XQR UHODFLRQDGR DQWLJpQLFDPHQWH VH
SURGXFH XQD £IXULRVD UHVSXHVWD DO FDER GH KRUDV GtDV TXH
tiende a limitar la misma y que acompaña a las defensas innatas
también "movilizadas".
De allí que múltiples infecciones virales que acontecen durante
la infancia pueden proveer protección en la adultez, y –en ciertos
FDVRV±GXUDQWHWRGDODYLGD(QPRGRDQiORJRXQSULPHUHQFXHQWUR
FRQXQDQWtJHQRYDFXQDOSURPRYHUiXQDUHVSXHVWDLQPXQHDGDSWDWLYDTXHVHUiSURWHFWRUD±IUHFXHQWHPHQWH±GXUDQWHPXFKRVDxRVSDUD
el individuo inmunizado. Las bases de esta memoria inmunológica
son aún debatidas, habiéndose postulado que la vida media prolongada de los linfocitos de memoria que perduran años en el organis-
PR VRQ UHVSRQVDEOHV GH OD UiSLGD UHVSXHVWD DGDSWDWLYD VHFXQGDULD
al producir una veloz proliferación y una enérgica síntesis de productos protectores. Es motivo de investigación si dichas células son
"secuestradas" en depósitos del organismo, o si son constantemente
producidas. Se sabe que la ,/HVQHFHVDULDSDUDODPDQWHQFLyQGH
DOJXQDV DXQTXHQRWRGDV ODVFpOXODV7GHPHPRULD6HKDSRVWXODGR
TXH OD SUHVHQFLD GH LQPXQRFRPSOHMRV DVRFLDGRV D OD VXSHU¿FLH GH
las células foliculares dendríticas por períodos prolongados, permiWLUtDODOLEHUDFLyQGHDQWtJHQRVHQEDMDVFRQFHQWUDFLRQHVDWUDYpVGHO
tiempo, lo cual promovería una persistente memoria inmunológica.
A diferencia de los receptores para PAMP de la respuesta innaWDFRGL¿FDGRVHQODOtQHDJHUPLQDOORVUHFHSWRUHVGHODVFpOXODVGH
la respuesta adaptativa son formados mediante rearreglos genéticos
durante el desarrollo del organismo. Cada LT y LB posee en su
VXSHU¿FLHUHFHSWRUHVSDUDXQLUVHDXQGHWHUPLQDGRSpSWLGRR
epítope. La respuesta antiviral es posible dado que los linfocitos
presentes en el organismo han "sobrevivido" al proceso de seOHFFLyQTXHHOLPLQDDTXHOORVFORQHVUHDFWLYRVFRQWUDSpSWLGRVR
epítopes propios. Se cree que dichas células entran a la circulación
VDQJXtQHD\GHDOOtVHGLULJHQDOVLVWHPDOLQIiWLFRRDORVGLYHUVRV
WHMLGRVGHORUJDQLVPRA estos linfocitos se los considera naïve o
YtUJHQHV\DTXHQRH[KLEHQXQDGLIHUHQFLDFLyQFRPSOHWD\
QRSURGXFHQODUHVSXHVWD¿QDOHIHFWRUD" correspondiente a tal
GLIHUHQFLDFLyQ \DVHDQORVanticuerpos, la muerte celular o las citoTXLQDVTXHHOLPLQDQODLQIHFFLyQYLUDOGHGLFKDVFpOXODV Al unirse
DORVSpSWLGRVRHStWRSHVHVSHFt¿FRVDVXVUHVSHFWLYRVUHFHSWRres, se produce una rápida respuesta inmune caracterizada por
ODHVSHFL¿FLGDG\GLYHUVLGDGGHODPLVPDDVRFLDGDDXQDSURQWDDGTXLVLFLyQGHVXFDSDFLGDGHIHFWRUD. Al producirse la unión
entre el péptido o el epítope y el UHFHSWRUHVSHFt¿FRVRQHVFDVDV
ODVFpOXODVLQLFLDOPHQWHLQYROXFUDGDVDSUR[LPDGDPHQWHD
'DGRTXHGLFKDFXDQWtDHVFLHUWDPHQWHLQVX¿FLHQWHSDUD
lograr limitar la infección, es la estimulación de células previamenWHQRLQYROXFUDGDVHQODUHVSXHVWDHVSHFt¿FDODTXHORSHUPLWLUi(Q
DVHPDQDVHOQ~PHURGHOLQIRFLWRVHVSHFt¿FRVSDUDXQGHWHUPLQDGRSpSWLGRRHStWRSHVHLQFUHPHQWDPiVGHYHFHVPHUFHGD
que OLQIRFLWRVSUHFXUVRUHVDGTXLHUHQODFDSDFLGDGGHGLYLGLUVH
madurar y producir anticuerpos o FLWRTXLQDVTXHOLPLWHQODLQfección. Estos son los OLQIRFLWRV DFWLYDGRV ORV TXH RULJLQDUiQ
FORQHVKLMRVFRQODPLVPDHVSHFL¿FLGDG
6LELHQVHGHVFULELUiQDFRQWLQXDFLyQVHSDUDGDPHQWHORVFRPponentes humoral y celular de la respuesta inmune adaptativa, es
menester tener presente su interrelación: los LB son ayudados por
XQDVXESREODFLyQGHFpOXODV7\HQFLHUWDVFLUFXQVWDQFLDVVXSULPLGRVSRURWUDVXESREODFLyQ7$VXYH]GHWHUPLQDGDVFpOXODVFLWRWy[LFDVSXHGHQHMHUFHUVXVHIHFWRVGHSHQGLHQGRGHODSUHVHQFLD
de DQWLFXHUSRVFRPRPHGLDGRUHV(QOD¿JXUDVHPXHVWUDOD
cinética de algunos de los componentes de la respuesta inmune innata y adaptativa.
3.1. INMUNIDAD HUMORAL
La respuesta sérica de anticuerpos que se produce luego de un priPHUFRQWDFWRFRQXQYLUXV UHVSXHVWDSULPDULD HVELIiVLFDSUHVHQ-
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
WDQGRXQSLFRLQLFLDODORVGtDVSRVWLQIHFFLyQVHJXLGRGHRWUR
DORVGtDV
Esto se debe a la aparición secuencial de IgM y luego de
,J*HVSHFt¿FDV. La IgA aparece en suero en menor cantidad, después de la IgM e IgG. La IgM decae a niveles no detectables en
tiempos variables para cada infección viral, en general al cabo
de 2 o 3 meses. Por ello, su detección permite frecuentemente
realizar un diagnóstico de infección reciente. Por el contrario, la
,J*HVSHFt¿FDSHUPDQHFHHQFLUFXODFLyQPHVHVRDxRV\DYHFHV
GXUDQWHWRGDODYLGD )LJXUD La intensidad y duración de esta respuesta depende de la puerta
de entrada y de la forma de diseminación del virus. Si éste se disemiQDPHGLDQWHYLUHPLDODHVWLPXODFLyQDQWLJpQLFDVHUiLQWHQVD\DIHFWDUiDWRGRHOWHMLGROLQIRLGHGHORUJDQLVPR JDQJOLRVED]RPpGXOD
yVHD 3RUHOORODUHVSXHVWDGHDQWLFXHUSRVVHUiGHJUDQPDJQLWXG
En las respuestas secundarias a las infecciones virales (reinfecciones) puede haber una respuesta anamnésica de IgM (de corta
duración), seguida de una importante producción de IgG.
Por el contrario, cuando el virus penetra por vía mucosa y queGDUHVWULQJLGRDHOODVSRUHMHPSORHQinfecciones respiratorias o
LQWHVWLQDOHVH[LVWLUiXQDSURGXFFLyQORFDOGH,J$VHFUHWRULDSHUR
ODUHVSXHVWDVpULFDVHUiGHPDJQLWXGUHVWULQJLGD
&XDQGRXQDQWtJHQRVHXQHHVSHFt¿FDPHQWHDOreceptor B
TXHORUHFRQRFH ,JDVRFLDGDDODVXSHU¿FLHGHXQ/% VHLQLFLD
una cascada de transducción de señales, lo que promueve la división celular. La progenie clonal se diferencia en células B de
memoria de larga duración y en plasmocitos efectores de vida
media corta.eVWRVQRVLQWHWL]DQPiV,JSDUDVXXQLyQDODPHPEUDQDSODVPiWLFDVLQRTXHVHFUHWDQDOPLVPRDQWLFXHUSR £PiVGH
PROpFXODVSRUVHJXQGR Es menester destacar que la estimulación producida por pequexDVGRVLVGHDQWtJHQR V YLUDO HV GXUDQWHSHUtRGRVFRUWRVLQGXFHOD
síntesis de IgM solamente. Una vez que el estímulo cesa, el nivel
de IgM disminuye hasta niveles no detectables. Por el contrario, la
estimulación viral intensa, induce la síntesis de IgM y luego de IgG
e IgA. Al cesar dicha estimulación, el nivel de IgM decae como en
el primer caso, pero el de IgG se mantiene por períodos variables.
Ante un segundo contacto con el mismo antígeno viral, en el priPHUFDVRVHSURGXFLUiQXHYDPHQWHXQDUHVSXHVWDSULPDULDGH,J0
PLHQWUDVTXHHQHOVHJXQGRKDEUiXQDUHVSXHVWDLQPXQHDXPHQWDGD
de tipo anamnésica.
6H KD GHWHFWDGR ,J$ VHFUHWRULD HVSHFt¿FD DQWLYLUDO HQ VHFUHciones respiratorias, oculares, intestinales, genitales y en la leche
materna. La IgA se sintetiza localmente en los nódulos linfoides
de la submucosa. Muchos virus inducen la síntesis de IgA, como
SRUHMHPSORVHREVHUYDHQLQIHFFLRQHVSURGXFLGDVSRUYLUXVFX\D
SXHUWDGHHQWUDGDHVUHVSLUDWRULD LQÀXHQ]DPLHPEURVGHODIDPLOLD
ParamyxoviridaeDGHQRYLUXVUXEpRODHWF RHQWpULFD YLUXVKHSDWLWLV$URWDYLUXVHWF La producción local de IgA puede estimularse como consecuencia de infecciones naturales o de inmunizaciones por vía muFRVD WDOFRPRVHREVHUYDHQODprevención anti-poliomielítica empleando la YDFXQD6DELQ /DUHVSXHVWDGH,J$VHUiPiVLQWHQVDVLVHLQPXQL]DFRQXQYLUXV
FDSD]GHUHSOLFDU(QHVWHFDVRKDEUiSURGXFFLyQGH,J$VHFUHWRULD
y también de IgA sérica. Por el contrario, si el virus no es capaz de
UHSOLFDU\VHLQPXQL]DSRUYtDPXFRVDODUHVSXHVWDVHUiVRODPHQWHGH
IgA secretoria y de escasa magnitud. Esto sucede en la administraFLyQH[SHULPHQWDOSRUYtDPXFRVDGHvacunas inactivadas.
La IgA tiene importancia en la resistencia a reinfecciones con
YLUXVUHVSLUDWRULRV/DOHFKHPDWHUQDTXHFRQWLHQH,J$HVSHFt¿FD
protege contra numerosos virus respiratorios y entéricos, aunque
UHFLHQWHPHQWHVHKDREVHUYDGRTXHODPLVPDHMHUFHXQHIHFWRSURWHFWRUGLIHUHQFLDGRGHSHQGLHQWHGHOVH[RDQWHODVLQIHFFLRQHVYLUDOHVUHVSLUDWRULDV YpDVHHOtWHPHQHVWHFDStWXOR 3.1.1. Los anticuerpos en el control de las infecciones virales
Los anticuerpos desempeñan en las infecciones virales diversas
IXQFLRQHV HOLPLQDFLyQ GH OD LQIHFFLyQ SULPDULD OLPLWDFLyQ
159
GHODYLUHPLD\ OLPLWDFLyQGHODHQIHUPHGDG\prevención de las
UHLQIHFFLRQHV$OJXQRVHMHPSORVGHOXVRDFWXDOGHORVanticuerpos
DQWLYLUDOHVHQODLQPXQL]DFLyQSDVLYDVHH[KLEHQHQOD7DEOD
Como respuesta a los antígenos virales circulantes o asociados a células infectadas se pueden producir DQWLFXHUSRVHVSHFt¿FRV
contra todos los constituyentes inmunogénicos del virión con los
que el organismo toma contacto. Los anticuerpos dirigidos contra
FRQVWLWX\HQWHVH[WHUQRVGHOYLULyQVHUiQFDSDFHVGHQHXWUDOL]DUOD
acción del virión, por lo cual se denominan neutralizantes. Estos
DQWLFXHUSRV HVWiQ GLULJLGRV FRQWUD JOLFRSURWHtQDV \ OLSRSURWHtQDV
HQORVYLUXVHQYXHOWRV \FRQWUDSROLSpSWLGRVGHODFiSVLGH HQORV
YLUXVGHVQXGRV Los anticuerpos circulantes constituyen una barrera para evitar
TXHORVYLUXVOLEUHVHQHOHVSDFLRH[WUDFHOXODURHQODVDQJUHSXHdan alcanzar los órganos que son blanco de la replicación. Estos
DQWLFXHUSRVVRQKDELWXDOPHQWHH¿FDFHVDQWHHYHQWXDOHVUHLQIHFFLRnes, lo cual constituye el fundamento de la inmunización activa
PHGLDQWH YDFXQDFLyQ 7DPELpQ OD LQPXQL]DFLyQ SDVLYD PHGLDQWH
la transferencia de DQWLFXHUSRV HVSHFt¿FRV SHUPLWH GLVPLQXLU OD
morbi-mortalidad de numerosas enfermedades virales.
&XDQGR OD LQIHFFLyQ YLUDO HV JHQHUDOL]DGD sarampión, poliomielitis, UXEpROD HWF OD LQPXQLGDG HVSHFt¿FD TXH VH GHVDUUROOD
luego de la infección es de larga duración, en general de por vida y
se debe a la presencia de anticuerpos neutralizantes en circulación.
Habitualmente, la inmunidad es WLSRHVSHFt¿FDORTXHVLJQL¿ca que protege contra el mismo tipo antigénico, pero no contra seURWLSRVGLIHUHQWHVORVTXHVHUiQFDSDFHVGHSURGXFLUUHLQIHFFLRQHV
en ese hospedero. Cuando las infecciones quedan localizadas en las
PXFRVDV SRUHMHPSORHQLQIHFFLRQHVGHOWUDFWRUHVSLUDWRULR OD,J$
secretoria es la que previene la colonización y evita las reinfecciones mediante la neutralización del virus infectante. Esta respuesta
ORFDOGH,J$HVGHFRUWDGXUDFLyQ DDxRV SRUHOORVHSXHGHQ
producir reinfecciones por el mismo serotipo y se selecciona en la
comunidad la circulación de cepas que presentan mínimas diferencias antigénicas: es el caso de las variaciones menores observadas
HQHOJHQRPDGHOYLUXVLQÀXHQ]D
La intrigante observación de que la pandemia de LQÀXHQ]DTXH
HPHUJLy HQ DIHFWDED HQ PHQRU PHGLGD D ORV LQGLYLGXRV GH
PD\RUHGDG HVSHFLDOPHQWHORVPD\RUHVGHDxRV IXHUHVXHOWD
PHGLDQWHODGLOXFLGDFLyQGHODHVWUXFWXUDFULVWDORJUi¿FDGHODhemaJOXWLQLQDGHHVWDFHSDODTXHHQHOVLWLR6D YpUWLFHGHOGRPLQLRGH
unión al UHFHSWRUFHOXODU UHVHXOWyVLPLODUDODGHOYLUXVSDQGpPLFR
GHORFXDOMXVWL¿FDODLQPXQLGDGREVHUYDGDHQGLFKRJUXSR
SREODFLRQDOFRPRFRQVHFXHQFLDGHODH[SRVLFLyQDHVWH~OWLPR(Q
OD)LJXUDVHREVHUYDHODQiOLVLVFULVWDORJUi¿FRGHODLQWHUDFFLyQ HQWUH HO IUDJPHQWR )DE GH XQ DQWLFXHUSR QHXWUDOL]DQWH DQWL
KHPDJOXWLQLQDGHODFHSDSURGXFWRUDGHODSDQGHPLDGHFRQOD
KHPDJOXWLQLQDHVSHFt¿FDDVtFRPRODUHDFWLYLGDGFUX]DGDGHGLFKD
Ig con la KHPDJOXWLQLQDGHODFHSDSDQGpPLFD
Ante una gastroenteritis por rotavirus se produce una respuesta
inmune tanto homotípica como heterotípica. Esta última se atribuye a la presencia de epítopes comunes en las proteínas VP4 y
93GHODFiSVLGHYLUDOGHGLIHUHQWHVVHURWLSRVRDOHIHFWRbooster
GHXQVHURWLSRGLVWLQWRGHOTXHSURGXMRODSULPRLQIHFFLyQVREUHOD
respuesta anamnésica hacia éste. Es decir, los anticuerpos dirigidos
contra el agente de la primoinfeción pueden atemperar la gravedad
GH VXEVLJXLHQWHV LQIHFFLRQHV SRU GLYHUVRV VHURWLSRV GH URWDYLUXV
DVLPLVPRHOSDVDMHSDVLYRGHanticuerpos IgA anti-rotavirus a traYpVGHODVHFUHFLyQOiFWHDPDWHUQDVHDVRFLDWDPELpQDSURWHFFLyQ
Sin embargo, la presencia de anticuerpos parecería no asegurar
la protección a la reinfección con cepas homólogas o heterólogas
del HCV. En la infección causada por este agente, se ha demosWUDGR TXH VLPXOWiQHDPHQWH FRH[LVWH HQ XQ PLVPR LQGLYLGXR XQD
mezcla heterogénea de genomas virales viables con una secuencia nucelotídica predominante y un amplio espectro de mutantes
relacionadas, una distribución genómica poblacional conocida
como cuasiespecies. La actividad de la RNA polimerasa viral sin
FDSDFLGDGGHFRUUHJLUHUURUHV FDUHFHGHproof reading o lectura de
SUXHED FRQOOHYD HO ULHVJR GH DFXPXODU mutaciones, las que han
160
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
VLGRFDOFXODGDVHQ[ por sitio y por año. Estas variaciones
genómicas con traducción fenotípica -sobre todo en las regiones
KLSHUYDULDEOHVSRUHMHPSORSUHVHQWHVHQODHQYROWXUDYLUDOWLHQHQ
relevancia también en la patogenia, ya que podrían constituir un
PHFDQLVPRGHHVFDSHDODYLJLODQFLDLQPXQROyJLFD0iVD~QHVWXdios realizados en chimpancés demostraron la falta de protección
cuando éstos son inoculados con cepas diferentes del mismo virus,
aun en presencia de anticuerpos anti-HCV inducidos durante infecciones previas. Este concepto de evolución de especies implica
XQVHULRREVWiFXORKDFLDHOGHVDUUROORGHvacunas para hepatitis C
HQ XQ IXWXUR SUy[LPR TXH HVWpQ EDVDGDV HQ OD LQGXFFLyQ GH XQD
respuesta inmune dirigida hacia la envoltura del virus homónimo.
'DGRTXHXQGHORVLQGLYLGXRVLQIHFWDGRVFRQHCV que
son sometidos a WUDVSODQWH KHSiWLFR HYROXFLRQDQ D OD FLUURVLV GHO
yUJDQRUHLQIHFWDGRGHQWURGHORVDxRVHQVHSURSXVRHOHPpleo de anticuerpos monoclonales de origen humano y con amplia
DFWLYLGDG QHXWUDOL]DQWH broadly neutralizing antibodies) frente a
cepas del HCV de diversos genotipos. Dichos anticuerpos neutraOL]DQWHVHVWiQGLULJLGRVFRQWUDXQSpSWLGRGHODJOLFRSURWHtQD(GH
la envoltura viral y constituyen una promisoria futura alternativa a
H[SORUDUSDUDODLQPXQL]DFLyQSDVLYDGHHVWRVSDFLHQWHV
&RPRVHGHVFULEHHQHOFDStWXOR (YDVLyQDOD5HVSXHVWDLQPXQH OD YDULDFLyQ JHQyPLFD GHO HIV constituye –entre muchos
otros– también un impedimento para lograr un inmunógeno capaz
de inducir una respuesta protectora contra los diferentes epítopes
de los distintos subtipos y formas circulantes recombinantes hasta
KR\ LGHQWL¿FDGRV /D PX\ UHFLHQWH LGHQWL¿FDFLyQ GH HStWRSHV ORFDOL]DGRVHQODVHVStFXODVGHODHQYROWXUDYLUDO FRUUHVSRQGLHQWHV
–SRUHMHPSOR– al sitio de unión al receptor CD4, o al de unión a
correceptores del virus, así como a regiones variables de los bucles
loops GHODJOLFRSURWHtQDGHHQYROWXUDJSDXQQXHYRHStWRSH
VXSHUSXHVWR DO VLWLR GH XQLyQ D &' \ D XQ GRPLQLR H[WHUQR GH
JS TXHLQGXFHQ VyORHQXQPtQLPRSRUFHQWDMHGHODSREODFLyQ
infectada con +,9 ODIRUPDFLyQGHanticuerpos neutralizantes de
DOWDD¿QLGDG\DPSOLDUHDFWLYLGDGFRQDGHFXDGDSRWHQFLDFRQWUD
cepas del +,9¿ORJHQpWLFD\DQWLJpQLFDPHQWHGLVWDQWHVDEUHXQD
QXHYDSHUVSHFWLYDSDUDODHODERUDFLyQGHXQDSUy[LPDvacuna contra dicho virus, así como para el desarrollo de anticuerpos monoclonales, potencialmente útiles como SUR¿OD[LVSDVLYD
3.1.2. Mecanismos de neutralización
La QHXWUDOL]DFLyQVHGH¿QHFRPRODSpUGLGDGHODLQIHFWLYLGDGFDXsada por los anticuerpos.
El mecanismo de QHXWUDOL]DFLyQYLUDOQRVHFRQRFHFRQH[DFWLWXG
SHURODLQWHUDFFLyQYLUXVDQWLFXHUSRSXHGHDFWXDUHQXQRRPiVGHORV
VLJXLHQWHVSDVRVGHODUHSOLFDFLyQ LQKLELHQGRODDGVRUFLyQGHOYLULyQ
DUHFHSWRUHVRFRUUHFHSWRUHVFHOXODUHVORFXDOLPSLGHODSHQHWUDFLyQ
LQKLELHQGRODGHFDSVLGDFLyQ SURYRFDQGRODOLVLVLQPXQHGHORV
virus envueltos mediante DQWLFXHUSRV\&DFWLYDGRSRUODYtDFOiVLFD
SURPRYLHQGR OD DJUHJDFLyQ YLUDO SDUD IDYRUHFHU OD FDSWDFLyQSRU
FpOXODVIDJRFtWLFDVFRQUHFHSWRUHVSDUD)F\ LQKLELHQGRODIXVLyQ
entre la envoltura de los virus que la poseen y la membrana endosoPDO ORTXHLPSLGHODXOWHULRUOLEHUDFLyQGHODVULERQXFOHRSURWHtQDVDO
FLWRVRO ODUHSOLFDFLyQYLUDO PHGLDQWHHOGLVSDURGHVHxDOHVFHOXODUHV y posiblemente su liberación y propagación célula-célula mediante
impedimentos estéricos. En los casos en que la célula fuere infectada,
los anticuerpos también pueden participar en la citólisis inmune o en
la HOLPLQDFLyQYLUDOSRUPHFDQLVPRVPHGLDGRVSRU)F
)LJXUD,QWHUDFFLyQHQWUHODSURWHtQDGHVXSHU¿FLH93GHURWDYLUXV\HOIUDJPHQWR)DEGHXQDQWLFXHUSRPRQRFORQDOQHXWUDOLzante. A.&ULRHOHFWURPLFURVFRStDGHOVHURWLSR*GHOURWDYLUXVGHOPRQR5KHVXV6HREVHUYDQODVSURWHtQDVLQWHUQDV 93\93 \ODVGH
VXSHU¿FLH 93TXHJHQHUDSRUFOLYDMH93\93\93 /DEDUUDLQGLFDQPB.'LDJUDPDGHODHVWUXFWXUDSULPDULDGH93LQFOX\HOD
VHFXHQFLDVHxDO DD \GRVGRPLQLRV ,\,, HQHOPLVPRFRORUTXHHQOD¿JXUD&/RVH[WUHPRV&\1WHUPLQDOGHVRUGHQDGRVHQOD
HVWUXFWXUDFULVWDORJUi¿FDVHREVHUYDQHQJULVRVFXUR6HLQGLFDQWDPELpQODVSRVLFLRQHVDPLQRDFtGLFDVGHORVSXHQWHVGLVXOIXURTXHRFXUUHQHQWUHUHVLGXRVGHFLVWHtQDHQODPLVPDFDGHQDSHSWtGLFDC.'LDJUDPDGHODHVWUXFWXUDWULPpULFDGH93FRPRVLVHREVHUYDUDVREUH
ODVXSHU¿FLHGHODSDUWtFXODYLUDO6yORXQDPROpFXODHVWiFRORUHDGDHQDPDULOOR GRPLQLR, \HQQDUDQMD GRPLQLR,,HQOiPLQDSOHJDGD 'RV
EROLOODVFRORUHDGDVHQD]XOLQGLFDQORVLRQHVGH&D++D.,QWHUDFFLyQHQWUH93\HOIUDJPHQWR)DEGHXQD,JFRQDFWLYLGDGQHXWUDOL]DQWH
mostrando la interfase entre ambos y los iones de Ca++XQLGRVDODSURWHtQDYLUDO(QURMRVHREVHUYDODFDGHQDOLYLDQD / \HQFHOHVWHOD
SHVDGD + 6HLQGLFDQORVDPLQRiFLGRVYLQFXODGRVFRQODLQWHUDFFLyQFRQORVLRQHV&D++(ODQWLFXHUSRDWUDYLHVDODLQWHUIDVHGHODHVWUXFWXUDWULPpULFDHVWDELOL]iQGRODHLPSLGHHOGHVQXGDPLHQWRIXQGDPHQWRGHODQHXWUDOL]DFLyQGHHVWHYLUXV)XHQWH$RNL67et al.; Science
5HSURGXFLGRFRQDXWRUL]DFLyQ
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
El mecanismo de neutralización que impide la decapsidación
del rotavirus fue recientemente dilucidado al conocerse la estrucWXUDFULVWDORJUi¿FDGHODLQWHUDFFLyQHQWUHODJOLFRSURWHtQDGHVXSHU¿FLH93GHOURWDYLUXV\HODQWLFXHUSRHVSHFt¿FR6HVDEtDTXH
el virus requiere la pérdida de la estructura trimérica de dicha gliFRSURWHtQD SUREDEOHPHQWHFRPRFRQVHFXHQFLDGHODUHPRFLyQGH
iones Ca++ SDUDJDWLOODUHODQFODMHGHODRWUDSURWHtQDGHVXSHU¿FLH
93 HQODVXSHU¿FLHFHOXODU\SURPRYHUFDPELRVFRQIRUPDFLRnales en ésta que faciliten la subsiguiente unión a las membranas
HQGRVRPDOHV(OIUDJPHQWR)DEPRQRYDOHQWHGHXQDQWLFXHUSRPRQRFORQDOGLULJLGRFRQWUD93HVVX¿FLHQWHSDUDQHXWUDOL]DUDOYLUXV
6HXQHDODHVWUXFWXUDWULPpULFDGH93HVWDELOL]iQGROD DXQDQWH
EDMDVFRQFHQWUDFLRQHVGH&D++TXHSURPRYHUtDQODGLVRFLDFLyQ H
LPSLGLHQGRHOVXEVLJXLHQWHLQLFLRGHUHSOLFDFLyQ )LJXUD (O SULPHU SDVR HV OD XQLyQ GHO DQWLFXHUSR D OD VXSHU¿FLH GHO
virión, seguido de un cambio conformacional en ambos reactivos.
/DVXSHU¿FLHYLUDOSRVHHHVWUXFWXUDVLQGLVSHQVEOHVSDUDPDQWHQHUOD
infectividad de las partículas, denominadas sitios críticos y otras,
importantes para mantener la integridad estructural que se denominan sitios "no críticos". Algunos virus poseen un sólo sitio críWLFR EDFWHULyIDJR 7 RWURV SRVHHQ P~OWLSOHV VLWLRV LQÀXHQ]D \
HQRWURVWRGDODVXSHU¿FLHVHFRQVLGHUDFUtWLFDSDUDODLQIHFWLYLGDG
YLUXVPRVDLFRGHOWDEDFR Los sitios críticos son los blancos para los anticuerpos neutralizantes y su número, tamaño y localización en el virión tienen
importancia en la reacción de QHXWUDOL]DFLyQ6LHODQWLFXHUSRHVWi
dirigido contra un sitio no crítico, cuando aquél se una al virión,
pVWHUHWHQGUiVXLQIHFWLYLGDG
$FWXDOPHQWHVHHVWiQGHVDUUROODQGRQXPHURVDVvacunas compuestas por subunidades del virión. Para que estas vacunas sean
HIHFWLYDVGHEHUiQFRQWHQHUHOVLWLRFUtWLFRSDUDODLQGXFFLyQGHantiFXHUSRVQHXWUDOL]DQWHV3DUDHOYLUXVLQÀXHQ]D$VHREVHUYyTXHHV
fundamental mantener la integridad antigénica de dos glicoproteínas de envoltura, la hemaglutinina y la QHXUDPLQLGDVDHQHOYLUXV
FDXVDQWHGHOD¿HEUHDIWRVD YLUXVTXHDIHFWDQDOJDQDGR VyORXQD
GHODVFXDWURSURWHtQDVGHODFiSVLGH 93 HVLPSRUWDQWHHQODLQducción de anticuerpos neutralizantes.
Cuando los anticuerpos neutralizantes se unen a las partículas virales se produce una agregación de las mismas y por lo tanto se disminuye
161
la infectividad. Por ello, la agregación es un mecanismo de neutralización, aunque esto es dependiente de muchos factores, tales como concentración viral, tamaño de la partícula, tipo de anticuerpos, etc.
(QDOJXQDVRFDVLRQHV SRUHMHPSORHQHOVXHURGHHWDSDVWHPpranas de la infección, conteniendo DQWLFXHUSRVGHEDMDD¿QLGDG HV
posible disociar las partículas y recuperar la infectividad. En otros
casos, puede persistir la infectividad: es la fracción persistente aún
HQSUHVHQFLDGHH[FHVRGHDQWLFXHUSRV anticuerpos no neutralizanWHV KHFKRTXHVHDWULEX\HDGLYHUVRVIDFWRUHVFRPRDJUHJDGRVGH
partículas, DQWLFXHUSRVGHEDMDD¿QLGDGRIDFWRUHVHVWpULFRV(VWDV
fracciones persistentes se observan en pacientes infectados con
HBV o con EBV.
([LVWHQ factores accesorios en la QHXWUDOL]DFLyQ YLUDO TXH
ayudan a los anticuerpos en dicha función. Dentro de ellos, el
más importante es el C, debiéndose mencionar también los denominados factores reumatoideos.
El C al unirse a los anticuerpos, a su vez unidos a una partícula
YLUDOSXHGHSURGXFLUXQDYLUyOLVLVLQPXQH )LJXUD RELHQ
SXHGHSURYRFDUDOWHUDFLRQHVHQODVXSHU¿FLHGHODVSDUWtFXODV\R
DJUHJDFLyQGHODVPLVPDV/DVSDUWtFXODVRSVRQL]DGDV GHOJULHJR
opsonFRQGLPHQWRDGRER \DJUHJDGDVVRQPiVIiFLOPHQWHIDJRcitadas por los macrófagos. De allí la denominación de opsoninas
FRQTXH6LU$OPURWK:ULJKWGHQRPLQyHQDORVanticuerpos
que preparaban las bacterias como un alimento para las células
fagociticas, las que incrementaban asombrosamente su actividad
en presencia de aquéllos. Ese descubrimiento sentó nuevas bases
para establecer la estrecha vinculación entre la respuesta innata y
la adaptativa.
Los anticuerpos antivirales, unidos a las membranas de las
FpOXODVTXHH[SUHVDQDQWtJHQRVYLUDOHVWDPELpQSXHGHQDFWLYDU
el C, y como consecuencia, lisar las células infectadas.
El sistema del C puede ser activado por la vía clásica: las
células infectadas cubiertas con anticuerpos promueven la activación
GH&\VXEVLJXLHQWHPHQWHODFDVFDGDGHIHQyPHQRVGHFOLYDMHHQ]LPiWLFRTXHFXOPLQDQFRQODIRUPDFLyQGHXQJUDQFRPSOHMRPXOWLPROHFXODU &&&&\& Sin embargo, la lisis celular no
se produce si la vía de activación alternativa del C está alterada,
indicando la incapacidad de la vía clásica para lisar las mismas
per se. Los anticuerpos no son requeridos para la activación por la
Figura 7.24. Disrupción de una partícula del virus de la corimeningitis linfocitaria (LCM) mediante anticuerpos y complemento.
Imagen histórica de microscopía electrónica de una partícula tratada con: A.VXHURQRUPDOFRQWUROB.VXHURGHFRED\RFRQWHQLHQGR
DQWLFXHUSRVDQWL/&0HLQDFWLYDGRSRUFDOHQWDPLHQWRDž&GXUDQWHPLQ HOLPLQDODDFWLYLGDGGHOVLVWHPDFRPSOHPHQWR C-F.VXHURGH
cobayo conteniendo DQWLFXHUSRVDQWL/&01yWHVHODKLQFKD]yQ\UXSWXUDGHODHVWUXFWXUDGHOYLULyQWUDWDGRFRQDQWLFXHUSRVHVSHFt¿FRV\
FRPSOHPHQWR/DVÀHFKDVLQGLFDQORVVLWLRVGHGLVUXSFLyQGHODHQYROWXUDYLUDOGHVGHGRQGHVHOLEHUDPDWHULDOGHO&RUH)XHQWH:HOVKet
alVirology
162
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
YtDDOWHUQDWLYDGHO&6LQHPEDUJRSDUDGyMLFDPHQWHOD,J*SRGUtD
SDUWLFLSDUHQHVWHVLVWHPDDXPHQWDQGRHOGHSyVLWRGH&EVREUHOD
VXSHU¿FLHFHOXODUORFXDOJHQHUDUtDPiVVLWLRVSDUDHOFOLYDMHGH&\
HOSRVWHULRUHQVDPEOHHLQVHUFLyQGHOFRPSOHMR&EFRQODFRQVLJXLHQWHOLVLVFHOXODU$HVWHIHQyPHQRVHVXPDODUHVSXHVWDLQÀDPDtoria producida por diversos factores que se liberan en la activación
GHO& IDFWRUHVTXLPLRWiFWLFRVDQD¿ORWR[LQDVHWF HODXPHQWRGHOD
fagocitosis, y la presencia de células NK, entre otros.
1RH[LVWHUHODFLyQGH¿QLGDHQWUHVXEFODVHVGH,JV\SURWHFFLyQ
contra la infección viral en el SNC. Mientras que en la infección
H[SHULPHQWDO FRQ HO YLUXV FRULRPHQLQJLWLV OLQIRFLWDULD /&0 OD
SURWHFFLyQVHFRQ¿HUHPHGLDQWHOD,J*DHQODLQIHFFLyQFRQYLUXVUDELDSXHGHFRQIHULUVHHVDSURWHFFLyQPHGLDQWH,J*,J*D
R,J*E
Importancia de los anticuerpos pre-existentes
Espacialidad
La presencia previa de anticuerpos neutralizantes contra un determinado virus puede proteger contra los efectos de una reinfección
XQDQXHYDHQIHUPHGDG SRUGLFKRDJHQWH6LQHPEDUJRHOORQRHV
DVtSRUHMHPSORVLHOYLUXVHVFDSD]GHYDULDUVXHVWUXFWXUDH[WHUna o de ingresar a un nuevo organismo vehiculizado en el interior
GHRWUDVFpOXODV FRPRRFXUUH±SRUHMHPSOR±HQODWUDQVPLVLyQGHO
+,9OXHJRGHXQDUHODFLyQVH[XDO /RVanticuerpos preformados
no necesariamente previenen la reinfección, y tal vez la diseminación, desde una mucosa epitelial, pero sí limitan la diseminación
distal a órganos blanco claves en la patogénesis de la enfermedad.
La comprensión de este evento es crucial para entender las
UD]RQHVGHODH¿FDFLDGHFLHUWDVvacunas utilizadas para prevenir
infecciones sistémicas como las producidas por los virus polio y
sarampión.
En contraposición, en aquellas patologías en las que la enfermedad es consecuencia de la afectación del epitelio de una mucosa
DOSURGXFLUVHH[FOXVLYDPHQWHDOOtODUHSOLFDFLyQYLUDOODSURWHFFLyQ
conferida por los anticuerpos depende del nivel que tengan en
GLFKDVXSHU¿FLH(OPLVPRHVSRWHQFLDOPHQWHGHSHQGLHQWHGHORV
SODVPRFLWRVTXHVHFUHWDQ,JVHQHOODGHODHYHQWXDOH[LVWHQFLDGH
HOHYDGRVQLYHOHVVpULFRVGH,JVTXHVHGHUUDPDQ H[WUDYDVDQ D
WUDYpVGHODVXSHU¿FLHPXFRVDRGHOWUDQVSRUWHDFWLYRGH,J$HVSHFt¿FDDWUDYpVGHODPLVPD
Neutralización viral intracelular
<DKDVLGRPHQFLRQDGRTXHODneutralización ocurre habitualmente
cuando DQWLFXHUSRVGLULJLGRVFRQWUDVLWLRVFUtWLFRVGHODVXSHU¿FLH
viral reaccionan contra ellos inhibiendo la infectividad viral.
Sin embargo, en años recientes, un nuevo capítulo ha sido
abierto ante la posibilidad de que anticuerpos pudieran actuar no
VyORHQHVSDFLRVH[WUDFHOXODUHVVLQRWDPELpQHQHOLQWHULRUFHOXODU
Este evento fue inicialmente documentado in vitro en células
de neuroblastoma infectadas con virus rabia, y luego tratadas con
XQ DQWLFXHUSR PRQRFORQDO HVSHFt¿FR ±SHUR QR FRQ RWURV± OR TXH
SURPRYLyOD¿QDOL]DFLyQGHODSURGXFFLyQGHYLUXVSUHFHGLGDSRU
una inhibición de la síntesis proteica viral. Esta inhibición ocurre a
nivel de la transcripción del RNA viral, lo cual sugiere un efecto de
restricción de la H[SUHVLyQJpQLFD2WURVHVWXGLRVin vitro realizaGRVHQODGpFDGDGHXWLOL]DQGRFXOWLYRVGHFpOXODVGHJOLREODVtoma persistentemente infectadas con virus sarampión que fueron
tratados con DQWLFXHUSRVHVSHFt¿FRVSROLFORQDOHVKDQGHPRVWUDGR
una inhibición de la síntesis viral. El virus induce un aumento de
la fosforilación proteica celular mediada por la proteína quinasa C
3.& ODTXHHVQHFHVDULDSDUDVXUHSOLFDFLyQ6LGLFKDHQ]LPDHV
LQKLELGDPHGLDQWHIiUPDFRVODSURGXFFLyQGHSURJHQLHYLUDOOLEHUDGDGLVPLQX\H(QIRUPDDQiORJDHOtratamiento de los cultivos con
anticuerpos policlonales anti-virus sarampión limita la replicación
viral, mediante la inhibición de la PKC. No se ha establecido aún si
HVWHHIHFWRDQWLYLUDOHVHMHUFLGRDWUDYpVGHODLQWHUDFFLyQHQWUHODV
SURWHtQDVYLUDOHVGHVXSHU¿FLH±TXHDFWXDUtDQFRPRreceptor– y los
DQWLFXHUSRVHVSHFt¿FRV±TXHSURYHHUtDQXQDVHxDOH[WHUQD±RVLOD
DFFLyQGHHVWRV~OWLPRVVHSURGXFHUHFLpQGHVSXpVGHVX HYHQWXDO internalización.
Este evento cobra especial relevancia in vivo cuando en una
misma célula cohabitan proteínas virales e inmunoglobulinas. Ello
RFXUUHSRUHMHPSORFXDQGRHQHOLQWHULRUGHXQDFpOXODHSLWHOLDOGH
una mucosa se sintetizan proteínas virales, al tiempo que transitan
Figura 7.25. Localización de la gammaglobulina hiperinmune anti-hepatitis B (HBIG) y de proteínas del HBV en células HepAD38
transfectadas en forma estable e inducible con el genoma viral.
/D VtQWHVLV GH GLFKDV SURWHtQDV YLUDOHV VyOR DFRQWHFH DO UHPRYHUVH
HO UHSUHVRU WHWUDFLFOLQD GHO PHGLR GH FXOWLYR \D TXH VX SUHVHQFLD
LQKLEHODDFWLYLGDGGHOSURPRWRUGHOFXDOGHSHQGHODVtQWHVLVGH51$
SUHJHQyPLFRYLUDO$OGtDODVFpOXODV+HS$'WUDWDGDVFRQ+,%*
VH¿MDURQ\SURFHVDURQPHGLDQWH,)/DVFpOXODVVHLQFXEDURQFRQanWLFXHUSRVDQWL3UH6GHO+%9VHJXLGRGHOtratamiento con DQWLFXHUSRVDQWL,*VKXPDQDVFRQMXJDGDVFRQÀXRUHVFHtQD\FRQDQWLFXHUSRV
PRQRFORQDOHVDQWL,*VGHUDWyQFRQMXJDGRVFRQ5RMRGH7H[DVA. La
captación de +%,* ÀHFKDV HQHOFLWRSODVPDGHODVFpOXODVWUDWDGDV
con +%,*VHGHWHFWDPHGLDQWHWLQFLyQÀXRUHVFHQWHB./DVFpOXODVQR
tratadas con +%,*QRH[KLEHQLPiJHQHVÀXRUHVFHQWHVDQWHLGpQWLFDV
FRQGLFLRQHVGHFDSWXUDGHLPiJHQHVDODVGHOFXDGUR$C y D. El
depósito de +%,*RODH[SUHVLyQGH3UH6VHREVHUYDQ–respectivamente– HQ FDGD FXDGUR HQ HO FLWRSODVPD GH ODV PLVPDV FpOXODV
LQGLFDGDV SRU ÀHFKDV E. /D VXSHUSRVLFLyQ GH LPiJHQHV REWHQLGDV
PHGLDQWHODVGRVÀXRURVRQGDV ÀHFKDV FRQ¿UPDODFRORFDOL]DFLyQGH
ODSURWHtQDYLUDO\HODQWLFXHUSRDQWL+%VF. Detección de la proteína
del Core de +%9PHGLDQWHDQWLFXHUSRVSROLFORQDOHV/DVÀHFKDVLQGLFDQODVVHxDOHVSRVLWLYDVHQFDGDFXDGUR&RPRUHVXOWDGRGHHVWD
interacción ente las proteínas virales y los DQWLFXHUSRV HVSHFt¿FRV
DQWL+%V VH SURGXFH XQD QHXWUDOL]DFLyQ LQWUDFHOXODU TXH GLVPLQX\H
VLJQL¿FDWLYDPHQWHODOLEHUDFLyQGH+%V$JDOPHGLRH[WUDFHOXODU)XHQWH6FKLOOLQJet alJournal of Vrology 5HSURGXFLGR
FRQDXWRUL]DFLyQ
163
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
KDFLDODVXSHU¿FLHFHOXODUPROpFXODVGH,JV SRUHMHPSOR,J$ (Q SHTXHxRVGHXQDQWtJHQRGHWHUPLQDGR SRUHMHPSORXQEROVLOORHQeste evento de transcitosis, estos anticuerpos pueden interactuar – ]LPiWLFRRYDOOHVKHQGLGRVHQWUHH[WUHPRVSURWUX\HQWHVGHSURDXQFRQGHWHUPLQDQWHVDQWLJpQLFRVGHVLWLRVQRFUtWLFRVSRUHMHP- WHtQDVHWF 6XHVWUXFWXUDHVPiVVLPSOH\PiVSHTXHxDTXHODGH
plo, de proteínas internas o bien no estructurales– lo que puede ORVVF)Y N'D \DTXHVRQPXFKRPiVKLGURItOLFRVSRUOR
conducir a la perturbación de la replicación viral, impidiendo la que son más solubles y su expresión aumentada y más estable
síntesis de la progenie. Ello ha sido demostrado en infecciones ta- en sistemas heterólogos. Estos intracuerpos VHH son construcles como las producidas por rotavirus en el epitelio intestinal, la FLRQHV H[SHULPHQWDOHV TXH XWLOL]DQ OODPDV FDPpOLGRV LQPXQL]Dque es inhibida por anticuerpos IgA dirigidos contra proteínas de das –en el caso arriba mencionado, lo fueron con HBsAg– para
ODFiSVLGHLQWHUQD 93\93 RODGHOYLUXVVDUDPSLyQGRQGHOD JHQHUDUXQDELEOLRWHFDJHQpWLFDTXHFRGL¿FDDQWLFXHUSRVHVSHFt¿IgA puede participar tanto en la neutralización intracelular como FRVDH[SUHVDUVH H[SRQHUVH PHGLDQWHLQJHQLHUtDGHSURWHtQDVHQ
HQODH[FOXVLyQLQPXQHDOLQJUHVRYLUDODODFpOXOD\HQODH[FUHFLyQ EDFWHULyIDJRV ¿ODPHQWRVRV PHWRGRORJtD FRQRFLGD FRPR phage
viral, dependiendo de la proteína viral sobre la que actúa dicha IgA display". Los VHH han sido exitosamente probados in vitro e in
vivoSRUSULPHUDYH]HQHQPDPtIHURVTXHH[SHULPHQWDOSURWHtQDV+1R) Asimismo, se ha demostrado in vitro que diversas líneas hepatocita- mente expresan HBV, KDELpQGRVHORJUDGRXQDUHGXFFLyQGH
rias humanas poseen receptores para IgG, la que luego de ser endocitada, YHFHVGHORVQLYHOHVGHYLUHPLD(VWRVKDOOD]JRVFRQVWLWX\HQ
FRORFDOL]DFRQDQWtJHQRVGHVXSHU¿FLHGHOYLUXV +%V$J SURPRYLHQGR una promisoria herramienta a evaluar entre los potenciales futuros
su QHXWUDOL]DFLyQLQWUDFHOXODU/DLQWHUDFFLyQHQWUHHO+%V$JVDOYDMH ensayos terapéuticos en individuos infectados por HBV.
\OD,JKLSHULQPXQHHVSHFt¿FDDQLYHOLQWUDKHSDWRFLWRHVWiDVRFLDGDDOD Temporalidad
HPHUJHQFLDGHYDULDQWHVGHHVFDSH +%V$JPXWDGR DGLFKRVanticuer- /DH[LVWHQFLDGHanticuerpos neutralizantes preformados tiene obpos. Este hallazgo tiene especial relevancia en la emergencia de varian- vias implicancias en la prevención de la enfermedad, tal como se
tes mutadas ante situaciones médicas tales como la SUR¿OD[LVFRQWUDOD H[SOLFyDQWHULRUPHQWH
En una infección determinada los DQWLFXHUSRVHVSHFt¿FRVHVWiQ
KHSDWLWLV%HQLQGLYLGXRVWUDVSODQWDGRV )LJXUD Como consecuencia del interés por estudiar la replicación viral ausentes en la etapa previa a la seroconversión y pueden desapare\FRQVLJXLHQWHPHQWHGH¿QLUQXHYDVHVWUDWHJLDVSDUDVXLQKLELFLyQ FHUFRQHOGHYHQLUGHOWLHPSR VHURUUHYHUVLyQ La producción de anticuerpos por períodos prolongados puede
VH GHVDUUROODURQ DSUR[LPDFLRQHV GH inmunización intracelular
mediante el uso de fragmentos variables de cadena única de las ocurrir en presencia o ausencia de estímulos diversos. Entre los esIgs o scFv Single-Chain Variable Fragment (VWDVVRQPROpFX- WtPXORVFRQRFLGRVGHEHQPHQFLRQDUVHD ODUHH[SRVLFLyQDOYLUXV
las correspondientes al dominio variable de la cadena liviana de un E ODSHUVLVWHQFLDGHODLQIHFFLyQHQFpOXODVIROLFXODUHVGHQGUtWLFDV
anticuerpo, unido mediante un péptido corto al dominio variable F ODUHDFFLyQFUX]DGDFRQDQWtJHQRVSURSLRVRGHOPHGLRDPELHQWH
de la cadena pesada, por lo cual pueden interactuar con antígenos \G ODVUHGHVLGLRWtSLFDV$XQHQDXVHQFLDGHHVWtPXORVDQWLJpQLHVSHFt¿FRV OXHJR GH H[SUHVDUVH VHJ~Q OD FRQVWUXFFLyQ JHQpWLFD cos, la duración de los plasmocitos en la médula ósea coadyuva a la
XWLOL]DGD HQHO5(ODmitocondria, o el núcleo. Estos anticuerpos producción de anticuerpos por períodos prolongados.
(QOD7DEODVHLQGLFDODGXUDFLyQGHODinmunidad humoral
intracelulares de cadena única (construidos en el laboratorio)
TXHVHH[SUHVDQ\IXQFLRQDQGHQWURGHXQDFpOXODVHGHQRPL- conferida por algunos DQWLFXHUSRVHVSHFt¿FRVGLULJLGRVFRQWUDFLHUnan intracuerpos. Han sido evaluados en la inhibición in vitro tos virus causantes de infecciones agudas.
Sin embargo, GHEHWHQHUVHHQFXHQWDTXHVLELHQODSUHVHQde virus tales como HIV, HCV, HBV, +39LQÀXHQ]DKHUSHVYLUXV
ÀDYLYLUXV\URWDYLUXV(QSRUYH]SULPHUDVHGRFXPHQWyOD cia de DQWLFXHUSRVHVSHFt¿FRVSUHH[LVWHQWHVHVPX\LPSRUWDQWH
utilización de una nueva generación de intracuerpos TXHUHFR- para la prevención de los efectos de las reinfecciones (o subnocen dominios únicos y son denominados VHH. Corresponden siguientes infecciones si se tratara de la respuesta generada a
a la fracción variable de la cadena pesada de un anticuerpo con- través de la inmunización activa), más aún lo es la presencia
YHQFLRQDO FDUHFHQGHFDGHQDOLYLDQD \VRQFDSDFHVGHUHFRQRFHU de linfocitos B de memoria.9DOJDPHQFLRQDUFRPRHMHPSORGH
DGLIHUHQFLDGHORVDQWLFXHUSRVFRQYHQFLRQDOHV ORVGRPLQLRVPiV ello, los menores títulos de anticuerpos anti-polio generados por
Ejemplo
Familia viral
Duración en años
Duración en meses
INFECCIONES AGUDAS SISTÉMICAS INTRODUCIDAS POR VÍA PARENTERAL
'HQJXH
Flaviviridae
32
Fiebre amarilla
Flaviviridae
75
INFECCIONES AGUDAS SISTÉMICAS INTRODUCIDAS POR VÍA MUCOSA
Sarampión
Paramyxoviridae
65
Parotiditis
Paramyxoviridae
12
Polio
Picornaviridae
40
+HSDWLWLV$
Picornaviridae
25
5XEpROD
Togaviridae
14
Vaccinia
Poxviridae
15
9LUXHOD
Poxviridae
40
INFECCIONES AGUDAS DE LAS MUCOSAS ENTÉRICA O RESPIRATORIA
,QÀXHQ]D
Orthomyxoviridae
30
9LUXVVLQFLFLDOUHVSLUDWRULR
Paramyxoviridae
3
5RWDYLUXV
Reoviridae
12
Tabla 7.9. Duración de la respuesta inmune humoral a infecciones agudas virales en el ser humano.
164
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
la vacuna inactivada Salk, respecto a los inducidos por la vacuna
atenuada Sabin. Sin embargo, el efecto protector generado por la
primera es absoluto, tal como se documentó en los países escandinavos, donde fue utilizada como única fuente vacunal para erradiFDUODFLUFXODFLyQGHOYLUXVSROLRVDOYDMHFRQXQp[LWRWRWDO
(QPRGRDQiORJRHQQXHVWURVGtDVODDSOLFDFLyQGHODvacuna
para prevenir la hepatitis B genera en individuos respondedores
DQWLFXHUSRVDQWLDQWtJHQRGHODVXSHU¿FLHYLUDO DQWL+%V 6LGLFKR
WtWXORHVLJXDORVXSHULRUD8,OVHFRQVLGHUDSURWHFWRU6LQHPbargo, en aquellos individuos que hubieran respondido a la vacuna
FRQWtWXORVVXSHULRUHVDOPHQFLRQDGRYDORU\TXHH[KLEHQFRQHO
GHYHQLUGHOWLHPSRXQDGLVPLQXFLyQGHORVPLVPRVSRUGHEDMRGH
8,OQRQHFHVLWDQODDGPLQLVWUDFLyQGHXQDGRVLVGHUHIXHU]R
GHELGRDODREVHUYDFLyQGHTXHODPHPRULDLQPXQROyJLFDHVVX¿ciente para promover una nueva respuesta secundaria protectora.
(QOD7DEODVHLQGLFDQDOJXQRVHMHPSORVGRQGHODDGPLQLVWUDFLyQGH,JVHVSHFt¿FDVRSODVPDFRQWHQLpQGRODVSHUPLWHSURWHger al hospedador frente a la infección viral.
3.2. INMUNIDAD CELULAR ADAPTATIVA
Diversos factores generales tales como el número de LT que participan de la respuesta inmune (respuesta fuerte o débil), el núPHURGHHStWRSHVUHFRQRFLGRV UHVSXHVWDPXOWLHVSHFt¿FDXROLJR
RPRQRHVSHFt¿FD , la funcionalidad y la duración de dicha respuesta, así como la sensibilidad de los LT YpDVHPiVDGHODQWH
determinan el desenlace de una infección viral (Figura 7.26).
La mayoría de los /7PDGXURVH[SUHVDQXQ7&5ĮȕTXHUHFRQRFH
SpSWLGRV SUHVHQWDGRV HQ OD VXSHU¿FLH GH ODV &3$ D /7 &'+ mediante el CMH de clase I o a /7CD4+ mediante el CMH de clase
II. Esta última población comprende diversas células ayudadoras
7K 7helper UHJXODWRULDV 7UHJ\UHODFLRQDGDV FpOXODVGHPHPRULDDQWtJHQRHVSHFt¿FDV CD4+ CD44bright,/5ȕ+ TXHH[KLEHQ
un lento recambio y requieren ,/ SDUD VX SUROLIHUDFLyQ \ VREUHYLGD \ FpOXODV PHPRULDVtPLO CD4+ CD44hi ,/5ȕlow FX\D
función aún no ha sido dilucidada. A continuación, sólo se descriELUiQEUHYHPHQWHORV/7D\XGDGRUHV\UHJXODGRUHVPiVUHOHYDQWHV
y subsiguientemente, los /7&'+FRQDFWLYLGDGFLWRWy[LFD &7/ 3.2.1. Linajes de LT CD4+ de ayuda
+DVWDHOSUHVHQWHVHUHFRQRFHQGLYHUVRVOLQDMHVGHQWURGHHVWDSRblación: son las células 7K7K7K\7UHJ$VLPLVPRRWUDV
VXESREODFLRQHVFRPRODV7IK7K7U\7KKDQVLGRSURSXHVWDV
DXQTXHVHLQYHVWLJDVLVRQ±HQUHDOLGDG±VXEOLQDMHVGHDOJXQDVGH
ODVFXDWURPHQFLRQDGDVSUHFHGHQWHPHQWH )LJXUD /DVFpOXODV
CD4+ participan en la colaboración que los /7 EULQGDQ D ORVLB
para la producción de DQWLFXHUSRV OD PDGXUDFLyQ GH OD D¿QLGDG
GHORVPLVPRV\ODUHDOL]DFLyQGHOFDPELRLVRWuSLFR,J0ĺ,J*
también reclutan y activan &7/ &'+ PDFUyIDJRV QHXWUy¿ORV
HRVLQy¿ORVEDVy¿ORV\RWUDVFpOXODVHIHFWRUDV
(Q &RIIPDQ \ 0RVPDQQ HVWDEOHFLHURQ OD H[LVWHQFLD GH
dos poblaciones de /7GHD\XGDORV7K\ORV7KLas células
Th1 producen ,)1Ȗ, relevante para activar macrófagos y limitar
las infecciones por patógenos intracelulares como los virus. Las
células Th2 se asocian a la producción de, IL-4. IL-5, IL-10 e
IL-13. Esta subpoblación colabora en la producción de IgE, el reFOXWDPLHQWRGHHRVLQy¿ORV\HVLPSRUWDQWHSDUDOLPLWDUODVLQIHFFLRQHVSRUSDWyJHQRVH[WUDFHOXODUHV$QWHHOGHVFXEULPLHQWRGHTXHOD
,/FRQVWDGHXQDVXEQLGDGFRP~QDOD,/ S VHHVWDEOHFLy
que algunas enfermedades inicialmente atribuidas a la participación de la población 7KHUDQHQUHDOLGDGPHGLDGDVpor células
TXH UHVSRQGtDQ D OD ,/ FRQVWLWX\HQGR XQD QXHYD HVWLUSH
la de los LTh17. Estas células producen IL-17a, IL-17f, IL-21
e IL-22.$GHPiVGHOUROHQHQIHUPHGDGHVDXWRLQPXQHVHVWRV/7
SDUWLFLSDQ HQ OD UHVSXHVWD LQPXQH FRQWUD EDFWHULDV H[WUDFHOXODUHV
y hongos.
Las células 7UHJWLHQHQODFDSDFLGDGGHOLPLWDUODUHVSXHVWD7
evitando fenómenos autoinmunitarios, promover la tolerancia a los
antígenos propios y –en ciertas circunstancias– inducir la respuesta
LQPXQH (Q HVWD SREODFLyQ VH FRQVLGHUDQ JUXSRV ODV7UHJ QDWXUDOHVTXHSURYLHQHQGHOWLPR FpOXODVCD4+&'+)R[3+ que
HJUHVDQGHHVWDJOiQGXODFRQGLFKDFDSDFLGDG \ODV7UHJXODWRULDV
inducibles 7K\7U TXHDQWHHOFRQWDFWRFRQHODQWtJHQRHQORV
yUJDQRVOLQIiWLFRVVHFXQGDULRVDGTXLHUHQGLFKRSRWHQFLDO /DVFplulas CD4+&'+)R[3+ HMHUFHQVXHIHFWRPHGLDQWHHOFRQWDFWR
GLUHFWR FRQ ODV FpOXODV 7 HIHFWRUDV 7K 7K \ &'+ PLHQWUDV
que las 7KORKDFHQPHGLDQWHODVHFUHFLyQGH7*)ȕ\ODV7UPHGLDQWHODOLEHUDFLyQ IXQGDPHQWDO GH,/\WDPELpQGH7*)ȕ
6HKDGRFXPHQWDGRTXHHVWRVSULQFLSDOHVOLQDMHVGH/7H[SUHVDQ
IDFWRUHVGHWUDQVFULSFLyQHVSHFt¿FRV )LJXUD (QFRQWUDSRVLción, las estirpes 7K7U7K\7IKFDUHFHQGHXQSHU¿OSURSLRGH
producción de citoquinas, al tiempo que también utilizan algunos
GH ORV IDFWRUHV WUDQVFULSFLRQDOHV GH ORV OLQDMHV7K7K7K \
7UHJSRUORFXDOD~QQRVHKDHVWDEOHFLGRVLFRUUHVSRQGHQDVXESRblaciones de éstas, o si son estirpes celulares disímiles.
LTh3. La tolerancia inmunológica oral se asocia a células proGXFWRUDV GH 7*)ȕ FRQ IHQRWLSR CD4+ LAP+ Latency Associated
PeptideSpSWLGRDVRFLDGRDODODWHQFLDDOFXDOVHXQHQHQODVXSHU¿-
Figura 7.26. Evolución de una infección viral en función de la respuesta inmune antiviral mediada por /7FLWRWy[LFRVHVSHFt¿FRV
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
FLHGHODPHPEUDQDSODVPiWLFDPROpFXODVGH7*)ȕ &'- designadas 7K6LQHPEDUJRODPD\RUtDGHODV7UHJVDFWLYDGDVSURGXFH
GLFKDFLWRTXLQD([LVWHQFpOXODVSURGXFWRUDVGH7*)ȕTXHWDPELpQ
VLQWHWL]DQ ,/ H ,/ DXQTXH DTXHOODV TXH SURGXFHQ OD Pi[LPD
FXDQWtDGH7*)ȕQRORKDFHQ$SUR[LPDGDPHQWHXQGHODV7K
VRQ)R[3+ORTXHLPSOLFDTXHH[LVWHXQDVXESREODFLyQFRQIXQFLyQ
7UHJ\RWUDGLIHUHQWHTXHQRORHVFX\DIXQFLyQVHGHVFRQRFH
Células Tr1. 6LELHQVHDVRFLyLQLFLDOPHQWHDOD,/FRQODV
FpOXODV7KVXEVLJXLHQWHPHQWHVHFRQVWDWyTXHWDPELpQODSURGXcen células con función regulatoria CD4+ PD\RULWDULDPHQWH)R[3denominadas 7UDXQTXHWDPELpQORKDFHQRWUDV/7UHJXODWRULDV
FRQYHQFLRQDOHV )R[3+ /D,/HVWDPELpQSURGXFLGDSRUFplulas 7K \7K TXH UHJXODQ QHJDWLYDPHQWH VX SURSLD IXQFLyQ
Consiguientemente, es posible que las 7UHQUHDOLGDGVHDQUHSUHVHQWDQWHVGHXQVXEFRQMXQWRGHODV7UHJ7K7K\7KTXHOLmitan la respuesta inmune mediada por las mismas para evitar el
daño hístico.
Células Th9. Aunque la producción de IL-9 se asoció inicialmente a la respuesta 7KHVWDFLWRTXLQDHVWDPELpQSURGXFLGD
SRUODV7UHJVLQGXFLEOHV\ODV7KGHVFRQRFLpQGRVHVLORKDFHQ
también las 7K/DSURGXFFLyQGHHVWDFLWRTXLQDHQFpOXODVCD4+
QDʀYHSXHGHLQGXFLUVHPHGLDQWHODHVWLPXODFLyQGH7*)ȕH,/
ODTXHUHTXLHUHGHOIDFWRUWUDQVFULSFLRQDO*$7$
Células Tfh. 6L ELHQ LQLFLDOPHQWH VH ODV FRQVLGHUy XQ OLQDMH
VHSDUDGR QR HVWi D~Q GLOXFLGDGR VL HVWDV FpOXODV FRUUHVSRQGHQ D
un estado particular de las células 7K7KR7KRVLVHJHQHUDQ
a partir de células CD4+ QDʀYH que -ante determinados estímulosSXHGHQH[SUHVDU,)1Ȗ,/y,/DDOPLJUDUDODV]RQDVIROLFXODUHV%GHSHQGLHQWHV(VWDVFpOXODVH[SUHVDQHOHYDGRVQLYHOHVGH
%FODXQTXHVHGHVFRQRFHVLH[LVWHSDUWLFLSDFLyQGHIDFWRUHVGH
WUDQVFULSFLyQWDOHVFRPR7EHW\*$7$
Heterogeneidad y plasticidad de los LT CD4+
y modulación de la respuesta inmune
La KHWHURJHQHLGDGHVWiGDGDQRVyORSRUORVGLYHUVRVOLQDMHVVLQR
WDPELpQ SRU ORV GLIHUHQWHV SHU¿OHV GH citoquinas que cada uno de
ellos puede adquirir en sus clones constituyentes en diversas etapas
del desarrollo o en un momento determinado. La plasticidad radica
HQTXH±GHQWURGHFLHUWRVOtPLWHVORVGLYHUVRVOLQDMHVQRWRWDOmente maduros pueden virar hacia otro o hacia un fenotipo mixto )LJXUD . Esto es especialmente válido para los linajes Th1
y Th2. En contraposición, el linaje Th17 posee una capacidad
plástica superior, ya que aun las células maduras pueden estimuODUODH[SUHVLyQGHIDFWRUHVWUDQVFULSFLRQDOHVFUtWLFRVFRPR7EHW\
165
*$7$ORTXHOHVSHUPLWHODVtQWHVLVVLPXOWiQHDWDQWRGH,/FRQ
,)1ȖFRPRGH,/FRQ,/$VXYH]ODVFpOXODV7UHJVSXHGHQ
H[SUHVDU,)1ȖH,/DOSURPRYHUODVREUHH[SUHVLyQGHORVIDFWRUHVWUDQVFULSFLRQDOHVHVSHFt¿FRVGHORVPHQFLRQDGRVOLQDMHV 7EHW\
525ȖW 6HKDGRFXPHQWDGRTXHXQDFpOXODGHWHUPLQDGDFRUUHVSRQGLHQWHDXQOLQDMHGDGRQRSURGXFHVLPXOWiQHDPHQWHWRGDVODVcitoTXLQDVFRUUHVSRQGLHQWHVDOPLVPR3RUHMHPSORHOOLQDMH7KSXHGH
producir ,)1ȖOLQIRWR[LQDĮ71)ĮH,/DXQTXHVyORUDUDPHQWH
una célula produce la totalidad de las mismas en un momento dado.
Sorprendentemente, algunas células 7KSXHGHQDGTXLULUWDPELpQOD
FDSDFLGDGGHSURGXFLU,/VLPXOWiQHDPHQWHFRQ,)1Ȗ(QPRGR
DQiORJRODVFpOXODV7KSXHGHQSURGXFLUGLIHUHQFLDOPHQWH,/,/
,/\SUREDEOHPHQWH,/\ODV7KSURGXFLUGLYHUVDVFRPELQDFLRQHVGH,/D,/I,/H,/
En síntesis, las células 7K \ 7K VRQ KHWHURJpQHDV \ H[KLben cierto grado de plasticidad, siendo las 7KODVTXHRVWHQWDQ
HOPi[LPRJUDGRGHGLFKDplasticidad, lo que sugiere que no serían
células terminalmente diferenciadas. Esta reprogramación de la
funcionalidad de los LT CD4+ de ayuda posee una extraordinaria importancia, ya que su potencial manipulación conlleva la
apasionante posibilidad de modular la respuesta inmune en situaciones tan disímiles como las infecciones, los eventos de autoinmunidad o los tumores.
3.2.2. Linfocitos T citotóxicos (CTL)
Estas células reconocen a través del receptor de OLQIRFLWRV7±SRU
HMHPSORH[SUHVDGRVREUHODVXSHU¿FLHGHODPHPEUDQDFHOXODULQfectada– un producto del antígeno viral procesado, asociado a una
PROpFXODGHFODVH,GHO&0+7DPELpQVHKDGHPRVWUDGRHQHOVHU
humano que una minoría de &7/HVWiWDPELpQUHVWULQJLGDSRUPRléculas de clase II del CMH.
(OVLJQL¿FDGRRSHUDFLRQDOGHHVWHIHQyPHQRGHUHVWULFFLyQHMHUcido por las moléculas del CMH es que los &7/PLJUDQKDFLDVLWLRV
donde reconocen células infectadas como "no propias", pero no pueden ser bloqueados o estimulados en su actividad por la presencia
GHYLUXVOLEUHHQVDQJUHXRWURÀXLGR&RPR\DIXHUDH[SUHVDGRORV
viriones libres, en cambio, son controlados por los anticuerpos neuWUDOL]DQWHV ORV TXH SXHGHQ SURGXFLUVH HQ H[FHVR UiSLGDPHQWH /D
velocidad de la respuesta de los &7/HVGHSHQGLHQWHGHOSRUFHQWDMH
de /7SUHFXUVRUHV\GHOWLHPSRGHGXSOLFDFLRQGHORV/7HIHFWRUHV
¿Cómo actúan los CTL?
Al no ser totalmente maduros, los /7&'+ vírgenes que migran desde
HO WLPR VRQ FDSDFHV GH UHFRQRFHU FpOXODV TXH H[SUHVDQ SpSWLGRVQR
Figura 7.27. Linajes de linfocitos T CD4+. /DVVXESREODFLRQHV7K7K7K\7UHJH[KLEHQFDUDFWHUtVWLFDVIHQRWtSLFDV\IXQFLRQDOHV
GH¿QLGDV/DVSREODFLRQHV7IK7KTr1 y 7KHVWiQVLHQGRD~QHYDOXDGDVSDUDGHWHUPLQDUVLFRUUHVSRQGHQDHQWLGDGHVLQGHSHQGLHQWHV
RDDOJXQDGHODVHVWLUSHVPHQFLRQDGDVSUHFHGHQWHPHQWH(QHOLQWHULRUGHFDGDFpOXODVHLQGLFDQORVIDFWRUHVGHWUDQVFULSFLyQTXHVRQ
HVSHFt¿FRVDFDGDXQD/DVÀHFKDVLQGLFDQODSRWHQFLDOHYROXFLyQGHXQDHVWLUSHFHOXODUHQSUHVHQFLDGHGHWHUPLQDGDVFLWRTXLQDV
166
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
Figura 7.28.,QGXFFLyQGHapoptosis por &7/HVSHFt¿FRVGHFpOXODV
GLDQD LQIHFWDGDV FRQ YLUXV KHSDWLWLV GHO UDWyQ XQ FRURQDYLUXV /D
OtQHDFHOXODU- XQDHVWLUSHPDFURIiJLFD IXHLQIHFWDGDKRUDV
DQWHVGHODFRLQFXEDFLyQin vitro con &7/KLVWRFRPSDWLEOHVGHUDWyQVHQVLELOL]DGRVFRQHOYLUXV UHODFLyQHQWUHFpOXODHIHFWRUD\FpOXODGLDQDLJXDOD A.&RQWDFWRHQWUHODFpOXODGLDQDLQIHFWDGD\HO
&7/FRLQFXEDGRVC. Desaparición de procesos citoplasmáticos en
ODFpOXODGLDQDLQIHFWDGDDOFDERGHKRUDE.$SDULFLyQGHSURWUXVLRQHVEXOORVDVGHDSUR[LPDGDPHQWH—HQODVXSHU¿FLHGHODFpOXOD
GLDQDLQIHFWDGDB. Condensación y marginación de la cromatina en
ODFpOXODGLDQDLQIHFWDGDDOFDERGHKD. Patente degeneración
YDFXRODUGHOFLWRSODVPDDOFDERGHKRUDVF. Degeneración de la
FpOXODGLDQDLQIHFWDGDIRUPDQGRPDVDVFHOXODUHVFRQGHQVDGDVQR
asociadas a la &7//DVEDUUDVLQGLFDQ—)XHQWH6KLEDWD6et al
Journal of Virology5HSURGXFLGRFRQDXWRUL]DFLyQ
SURSLRVHQHOFRQWH[WRGHPROpFXODVCMH-I, aunque carecen de caSDFLGDGFLWRWy[LFD/DPLVPDVHDGTXLHUHHQORVyUJDQRVVHFXQGDULRV
linfoides cuando las células presentadoras profesionales y los linfocitos 7K VH HQFXHQWUDQ FRQ ORV /7 &'+ naïve. Sin embargo, para
ser totalmente funcionales, los &7/ UHTXLHUHQ RWUDV VHxDOHV )LJXUD
HOUHFRQRFLPLHQWRGHOSpSWLGRH[WUDxRSUHVHQWDGRHQHOFRQWH[WR
de las &0+,SRUSDUWHGHO7&5 VHxDO \ODLQWHUDFFLyQHQWUHORV
FRUUHFHSWRUHVGHODVFpOXODVFLWRWy[LFDV\ORVOLJDQGRVSUHVHQWHVHQOD
VXSHU¿FLHGHODFpOXODLQIHFWDGD VHxDO /DLQWHUDFFLyQHQWUHHO7&5
\HOSpSWLGRH[WUDxRSUHVHQWDGRSRUODVCMH-I también requiere la
DJUHJDFLyQGHXQQ~PHURGHUHFHSWRUHV7HQXQDHVWUXFWXUDSDUWLFXODU
y reorganizada del citoesqueleto del /7/XHJRGHODVHFUHFLyQGHODV
FLWRTXLQDVDSURSLDGDVSRUSDUWHGHODVFpOXODVSUHVHQWDGRUDV VHxDO los /7&'+WLHQHQODWRWDOFDSDFLGDGSDUDHMHUFHUVXIXQFLyQDQWLYLUDO
/DLQWHUDFFLyQHQWUHHO7&5\HOSpSWLGRSUHVHQWDGRSRUODVCMH-I es
GHEDMDD¿QLGDG —0RPHQRU DXQTXH±VRUSUHQGHQWHPHQWH±GHDOWD
¿GHOLGDG". Esta interacción entre el TCR y el complejo péptido/
CMH se ensambla como una sinapsis inmunológica.
$XQTXHORV7&5SXHGHQGHVSOD]DUVHLQGLYLGXDOPHQWHVREUHOD
VXSHU¿FLHFHOXODUODXQLyQDOFRPSOHMRSpSWLGR&0+GHEHVHUFRQVLGHUDGDFRPRXQDFRPSOHMDLQWHUDFFLyQPXOWLPpULFD
Los CTL ejercen su efecto antiviral mediante mecanismos
FLWROtWLFRV\QRFLWROtWLFRV5HFLpQHQSXGRHVWDEOHFHUVHTXH
HOVHJXQGRHVD~QPiVUHOHYDQWHTXHHOSULPHURHQLQIHFFLRQHV
tales como la producida por HBV.
Los CTL promueven la muerte de las células infectadas
mediante 2 vías: ODWUDQVIHUHQFLDGHJUiQXORVFLWRSODVPiWLFRVGH
perforinas y granzima B VHULQDSURWHDVDV KDFLDODFpOXODLQIHFtada que las capta mediante un mecanismo de endocitosis mediada
por UHFHSWRU\TXHSURPRYHUiODapoptosis de ésta mediante la vía
H[WUtQVHFDGHODapoptosis mediada por FDVSDVDV )LJXUD \ la inducción de apoptosis mediante la expresión de FasL sobre
VXVXSHU¿FLHTXHFRQWDFWDUiODPROpFXOD)DV &' HQODVFpOXODV
LQIHFWDGDV YpDVHHOtWHPHQHVWHFDStWXOR /DOLEHUDFLyQGHSHUIRrinas desde las &7/SURPXHYHODIRUPDFLyQGHSRURVHQODPHPEUDQDHQGRVRPDOGHODFpOXODLQIHFWDGDORFXDODVXYH]SRVLELOLWDUi
la liberación de JUDQ]LPD%TXHLQGXFLUi±WDPELpQODapoptosis de
HVWD~OWLPD0LHQWUDVHOSULPHUPHFDQLVPRHVGHDFFLyQUiSLGR VH
HMHFXWDHQPLQXWRV HOVHJXQGRRFXUUHPiVOHQWDPHQWH HQKRUDV Muchos &7/VHFUHWDQWDPELpQ,)1ȖHOTXHSURPXHYHXQHVWDGR
DQWLYLUDOHQFpOXODVYHFLQDVHLQFUHPHQWDORVQLYHOHVGHH[SUHVLyQ
de CMH-I y CMH-II. Los &7/DFWLYDGRVWDPELpQVHFUHWDQ,/\
TXLPLRTXLQDVFRPR&&/ 5$17(6 La secreción de ,)1Ȗ\71)Į es capaz de eliminar por un
mecanismo no citolítico la infección viral de una célula. Este meFDQLVPRHVGHHVSHFLDOUHOHYDQFLDDQWHYLUXVQRFLWRSiWLFRV(QORcalizaciones anatómicas tales como el hígado o el SNC este mecanismo es crucial para la limitación de las infecciones virales, dado
que si la eliminación viral dependiese del efecto citotólítico de las
&7/SRGUtDSURGXFLUVHPiVGDxRTXHEHQH¿FLRDOKRVSHGDGRU(Q
HVWDVORFDOL]DFLRQHVKDELWXDOPHQWHH[LVWHXQH[FHVRGHYDULRVyUdenes de magnitud del número de células infectadas respecto al de
las &7/SUHVHQWHV(QRWURVWpUPLQRV la limitación de la infección
mediante efectos citolíticos es apropiada cuando el número de
células infectadas es escaso. Por el contrario, cuando la infección acontece en cantidades masivas de células, el mecanismo
no citolítico promovido por FLWRTXLQDV HV HO PiV LPSRUWDQWH.
Este mecanismo requiere que las células infectadas retengan su
capacidad de responder ante la señalización disparada por la interacción entre las FLWRTXLQDVPHQFLRQDGDV ,)1Ȗy 71)Į \VXV
receptores, y que la replicación del virus en cuestión sea sensible
al efecto promovido. Este mecanismo no citolítico ha sido observado en infecciones tales como las producidas por los virus HBV y
HCV, arenavirus, adenovirus, picornavirus y otros. Otros péptidos
secretados también por los &7/FRPRODVGHIHQVLQDVVRQFDSDFHV
de promover cierto grado de depuración celular no citolítica del
HIV. Los /7CD4+ pueden también contribuir a la limitación viral
no citolítica, aun con escasa participación de los &7/ FRPR VH
documentó en infecciones producidas por virus vaccinia y otros.
/DUHVSXHVWDGHH[SDQVLyQFORQDOGHORVSUHFXUVRUHVGHODVFplulas &7/HVYDULDEOHVHJ~QHOYLUXV$VtH[SHULPHQWRVUHDOL]DGRV
en ratones infectados con el virus de la coriomeningitis linfocitaria
/&0 GRFXPHQWDURQTXHKDVWDHOGHORV&7/HVSOpQLFRVHUDQ
HVSHFt¿FRVSDUDXQSpSWLGRYLUDOGHWHUPLQDGRVLHQGRD~QGHWHFWDEOHXQDOFDERGHDxR(QIRUPDDQiORJDODLQIHFFLyQSRU
EBV se asocia a una masiva proliferación clonal de &7/HVSHFt¿FRV(QFRQWUDSRVLFLyQHODQiOLVLVGH&7/GHED]RGHKXPDQRVLQfectados con HBV o +,9PXHVWUDTXHPHQRVGHOGHORVPLVPRV
HVHVSHFt¿FRSDUDXQSpSWLGRGHWHUPLQDGR
¿Cómo influye la sensibilidad funcional
de los LT en el desenlace de la infección viral?
Entre los factores que condiciona el desenlace de una infección
YLUDOGHEHPHQFLRQDUVHODGLYHUVDVHQVLELOLGDGIXQFLRQDO para algunos autores denominada avidez funcional GHORV/7$GHPiV
de los factores generales mencionados al comienzo de esta SecFLyQHOGHVHQODFHGHODLQIHFFLyQHVWiWDPELpQFRQGLFLRQDGRSRUOD
naturaleza de los péptidos reconocidos por los /7DVtFRPRSRUOD
FDSDFLGDGYLUDOGHPXWDUGLFKRVHStWRSHV\HVFDSDUDODUHVSXHVWD7
y por la sensibilidad individual de dichas células. Esta sensibilidad
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
Figura 7.29. Balance entre Treg y CTL. Como lo explica el Ying<DQJGHOD¿ORVRItDRULHQWDOH[LVWHXQDGXDOLGDGGHWRGRORH[LVWHQWH
Una actividad exacerbada de los &7/OLPLWDUiODLQIHFFLyQYLUDODXQ
DOFRVWRGHOGDxRKtVWLFR3RUHOFRQWUDULRXQDDFWLYLGDGDXPHQWDGD
de las 7UHJOLPLWDUiHOGDxRWLVXODUSHURSXHGHGHYHQLUHQXQGHIHFWR
SDUDOLPLWDUODLQIHFFLyQYLUDO
SDUDHOUHFRQRFLPLHQWRGHHStWRSHVH[SUHVDGRVHQHOFRQWH[WRGHO
CMH por parte de los /7SXHGHYDULDUHQYDULRVyUGHQHVGHPDJnitud. A mayor sensibilidad FDSDFLGDG GH XQ /7 GH UHFRQRFHU
FpOXODVTXHH[SUHVDQXQPHQRUQ~PHURGHSpSWLGRVHQHOFRQWH[WR
GHODV&0+VREUHODVXSHU¿FLHFHOXODU mayor es la capacidad de
eliminar la infección. A esta funcionalidad contribuyen factores
originados en el /7\HQODFpOXODSUHVHQWDGRUD(QWUHORVIDFWRUHV
dependientes del /7PHUHFHQGHVWDFDUVHORVVLJXLHQWHVD ODD¿QLGDGGHO7&5SRUHOSpSWLGRE HOQLYHOGHH[SUHVLyQGH7&5GH
&'\GHPROpFXODVFRHVWLPXODWRULDVVREUHODVXSHU¿FLHFHOXODUF ODYDOHQFLDGHO7&5$VXYH]GHVGHODFpOXODLQIHFWDGDRSUHVHQtadora, es crucial el nivel de procesamiento y unión a las CMH-I
del péptido a ser reconocido. Una mayor sensibilidad de los LT
es crítica para el reconocimiento de las células infectadas en
las etapas iniciales, así como ante la estrategia viral de inhibir
la expresión de las CMH-I y consiguientemente, el reconocimiento peptídico por los CTL. Para ser activados, los /7CD4+
UHTXLHUHQODPHUDH[SUHVLyQGHXQSpSWLGRDQWLJpQLFRGDGRHQHO
&0+,,GHODFpOXODSUHVHQWDGRUDHQDSHQDVHOGHOWRWDOGH
GLFKDVPROpFXODVH[SXHVWDVHQODVXSHU¿FLHFHOXODU$VLPLVPRKDbitualmente, EDVWDFRQTXHXQDFpOXODLQIHFWDGDH[SUHVH±
epítopes T en el contexto del &0+, SDUD TXH VHD UHFRQRFLda por un CTL. /DD¿QLGDGGHODLQWHUDFFLyQHQWUHHO7&5\HO
FRPSOHMRSpSWLGR&0+VHFRUUHODFLRQDFRQODFXDOLGDGGHODUHVSXHVWDGHORVGLIHUHQWHVFORQHV7\DTXHGHWHUPLQDHOXPEUDOGHO
gatillado de la respuesta de las células &'+. Esta sensibilidad de
los /7SXHGHVHUPHQVXUDGDPHGLDQWHHQVD\RVELROyJLFRVex vivo
FRPRHO(/,6327 ,)1ȖEnzyme-Linked Immunospot Assay TXH
determinan con alta sensibilidad la capacidad funcional de dichas
FpOXODVORFXDOGHSHQGHGHODD¿QLGDGGHODLQWHUDFFLyQGHO7&5
FRQHOFRPSOHMR&0+SpSWLGR\GHOHVWDGRIXQFLRQDOGHODFpOXOD
2WUDWHFQRORJtDLGHDGDSDUDPHGLUH[FOXVLYDPHQWHODD¿QLGDGHQWUHHO7&5FRQHOFRPSOHMR&0+SpSWLGR±LQGHSHQGLHQWHPHQWH
de la función celular– es la denominada tinción de células CD8+
DQWtJHQRHVSHFt¿FDVPHGLDQWHODXQLyQGHWHWUiPHURV de complejos CMH-I / péptidos PDUFDGRV FRQ ÀXRUHVFHtQD OR TXH HV
VXEVLJXLHQWHPHQWHPHGLGRPHGLDQWHFLWRPHWUtDGHÀXMR
167
La relevancia de la sensibilidad funcional de los CTL es
HMHPSOL¿FDGDHQHOFXUVRGLIHUHQWHTXHSXHGHRFXUULUDQWHODV
infecciones producidas por HIV o por HCV. En el primer caso,
los &7/UHVWULQJLGRVSRUODPROpFXOD%GHOCMH-I reconocen el
HStWRSHLQPXQRGRPLQDQWH.FRQPD\RUVHQVLELOLGDGIXQFLRQDO
–y consiguientemente menor carga viral de HIV– que al ser restringidos por otras moléculas HLA-A y HLA-B. Este hallazgo se correlaciona con la progresión de la infección por +,9VLJQL¿FDWLYDPHQWHPiVOHQWDREVHUYDGDHQSDFLHQWHVTXHH[KLEHQ+/$%(Q
PRGRDQiORJRORV&7/GHLQGLYLGXRVTXHOLPLWDQODLQIHFFLyQSRU
+&9H[KLEHQPD\RUVHQVLELOLGDGIXQFLRQDO±\FRQVLJXLHQWHPHQWH
mayor nivel de FLWRWR[LFLGDG\SURGXFFLyQGH,)1Ȗ\71)ĮTXH
los de pacientes que no eliminan el virus, progresando hacia la infección crónica.
/D UHVSXHVWD GH PD\RU VHQVLELOLGDG IXQFLRQDO WLHQH VLPXOWiQHDPHQWHYHQWDMDV\GHVYHQWDMDVSRUXQODGRVHSRWHQFLDODH¿FDFLD
de la respuesta inmune celular mediada por los &7/SDUDFRQWURODU
la infección, pero al mismo tiempo pueden inducirse mutaciones
de escape en el genoma viral que intenten evadir dicha respuesta,
pudiendo conducir al control de la infección si hubiese un elevado
costo de la DSWLWXGUHSOLFDWLYDYLUDO ¿WQHVV RDODLQIHFFLyQFUyQLFDVLVHSURGXFHXQEDMRFRPSURPLVRGHGLFKDaptitud viral. Esta
persistente estimulación de los &7/GHDOWDVHQVLELOLGDGIXQFLRQDO
con elevadas dosis de antígenos virales los puede tornar anérgicos,
ORTXHSURPXHYHHODJRWDPLHQWRLQPXQH(VWHHIHFWRHVWiDVRFLDGR
DODLQGXFFLyQGHODH[SUHVLyQGHODPROpFXOD3'HQORV/7(VWH
fenómeno ha sido observado en las infecciones crónicas por HIV,
HBV y HCV.
¿De qué depende que el reconocimiento T
de células infectadas con virus no se transforme en un
mecanismo promotor de un daño inmunopatológico?
6L ELHQ H[LVWHQ YLUXV TXH VRQ FDSDFHV GH LQKLELU OD UHVSXHVWD 7
YpDVHHOFDStWXOR0HFDQLVPRVGHHYDVLyQDODUHVSXHVWDLQPXQH FRPRHO+&09+,9\RWURVQRUPDOPHQWHH[LVWHXQIUHQR
KRPHVWiVLFRTXHHVHMHUFLGRSRUODH[SUHVLyQGHPROpFXODVWDOHV
FRPR&7/$\)DV/HQORV/7DFWLYDGRVTXHSHUPLWHQHOFRQWURO
GHODH[SDQVLyQFORQDO(QPRGRDQiORJRODLQWHUDFFLyQHQWUHOD
SURWHtQD3'HQODVXSHU¿FLHGHORV/7 SRUHMHPSORHQORV&7/ FRQHOOLJDQGRHVSHFt¿FR3'/H[SUHVDGRHQODVcélulas dendríWLFDVSURPXHYHODOLPLWDFLyQGHODUHVSXHVWDGHGLFKDVFpOXODV7
$VLPLVPR RWUR QLYHO GH FRQWURO HV PRGXODGR SRU ODV FpOXODV 7
UHJXODWRULDV QDWXUDOHV \ SRU ODV7 UHJXODWRULDV LQGXFLEOHV7K \
7U )LJXUD En términos generales, las proteínas solubles inducen una adecuada respuesta humoral, pero raramente desencadenan una resSXHVWD FLWRWy[LFD FHOXODU /D SDUWLFLSDFLyQ GH HVWD ~OWLPD UHTXLHre habitualmente de la síntesis del material inmunogénico en el
hospedador. La naturaleza de los virus permite la intervención de
ambas respuestas. Como contrapartida, la utilización de vacunas
virales inactivadas o de péptidos sintéticos no induce generalmente
la participación de &7/
4. INTERACCIONES
PROTEÍNA-GLICANOS EN EL CONTROL
DE LAS RESPUESTAS INNATA Y ADAPTATIVA: ROL DE LAS
GALECTINAS
El rol de las lectinas en la regulación de la respuesta innata ha sido
H[WHQVDPHQWHHVWDEOHFLGRWDOFRPRORHMHPSOL¿FDQODVcolectinas
YpDVHHOtWHP ODGHFWLQDRODPROpFXOD'&6,*1 DCSSHFL¿FIntercellular adhesion molecule (ICAM)3-Grabbing Nonintegrin (VWDV OHFWLQDV GH PDPtIHURV VRQ VLQWHWL]DGDV HQ OD YtD
VHFUHWRULD\SUHVHQWDGDVHQODVXSHU¿FLHFHOXODUSDUDLQWHUDFWXDUFRQ
PRWLYRV SDUD DOJXQRV DXWRUHV epítopes KLGURFDUERQDGRV QR
propios, presentes en agentes patógenos. En contraposición, otras
moléculas, denominadas galectinas son sintetizadas y almacenadas
en el citosol, pero ante ciertos estímulos producidos por el daño
tisular iniciado por una infección y/o por una infección prolongaGD SXHGHQ VHU SDVLYDPHQWH OLEHUDGDV GHVGH ODV FpOXODV TXH HVWiQ
168
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
PXULHQGR R VHU VHFUHWDGDV SRU XQD YtD QR FOiVLFD LQGHSHQGLHQWH
GH ODDXVHQFLDGH VHFXHQFLDVSHSWtGLFDVVHxDOHQODVPHQFLRQDGDV
moléculas.
8QD IDVFLQDQWH iUHD GHO FRQRFLPLHQWR HVWi HPHUJLHQGR HV OD
que vincula el rol de las galectinas con la regulación de las resSXHVWDVLQÀDPDWRULDVHLQPXQHVDJXGDV\FUyQLFDVLas galectinas
son proteínas conservadas a través de la HYROXFLyQTXHWLHQHQ
OD FDSDFLGDG GH GHVFLIUDU HO FyGLJR HVSHFt¿FR GH ORV JO~FLGRV
PHGLDQWHODGHWHFFLyQGHȕJDODFWyVLGRVDWUDYpVGHXQRRPiV
dominios de reconocimiento de carbohidratos CRD, según su
VLJODHQLQJOpV sin requerimiento de metales iónicos. La mínima
estructura reconocida por las JDOHFWLQDV HV HO GLVDFiULGR N-acetil
ODFWRVDPLQD *DOȕ*OF1$FGRQGH*DOHVJDODFWRVD\*OF1$F
es NDFHWLOJOXFRVDPLQD HO FXDO SXHGH REVHUYDUVH HQ ORV N-gliFDQRV XQLGRVDODPLQRiFLGRDVSDUDJLQD \OJOLFDQRV OLJDGRVD
VHULQD \HQVDPEODUVHFRPRXQLGDGHVP~OWLSOHV/DGLYHUVLGDGGH
posibles glicanos a ser reconocidos por las galectinas estriba en el
JUDGR GH UDPL¿FDFLyQ GH ORV N-glicanos, la multiplicidad de residuos de NDFHWLO ODFWRVDPLQD \ OD PRGL¿FDFLyQ WHUPLQDO GH ORV
UHVLGXRVVDFDUtGLFRV SRUHMHPSORFRQDGLFLyQGHIXFRVDRiFLGR
VLiOLFR (VWDV FUXFLDOHV GLIHUHQFLDV SRGUtDQ H[SOLFDU ODV GLYHUVDV
y a veces opuestas funciones de las galectinas en los fenómenos
LQÀDPDWRULRV Las galectinas participan en fenómenos de crecimiento y diferenciación celular, así como en su adhesión y
PLJUDFLyQ HQ OD TXLPLRWD[LV \ HQ OD apoptosis o sobrevida
celular. Su vasto espectro de acción se extiende al control de
enfermedades infecciosas, autoinmunes, alérgicas y neoplásicas $GHPiV ODV JDOHFWLQDV SXHGHQ UHFRQRFHU OLJDQGRV 3$03 SUHVHQWHV HQ OD VXSHU¿FLH GH GLYHUVRV SDWyJHQRV funcionando
así, también como receptores solubles de reconocimiento de
patrones 553 &RPRODVgalectinas aparecen especialmente en
WHMLGRVOHVLRQDGRVGRQGHH[LVWHQVHxDOHVGHGDxRLQLFLDGRSRUSDtógenos, su liberación pasiva es también considerada por varios
DXWRUHV FRPR XQ SRWHQFLDO SDWUyQ PROHFXODU GH GDxR '$03
Damage-Associated Molecular Pattern Diversos componentes
de la respuesta innata reconocen PAMP y DAMP LQFOX\HQSRU
HMHPSORGHIHQVLQDVDQH[LQDVSURWHtQDVGHHVWUpVWpUPLFR,/Į
HWF Al reconocer ambos patrones, la respuesta innata es caSD]GHGLVFULPLQDUHQWUHXQDJHQWHSDWyJHQR\RWURTXHQROR
es. Dado que los PAMP corresponden a patrones moleculares de
DJHQWHVH[yJHQRVDOKRVSHGDGRUWDQWRSDWyJHQRVFRPRDSDWyJHQRV
su mera presencia no indica al hospedero que la lesión es el resultado de dicho agente. Por el contrario, la detección de los DAMP
(moléculas habitualmente "escondidas" en el interior celular)
SURYHH GLFKD LQIRUPDFLyQ LQGLFDQGR TXH HO GDxR HV FDXVDGR
por un agente patógeno.
Las JDOHFWLQDVGHFRGL¿FDQODVLPSURQWDVGHKLGUDWRVGH
FDUERQRH[KLELGDVHQODVXSHU¿FLHGHODVFpOXODVFRPRFRQVHFXHQFLDGHODDFWLYLGDG¿QDPHQWHFRQWURODGDGHJOLFRVLOWUDQVIHUDVDV\JOLFRVLGDVDVTXHPRGXODQODDFWLYDFLyQGLIHUHQFLDFLyQ\
homesotasis inmune. A diferencia de las citoquinas y quimioquinas, las JDOHFWLQDVVHFUHWDGDVQRVHXQHQDUHFHSWRUHVHVSHFt¿FRV
sino que median la interacción con las células del sistema inmune
DWUDYpVGHOUHFRQRFLPLHQWRGHJOLFRFRQMXJDGRVSUHIHUHQFLDOHVH[SXHVWRVHQODVXSHU¿FLHFHOXODU
Las JDOHFWLQDV DQWLJXDPHQWHFRQRFLGDVFRPROHFWLQDVWLSR6 son moléculas proteicas caracterizadas por poseer al menos un doPLQLR &5' GH XQRV DPLQRiFLGRV SDUD HO UHFRQRFLPLHQWR GH
FDUERKLGUDWRV6HFRQRFHQKDVWDHOSUHVHQWHgalectinas, las que
KDQ VLGR FODVL¿FDGDV VHJ~Q VXV FDUDFWHUtVWLFDV HVWUXFWXUDOHV HQ JUDQGHVJUXSRVD ODVFRQVLGHUDGDVSURWRWLSR FRQWLHQHQXQ~QLFR
&5'\SXHGHQIRUPDUKRPRGtPHURV E ODVTXHH[KLEHQUHSHWLFLRQHVHQWiQGHPFRQVLVWHQWHVHQGRV&5'GLIHUHQWHVXQLGRVSRU
XQSpSWLGRFRUWR\F ODJDOHFWLQDTXLPpULFDTXHSRVHHXQ~QLFR
&5'FRQXQH[WUHPR1WHUPLQDOH[WHQGLGR 7DEOD $GLIHUHQcia de las selectinas, la unión de las galectinas a los carbohidratos
es Ca++ independiente. Muchas galectinas pueden unirse a dichos
azúcares en un modo bivalente o aun multivalente, lo que induce la
XQLyQ\UHGLVWULEXFLyQGHODVJOLFRSURWHtQDVGHODVXSHU¿FLHFHOXODU
formando una verdadera matriz o "entramado". Asimismo, la inteUDFFLyQDWUDYpVGHJOXFRFRQMXJDGRVHQODVXSHU¿FLHFHOXODUSXHGH
ocurrir mediante interacciones ligando-receptor.
El número de residuos N-glicanos –y por ende su grado de raPL¿FDFLyQ±disponibles para interactuar con las lectinas es variable según se trate de receptores estimulatorios o inhibitorios,
ORFXDOSXHGHUHJXODUHVSHFt¿FDPHQWHHOUHFDPELRGHDTXpOORV\VX
endocitosis, constituyendo un delicado mecanismo modulatorio de
la transición entre la proliferación y la detención del ciclo celular.
Al respecto, se ha observado que la interacción JDOHFWLQDV±&7/$
LPSLGHVXLQWHUQDOL]DFLyQGHVGHODVXSHU¿FLHFHOXODUSURORQJDQGRDVtVXVHxDOLQKLELWRULDORTXHFRQWULEX\HDOD¿QDOL]DFLyQGHOD
UHVSXHVWD7\SRUHQGHDODKRPHRVWDVLVGHGLFKDSREODFLyQ0iV
aún, la interacción entre la JDOHFWLQD\ORV/7&'+ HVSHFt¿FRVGH
tumores favorece su anergia, al promover la disgregación de dicha
PROpFXODUHVSHFWRDO7&5$VXYH]ODJDOHFWLQDSXHGHDFWXDUHQ
combinación con otros sistemas que también suprimen la respuesta
7 WDOHVFRPR3'3'/&7/$LQGRODPLQDGLR[LJHQDVD
y )DV/ SDUDDOFDQ]DUVXKRPHRVWDVLV
Como ocurre por ejemplo con las galectinas 3 y 10, estas
lectinas también pueden unirse a sus ligandos en un modo
carbohidrato-independiente, especialmente a nivel intracelular donde pueden producirse interacciones proteína-proteína.
Entre las galectinas se observa una diversidad funcional inherente
a características estructurales privativas de cada subgrupo y consiguientemente, a su preferencia por la unión a ligandos diversos.
0iVD~QXQDPLVPDJDOHFWLQDSXHGHSRVHHUHIHFWRVRSXHVWRVVHgún su concentración en el microambiente, su compartimentalización celular y/o el estado de diferenciación de la célula diana. A
FRQWLQXDFLyQVyORVHPHQFLRQDUiQDOJXQRVDVSHFWRVUHOHYDQWHVGH
las JDOHFWLQDV\VREUHODUHJXODFLyQGHODUHVSXHVWDLQPXQH
\DTXHpVWDVLQFUHPHQWDQVXH[SUHVLyQGXUDQWHODLQÀDPDFLyQ(O
OHFWRUREVHUYDUiHQSiUUDIRVVXEVLJXLHQWHVTXHdeterminados virus pueden modular la respuesta inmune regulada por dichas
JDOHFWLQDVSDUDVXSURSLREHQH¿FLRSURPRYLHQGRSRUHMHPSOR
una mayor infectividad y/o la persistencia viral.
Localización de las galectinas(VWiQSUHVHQWHVSUiFWLFDPHQte en todas las células de la respuesta inmune, ya sea en forma
FRQVWLWXWLYDRLQGXFLEOHVLHQGRVREUHH[SUHVDGDVHQORV/7\LB
DFWLYDGRVHQORVPDFUyIDJRVLQÀDPDWRULRVODVcélulas NK de la
GHFLGXD\HQODVFpOXODV7UHJXODWRULDV&'+&'+. Aunque estas
proteínas carecen de una señal peptídica para la secreción celular, algunas pueden secretarse mediante su capacidad de unión a
FDUERKLGUDWRVSRUXQDYtDQRFOiVLFD/DORFDOL]DFLyQLQWUDQXFOHDU
de las JDOHFWLQDV\DQLYHOQXFOHDUIXHSRVWXODGDFRPRSRVLEOH
consecuencia de su participación en el corte y empalme de los
51$ SUHPHQVDMHURV PLHQWUDV TXH VX XELFDFLyQ HQ HO H[WUDFHOXODUUHÀHMDVXYLQFXODFLyQFRQODVLQWHUDFFLRQHVFpOXODFpOXODR
célula-matriz. La JDOHFWLQDHVWiXELFDGDHVSHFt¿FDPHQWHHQORV
órganos linfoides, /7PDFUyIDJRVDFWLYDGRV\FpOXODVHQGRWHOLDOHVORFXDOSXHGHVHUUHJXODGRSRUGLYHUVRVHVWtPXORVLQÀDPDWRrios. La JDOHFWLQD±DVXYH]±HVWiH[SUHVDGDHQSUiFWLFDPHQWH
todas las células del sistema inmune, incluyendo las DC, monocitos, macrófagos, linfocitos y SROLPRUIRQXFOHDUHV/DH[SUHVLyQ
de dicha galectina se incrementa en estas últimas células en fenóPHQRVLQÀDPDWRULRVORTXHHVFRLQFLGHQWHFRQVXUHORFDOL]DFLyQ
HQODVXSHU¿FLHGHODPHPEUDQDSODVPiWLFDGHODVFpOXODVHQGRWHOLDOHV)LQDOPHQWHODJDOHFWLQDVHH[SUHVDHQPDFUyIDJRV/7
¿EUREODVWRV\FpOXODVHQGRWHOLDOHV
4.1. FUNCIÓN DE LAS GALECTINAS
En términos generales, la galectina-1 y la galectina-3 exhiben
generalmente efectos antagónicos: galectina-1 es considerada
XQDPROpFXODTXHLQKLEHORVIHQyPHQRVLQÀDPDWRULRVPLHQWUDV
TXHgalectina-3 los estimula )LJXUD /DJDOHFWLQDLQKLEH
HOWUi¿FROHXFRFLWDULRLQGXFHODapoptosis y regula la liberación de
mediadores químicos. En contraposición, la galectina-3, promue-
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
169
obedece a un efecto directo sobre los leucocitos o sobre las células
HQGRWHOLDOHV)LQDOPHQWHWDPELpQVHGHPRVWUyTXHODgalectina-1
es capaz de promover la angiogénesis.(QFRQMXQWRHVWRVGDWRV
sugieren que dicha molécula podría ser un potencial blanco de teUDSpXWLFDHQWXPRUHV SDUDHYLWDUVXGLVHPLQDFLyQ PLHQWUDVTXH
4.2. ESPECIFICIDAD Y AFINIDAD DE LA UNIÓN A GLICANOS
SRGUtDXWLOL]DUVHDODPLVPDPROpFXODSDUDOLPLWDUODLQÀDPDFLyQ
([LVWHXQD ¿QDGLVFULPLQDFLyQHQHOUHFRQRFLPLHQWRGHORVGLIHUHQ- FUyQLFDRSUHYHQLUUHVSXHVWDVLQPXQHVKLSHUpUJLFDV )LJXUD La JDOHFWLQDHVWDPELpQUHVSRQVDEOHGHOHIHFWRWROHURJpQLFR
tes ligandos por parte de las JDOHFWLQDV$Vt SRU HMHPSOR OD PHUD
PRGL¿FDFLyQGHUHVLGXRVGHJDODFWRVDSRUĮN-acetilgalactosamina de las células dendríticas tempranamente durante el embarazo, lo
disminuye la sensibilidad de la JDOHFWLQDKDFLDGLFKRUHVLGXRSHUR FXDO SURPXHYH OD H[SDQVLyQ FORQDO GH FpOXODV7 UHJXODWRULDV TXH
incrementa la de la JDOHFWLQD$OWHUQDWLYDPHQWH OD PRGL¿FDFLyQ SURGXFHQ,/(QORVJUXSRVGH*DEULHO5DELQRYLFK\-RUFRQ UHVLGXRV GH iFLGR VLiOLFR XQLGRV PHGLDQWH HQODFH Į SHUR ge Geffner dilucidaron las bases moleculares del circuito tolerogéQRĮ UHGXFHSULQFLSDOPHQWHODD¿QLGDGSRUODJDOHFWLQDSHUR nico CD-/7'LFKRFLUFXLWRUHJXODWRULRHVLQLFLDGRSRUlinfocitos
también por la JDOHFWLQD(VWDVLDOLODFLyQĮHVFUXFLDOSDUDHO 7 UHJXODGRUHV &'+)R[3+, los que en presencia de JDOHFWLQD
GHVYtRGHODUHVSXHVWD7KDFLDHOSHU¿OTh2 promovido por la ga\DVHDH[SHULPHQWDOPHQWHDGLFLRQDGDSRUYtDH[yJHQDRSURGXFLGD
OHFWLQD TXHVHXQHDORV/7KSHURQRDORV/7K 0iVD~QORV por las FpOXODVGHQGUtWLFDV \PHGLDQWHHOFRQWDFWRFRQHVWDV~OWLglicanos de dos cadenas hidrocarbonadas son preferencialmente PDVODVLQGXFHQDVHFUHWDU,/ XQDLQWHUOHXTXLQDVHPHMDQWHD
reconocidas por galectina-1, y no por galectina-3. La unión entre la ,/FRQSDUDGyMLFDVFDUDFWHUtVWLFDVSUR\DQWLLQÀDPDWRULDV el CRD de las JDOHFWLQDV\ORVOLJDQGRVȕJDODFWyVLGRVH[KLEHXQD que estimula a las 7UDVHFUHWDU,/ODTXH±DVXYH]LQKLEHODV
D¿QLGDGPHQRU 0 TXHODLQWHUDFLyQSURWHtQDSURWHtQD 0 respuestas 7K\7KSURPRYLHQGRXQSHU¿O7K/DSRWHQFLDO
PDQLSXODFLyQPpGLFDGHHVWHFLUFXLWRDEUHH[WUDRUGLQDULDVSHUVSHFWLYDVQRVyORSDUDiUHDVWDQGLYHUVDVFRPRODVLQKHUHQWHVDWXPRUHV
4.3. GALECTINA-1
trasplantes, o enfermedades autoinmunes sino también a infeccioEl carácter inmunosupresor de esta molécula se asocia a múlti- nes, incluidas las de origen viral.
La infección de células endoteliales con virus Nipah XQSDples mecanismos. Entre ellos, se destaca su capacidad pro-apoptótica sobre los LT maduros y activados, mediante reconocimien- UDPL[RYLUXVHPHUJHQWHDVRFLDGRDencefalitis en humanos, con una
WRHVSHFt¿FRGHODLVRIRUPDGLIHUHQFLDOPHQWHJOLFRVLODGD&'52 PRUWDOLGDGGHO promueve su fusión in vivo IRUPDQGRVLQFLGH OD WLURVLQDIRVIDWDVD 3735& Protein Tyrosine-Phosphatase, FLRV PHGLDQWHODDFWLYLGDGGHODVSURWHtQDV)\*GHVXHQYROWXUD
Receptor type C H[SUHVDGDSRUODVFpOXODVGHPHPRULD(VWDFD- Estudios in vitro demostraron que dicha fusión es inhibida por la
SDFLGDGHVFUXFLDOSDUDHOPDQWHQLPLHQWRGHODKRPHRVWDVLV7/DV galectina-1ODTXH±DVXYH]±SURPXHYHHOLQFUHPHQWRGHOD,/
células epiteliales tímicas sintetizan también esta galectina, lo cual por parte de las CD. Estos resultados demuestran un rol relevante
la hace partícipe de los procesos de selección positiva y negativa de dicha galectina en la respuesta inmune innata frente a la
de los linfocitos en el timo, mediante la disminución y el aumento infección por virus Nipah. En contraposición, se ha demostrado
UHVSHFWLYRVGHOXPEUDOGHVHxDOL]DFLyQGLVSDUDGRSRUHO7&5$GH- que la infección celular in vitro FRQ KHUSHV VLPSOH[ LQFUHPHQPiVHVWDJDOHFWLQDHMHUFHHIHFWRVDQWLLQÀDPDWRULRVDGLFLRQDOHVD WDODH[SUHVLyQ\VHFUHFLyQH[WUDFHOXODUGHJDOHFWLQDORFXDOVH
los promovidos por su capacidad pro-apoptótica: a bajas dosis es asocia a la apoptosis de /7 DFWLYDGRV HQ XQ PRGR FDUERKLGUDWR
capaz de inhibir tanto la adhesión de los LT a las glicoproteínas dependiente, evento postulado como un mecanismo de evasión a
de la matriz extracelular, como la secreción de 71)ĮH,)1Ȗ la respuesta inmune in vivo0iVD~QHQSDFLHQWHVFRQOLQIRPDGH
por los LT activados. La galectina-1 interviene también sobre +RGJNLQFOiVLFRDVRFLDGRDODLQIHFFLyQFRQEBV, se observó un
OD UHVSXHVWD LQQDWD GDGR TXH HV FDSD] GH LQKLELU HO LQ¿OWUD- incremento de JDOHFWLQDHQODVOHVLRQHVFRQXQGHIHFWRIXQFLRQDO
GRLQÀDPDWRULRPHGLDGRSRUQHXWUy¿ORV\ODGHJUDQXODFLyQGH de los /7&'+HVSHFt¿FRVSDUDFLHUWDVSURWHtQDVGHOYLUXV(VWRV
los mastocitos. A diferencia de la regulación de los /7DFWLYDGRV dos últimos estudios, muestran un rol central de la galectina-1 en
mediante la inducción de apoptosis, la JDOHFWLQD LQGXFH HQ ORV la generación de un microambiente inmunosupresor en las inQHXWUy¿ORVODH[SUHVLyQGHIRVIDWLGLOVHULQDHQVXVXSHU¿FLHFRPR fecciones producidas por el virus herpes simplex-1 y por EBV.
resultado de lo cual, son pasibles de ser fagocitados por los macróLa galectina-1 está implicada en la adsorción viral de cierfagos. En estas células, esta galectina también inhibe la secreción tos retrovirus a las células, tales como HTLV-1 y HIV. En el
GHiFLGRDUDTXLGyQLFR\SURVWDJODQGLQD(
caso de +7/9ODSURWHtQDYLUDO7D[ WUDQVDFWLYDGRUDGHODWUDQVSin embargo, no todas los efectos promovidos por JDOHFWLQD FULSFLyQ SURPXHYHODH[SUHVLyQGHJDOHFWLQDHQORV/7ORTXH
VRQDQWLLQÀDPDWRULRVDDOWDVGRVLVWDPELpQHVFDSD]GHSURPRYHU estabiliza las interacciones intercelulares, así como entre el virus
ODDFWLYDFLyQSODTXHWDULD\ODLQGXFFLyQGHODVtQWHVLVGH1$' 3
y la célula, habiéndose propuesto la formación de una estructura
+R[LGDVD±\FRQVLJXLHQWHPHQWHGHVXSHUy[LGR±HQORVQHXWUy¿ORV H[WUDFHOXODU GH SDUWtFXODV YLUDOHV FRQ XQ HQVDPEODMH VHPHMDQWH D
H[WUDYDVDGRV(VWR~OWLPRVXJLHUHTXHORVQHXWUy¿ORVDFWLYDGRVSR- ODVELRSHOtFXODVEDFWHULQDV ELR¿OPV SDUDIDFLOLWDUODLQIHFFLyQGH
GUtDQH[SRQHUUHFHSWRUHVSDUDJDOHFWLQD
RWUDV FpOXODV )LQDOPHQWH OD JDOHFWLQD GLPHUL]DGD HVWi WDPELpQ
Se postula también que la JDOHFWLQDHQGyJHQDFRQVWLWX\HXQ implicada en la promoción del ingreso del HIV a macrófagos y
IUHQRSDUDHOWUi¿FROHXFRFLWDULRDXQTXHD~QUHVWDGLOXFLGDUVLHOOR /7DOREUDUFRPRSXHQWHDWUDYpVGHVXVGRVGRPLQLRV&5'TXH
reconocen principalmente residuos de manosa sobre la glicoproWHtQDGHHQYROWXUDYLUDOJS0iVD~QHVWRVUHVLGXRVYLUDOHVVRQ
VHPHMDQWHVDORVH[KLELGRVSRUODVPLFURYHVtFXODVFHOXODUHVLQPXQRPRGXODWRULDV GHULYDGDV GH HQGRVRPDV H[RFLWDGDV GHVGH ORV
GalecƟna 3
GalecƟna 1
/7ORTXHLPSOLFDXQYHUGDGHURFDPXÀDMHYLUDODOXVXUSDUXQDYtD
Promueve
Inhibe
biosintética celular.
fenómenos
fenómenos
inŇamatorios
inŇamatorios
4.4. GALECTINA-3
ve la activación leucocitaria. Finalmente, la galectina-9 ejecuta
DFFLRQHVTXHLQGXFHQODTXLPLRWD[LVGHORVHRVLQy¿ORVHLQKLEH
la actividad de los LTh1.
Promueve la
respuesta Th2
Inhibe la
respuesta Th2
Figura 7.30. Efectos antagónicos promovidos por galectina-1
y galectina-3.
6XUROSURLQÀDPDWRULRVHH[SUHVDHQHQIHUPHGDGHVDXWRLQPXQHV
RHVWDGRVLQÀDPDWRULRV5HVSHFWRDVXLQÀXHQFLDVREUHORVFRPSRnentes de la respuesta innata, esta molécula promueve el reclutamiento de polimorfonucleares y macrófagos, a través de interaccioQHVHQWUHGLFKDVFpOXODV\ODVHQGRWHOLDOHV'XUDQWHODLQÀDPDFLyQ
170
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
Figura 7.31. Interacción entre galectina-1 y "entramados" de glicanos. La participación de esta galectina en diversos fenómenos y
actividades asociados a los /7SHUPLWHSRVWXODUODPRGXODFLyQGHVXLQWHUDFFLyQFRQVXVOLJDQGRVHVSHFt¿FRVWDQWRSDUDHYLWDUIHQyPHQRV
LQPXQLWDULRV PHGLDQWHVXLQGXFFLyQ FRPRSDUDLQKLELUODWROHUDQFLDGH/7HQHOPLFURDPELHQWHWXPRUDO PHGLDQWHVXLQKLELFLyQ SURPRYLHQGRXQDUHVSXHVWDLQPXQHHVSHFt¿FD0HWDIyULFDPHQWHSRGUtDGHFLUVHTXHVHWUDWDGHXQDPLVPDDUPDLQPXQROyJLFD ODHVSDGD TXH
SRVHHGRV¿ORVRSXHVWRVTXHSXHGHQVHUXWLOL]DGRVVHJ~QVHDHOUHTXHULPLHQWR
la JDOHFWLQDHVOLEHUDGDDOHVSDFLRH[WUDFHOXODUGRQGHLQGXFHXQD
PD\RULQWHUDFFLyQHQWUHODVFpOXODVLQÀDPDWRULDV\ODVJOLFRSURWHtnas de la matriz, lo cual promueve el reclutamiento y la activación
FHOXODU(OORVHWUDGXFH±SRUHMHPSOR±HQODGHJUDQXODFLyQGHPDVWRFLWRVHQODVtQWHVLVGH,/\GHVXSHUy[LGRVSRUORVPRQRFLWRV\
HQODGH,/\VXSHUy[LGRVSRUORVQHXWUy¿ORV
En relación a los fenómenos apoptóticos, esta galectina funFLRQD GLIHUHQFLDOPHQWH VHJ~Q VHD LQWUD R H[WUDFHOXODU 'HQWUR GH
la célula, su localización mitocondrial inhibe la liberación de citocromo c, lo cual podría favorecer la sobrevida celular en el lugar
GH OD LQÀDPDFLyQ (Q FRQWUDSRVLFLyQ VX XELFDFLyQ H[WUDFHOXODU
promueve –al igual que la JDOHFWLQD±ODapoptosis de los linfoFLWRV 7 (VWD JDOHFWLQD LQGXFH WDPELpQ OD DFWLYLGDG IDJRFtWLFD GH
ORV PDFUyIDJRV \ QHXWUy¿ORV LPSUHVFLQGLEOH SDUD OD HOLPLQDFLyQ
GH SDWyJHQRV FXHUSRV H[WUDxRV R GHWULWRV FHOXODUHV 0iV D~Q OD
JDOHFWLQDSURPXHYHODDFWLYDFLyQDOWHUQDWLYDGHORVPDFUyIDJRV
PHGLDGDSRU,/H,/ HQOXJDUGHODYtDFOiVLFDPHGLDGDSRU
,)1Ȗ $TXHOODV GRV citoquinas –a su vez– inducen la síntesis y
liberación de la mencionada lectina, lo que constituye una retroalimentación positiva. En contraposición con la galectina-1, la galectina-3 suprime la respuesta Th2 mediante la inhibición de la
SURGXFFLyQGH,/SRUORVHRVLQy¿ORVORTXHVXJLHUHXQSRWHQFLDO
UROHQORVSURFHVRVLQÀDPDWRULRVDOpUJLFRV
La galectina-3 está incrementada en LT infectados con
+7/9 OR TXH IDYRUHFH VX VREUHYLGD Este mecanismo antiapoptótico estaría mediado tanto por la secuencia aminoacídica
1:*5 WDPELpQ SUHVHQWH HQWUH ORV PLHPEURV VXSUHVRUHV GH
apoptosis de la familia %FO FRPR SRU XQD LQWHUDFFLyQ GLUHFWD
entre la JDOHFWLQD\ODSURSLDSURWHtQD%FO(QPRGRDQiORJR
la JDOHFWLQDHVWiWDPELpQLQFUHPHQWDGDHQhepatocitos de hígados
cirróticos y tumorales asociados a la infección por HBV, lo que
podría conferir mayor sobrevida a las células transformadas.
4.5. GALECTINA-9
Esta lectina –liberada por los /7DFWLYDGRV±H[KLEHpropiedades
TXLPLRWiFWLFDV SDUD ORV HRVLQy¿ORV, induciendo en ellos la proGXFFLyQGHVXSHUy[LGRV\SURORQJDQGRVXVREUHYLGD(VWDJDOHFWLQDDFW~DHQGLIHUHQWHVIDVHVGHODUHVSXHVWDLQPXQH7Inicialmente, es un potente activador de la maduración de las células dendríticas y de la iniciación de la respuesta inmune adaptativa, lo
que se asocia a la producción de ,/HQIRUPDGRVLVGHSHQGLHQWH
\DOYLUDMHDODSURGXFFLyQGHFLWRTXLQDVGHOLQDMH7K Esta galecti-
na también induce la apoptosis de los timocitos y de ciertas subpoblaciones de /7 SHULIpULFRV Su interacción con TIM-3 T cell
Immunoglobulin domain and Mucin domain-containing protein-3,
XQDPROpFXODGHODVXSHU¿FLHGHORV/7KCD4+ y CTL CD8+,
[pero no de los LTh2]) selectivamente inhibe la respuesta Th1,
promoviendo la apoptosis de los LT CD4+ Th1 y de los CD8+
alorreactivos. La galectina-9 también LQGXFH HVSHFt¿FDPHQWH
la formación de células T reguladoras, DO WLHPSR TXH VLPXOWineamente suprime la generación de células 7KSURLQÀDPDWRULDV
En pacientes con hepatitis C crónica se ha observado que las
FpOXODVGH.SIIHUUHJXODQODDFWLYLGDGFLWRWy[LFDGHORV/7&'+
&7/ mediante la producción de galectina-9, la que es inducida
por el ,)1ȖSURGXFLGRSRUGLYHUVDVFpOXODVLQPXQHV /7K&7/\
1. (VWDJDOHFWLQDSURPXHYHWDQWRODVtQWHVLVGHcitoquinas proinÀDPDWRULDVDQLYHOKHSiWLFRFRPRODDFWLYLGDGGHORV7UHJVCD4+
&'+ )R[3+ HQ XQ PRGR7*)ȕGHSHQGLHQWH OR TXH D VX YH]
favorece la SHUVLVWHQFLDYLUDO )LJXUD 5. APOPTOSIS
La palabra apoptosis proviene de dos vocablos griegos: el elemento preposicional "apó TXH VLJQL¿FD D SDUWLU GH \ HO VXVWDQWLYR
"ptôsis" que indica "caída". La adición del elemento preposicional
indica la duración de un proceso que es gradual y no abrupto, como
lo sugeriría el uso del vocablo único "ptôsis".
Esta forma de muerte celular se contrapone a la necrosis. En los
organismos multicelulares, la apoptosis –o muerte celular programaGD± HV XQ SURFHVR ¿VLROyJLFR TXH QRUPDOPHQWH DVHJXUD XQ EDODQFH
KRPHRVWiWLFRHQWUHODSUROLIHUDFLyQ\HOUHFDPELRFHOXODUHQFDVLWRGRV
ORVWHMLGRV/Dapoptosis es responsable de la remoción de células geQHUDGDVHQH[FHVRFpOXODVTXH\DKDQFRPSOHWDGRVXVIXQFLRQHVHVSHFt¿FDVRFpOXODVTXHVRQGDxLQDVSDUDHORUJDQLVPRVLHQGRSDUWLFXlarmente importante durante el desarrollo embrionario, la renovación
WLVXODU\ODH[SRVLFLyQDFRPSXHVWRVWy[LFRV3RUORWDQWRODapoptosis
es un proceso celular genéticamente controlado por el que las células
inducen su propia muerte en respuesta a determinados estímulos. Sin
embargo, la apoptosis se encuentra también involucrada en diferentes
FRQGLFLRQHVSDWROyJLFDVGRQGHXQDH[FHVLYDRLQVX¿FLHQWHPXHUWHFHlular puede contribuir al desarrollo de enfermedades humanas entre las
que se encuentran enfermedades neurodegenerativas, cardiovasculares, inmunológicas y tumorales.
La apoptosis fue descripta por primera vez por Kerr et al.,
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
171
Figura 7.32. Expresión aumentada de galectina-9 en células de Küpffer de pacientes infectados con HCV. Inmunohistoquímica a
SDUWLUGHPDWHULDOGHELRSVLDSDUD¿QDGR$&RQWUROQHJDWLYRWHxLGR~QLFDPHQWHFRQXQDQWLFXHUSRVHFXQGDULR0DJQL¿FDFLyQ[B.
Tinción de JDOHFWLQD FRORUPDUUyQ HQXQKtJDGRKXPDQRQRUPDO [ C. Tinción de JDOHFWLQDHQXQSDFLHQWHLQIHFWDGRFRQ+&9 [ D. Expresión periportal de JDOHFWLQDHQXQSDFLHQWHLQIHFWDGRFRQ+&9 [ E. Colocalización de galectina-9 (marrón) y CD68 (marcador
de FpOXODVGH.SIIHUHQURMR [)XHQWH0HQJVKRO-$et alPLoS ONE HGRLMRXUQDOSRQH5HSURGXFLGRSDUFLDOPHQWHFRQDXWRUL]DFLyQ
HQ\HVGH¿QLGDSRUFDPELRVPRUIROyJLFRVHQODFpOXODTXH
consisten en una disminución del volumen celular, cambios en la
PHPEUDQD SODVPiWLFD membrane blebbing ±TXH FRQOOHYDQ D OD
formación de los cuerpos apoptóticos–, condensación de la cromaWLQDQXFOHDU\ODIUDJPHQWDFLyQGHOQ~FOHR )LJXUDV\ Las características bioquímicas asociadas con la apoptosis incluyen
HOFOLYDMHLQWHUQXFOHRVRPDOGHO'1$ YpDVHOD¿JXUDFRUUHVSRQGLHQWHDODYtDH[WUtQVHFD H[WHUQDOL]DFLyQGHODIRVIDWLGLOVHULQD
TXHSXHGHGRFXPHQWDUVHPHGLDQWHODWLQFLyQFHOXODUFRQ$QH[LQD
9 \HOFOLYDMHSURWHROtWLFRGHXQQ~PHURGHVXVWUDWRVFHOXODUHV/D
fosfatidilserina –normalmente localizada en la cara interna de la
PHPEUDQDSODVPiWLFD–VHH[SRQHVREUHODVXSHU¿FLHH[WHUQDGRQde provee la señal de reconocimiento para las células fagocíticas.
&RPR UHVXOWDGR GH ORV FDPELRV HQ OD PHPEUDQD SODVPiWLFD ODV
FpOXODV DSRSWyWLFDV VRQ UiSLGDPHQWH IDJRFLWDGDV HQ IRUPD SUHYLD
a la liberación del contenido intracelular y sin inducción de una
UHVSXHVWDLQÀDPDWRULD
La apoptosis puede ser disparada como una respuesta celular a
HVWtPXORVGHOPHGLRH[WHUQRRGHOLQWHULRUFHOXODU3RUHOORP~OWLSOHV
cascadas apoptóticas han sido descriptas, las que tienen en consiGHUDFLyQD ODVVHxDOHVH[WUtQVHFDVRLQWUtQVHFDVE HOHVWtPXORGH
receptores de muerte o desde la PLWRFRQGULDF ODSDUWLFLSDFLyQR
QRGHS\ODSDUWLFLSDFLyQRQRGHODVFDVSDVDV FLVWHtQDSURWHDVDV
TXHFOLYDQSURWHtQDVFRQiFLGRDVSiUWLFR 6LQHPEDUJRODapoptosis
QR HV HO GHVHQODFH GH XQD VHULH GH YtDV FODUDPHQWH GH¿QLGDV VLQR
que por el contrario, es el resultado de una multitud de vías interconectadas y altamente reguladas. Por ende, el mencionar a las vías
como perteneciente a una u otra naturaleza, obedece meramente a
XQDVLPSOL¿FDFLyQGLGiFWLFD$VXYH]ODapoptosis puede ser consiGHUDGDXQGHVWLQR¿QDOTXHSDUWLFLSDFRPRUHVXOWDGRGHGLYHUVRV
mecanismos de defensa, también como un proceso a ser regulado
en el desarrollo de una determinada infección viral. Diversos virus
pueden inhibir o promover la DSRSWRVLV0iVD~QXQPLVPRYLUXV\
–a veces aun– una misma proteína viral pueden inducir uno u otro
efecto, dependiendo de condiciones del microambiente celular.
En la vía de muerte celular intrínseca, la iniciación de la
apoptosis ocurre como resultado de una alteración en la homeos-
tasis intracelular. En esta vía la mitocondria desempeña un rol crítico. La inducción de la apoptosis por la vía de muerte celular
extrínseca se realiza a través de la interacción de los receptores
GHPXHUWH '5>Death [email protected] para )DVyHO
UHFHSWRUSDUD71)>Tumor Necrosis [email protected]Į FRQVXVUHVSHFWLYRVOLJDQGRVGHPXHUWH '5/>Death Receptor [email protected])DV/
>OLJDQGRGH)[email protected]\71)Į 7DPELpQSXHGHGLVSDUDUVHODapoptosis
PHGLDQWH OD DFWLYLGDG GHO VLVWHPD VHFUHWRULR GH FpOXODV FLWRWy[LFDV &7/FRQIHQRWLSR&'+ –o infrecuentemente CD4+– y 1. a través de dos proteínas que alteran las membranas –perforina y
granulisina– y granzimas. La apoptosis inducida por granulisina
acontece mediante mecanismos aún no totalmente dilucidados,
mientras que la JUDQ]LPD%DFWLYDODYtDH[WUtQVHFDGHODVcaspasas.
La apoptosis puede ser, a su vez, separada en al menos tres fases
distintas: iniciación, LQWHJUDFLyQGHFLVLyQ \ HMHFXFLyQGHJUDGDFLyQ
La fase de iniciación depende estrictamente de la naturaleza de la
señal letal que, como se mencionó anteriormente, puede provenir del
PHGLRLQWUDFHOXODURH[WUDFHOXODU(QODIDVHGHintegración/decisión
HVWiQ LPSOLFDGDV QXPHURVDV PROpFXODV SUR \ DQWLDSRSWyWLFDV ODV
FXDOHVVHRSRQHQPXWXDPHQWHGHFLGLHQGRHOGHVWLQR¿QDOGHODFpOXOD
\HOSDVDMHGHOSXQWRGHQRUHWRUQR/DIDVH¿QDOGHHMHFXFLyQLQYROXFUDXQFRQMXQWRGHIHQyPHQRVGHGHJUDGDFLyQpost-mortem los que
producen las manifestaciones fenotípicas de la apoptosis.
5.1. FAMILIA DE LAS CASPASAS
Las caspasas constituyen una familia de proteínas intracelulares
involucradas en la DSRSWRVLVRHQODLQÀDPDFLyQ6HKDQGHVFULSWR
caspasas en células humanas, algunas de las cuales pertenecen a
la subfamilia involucrada en la activación de FLWRTXLQDV caspasas
\ \RWUDVDODVXEIDPLOLDLQYROXFUDGDHQODDSRSWRVLV casSDVDV\ 'HQWURGHHVWDV~OWLPDVDOJXQDV
VRQLQLFLDGRUDV FDVSDVDV\ \RWUDVHIHFWRUDV \ GHOSURFHVRDSRSWyWLFR/DDFWLYDFLyQGHODVcaspasas efectoras representa, dentro de la cascada de señalización, el punto de
compromiso apoptótico de la célula.
Las caspasas son sintetizadas como procaspasas, las cuales
172
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
)LJXUD'HWHUPLQDFLyQPHGLDQWHWLQFLyQGH+RHFKVW\PLFURVFRStDGHÀXRUHVFHQFLDGHODapoptosis tardía en células HeLa
con y sin expresión transitoria de las proteínas Core de los genotipos 1b y 2c del virus hepatitis C (HCV) durante 24 h. y luego
tratadas con staurosporina (STR). A.&pOXODVWUDQVIHFWDGDVFRQHOSOiVPLGRFRQWUROVLQHOJHQFRUHB.&pOXODVFRQH[SUHVLyQWUDQVLWRULD
de &RUHEGXUDQWHKC.&pOXODVFRQH[SUHVLyQWUDQVLWRULDGH&RUHFGXUDQWHKD.&pOXODVWUDQVIHFWDGDVFRQHOSOiVPLGRFRQWURO\
OXHJRGHKWUDWDGDVFRQ675—0GXUDQWHKE.&pOXODVFRQH[SUHVLyQWUDQVLWRULDGH&RUHEGXUDQWHKWUDWDGDVFRQ675
—0 HQODV~OWLPDVKGHH[SUHVLyQ F.&pOXODVFRQH[SUHVLyQWUDQVLWRULDGH&RUHFGXUDQWHKWUDWDGDVFRQ675—0 HQ
ODV~OWLPDVKGHH[SUHVLyQ )XHQWH0LQDVVLDQ0/WHVLVGRFWRUDO)DFXOWDGGH)DUPDFLD\%LRTXtPLFD8%$
VRQ SRVWHULRUPHQWH SURFHVDGDV PHGLDQWH FOLYDMH \ VXEVLJXLHQWH
oligomerización para constituir sus formas activas tetraméricas.
El dominio NH-terminal de las FDVSDVDVH[KLEHXQDORQJLWXGYDriable, dependiendo de la categoría funcional a la que pertenezca.
Las caspasas iniciadoras de la DSRSWRVLV\ODVLQÀDPDWRULDVSRVHHQ
SURGRPLQLRVODUJRV PD\RUHVDDPLQRiFLGRV PLHQWUDVTXHODV
caspasas efectoras de la apoptosis contienen prodominios cortos
PHQRUHV D DPLQRiFLGRV $ VX YH] ORV SURGRPLQLRV ODUJRV
FRQWLHQHQ PRWLYRV HVSHFt¿FRV HVHQFLDOHV SDUD OD DFWLYLGDG (VWRV
PRWLYRVSXHGHQVHUGRPLQLRVHIHFWRUHVGHPXHUWH Death Effector Domains>'('[email protected] RGRPLQLRVGHUHFOXWDPLHQWRGHcaspasas"
Caspase Recruitment Domains >&$5'[email protected] /RV PLVPRV PHGLDQ
las interacciones entre las caspasas y una variedad de moléculas
adaptadoras involucradas en la señalización celular. Las caspasas
que contienen dominios DED son caspasas iniciadoras, mientras
que las caspasas que contienen dominios CARD pueden ser caspasas iniciadoras o FDVSDVDVLQÀDPDWRULDV
La inducción de la apoptosis a través de los mecanismos de
PXHUWHH[WUtQVHFRVRLQWUtQVHFRVUHVXOWDHQODDFWLYDFLyQGHODVcaspasas iniciadoras de la DSRSWRVLV/RVUHFHSWRUHVGHPXHUWH '5V
o Death ReceptorHQLQJOpV DWUDYpVGHPROpFXODVDGDSWDGRUDV
reclutan a las FDVSDVDVLQLFLDGRUDVRPLHQWUDVTXHODVVHñales de muerte intrínseca resultan en la activación de la caspasa-9.
La activación de las caspasas iniciadoras constituye el primer paso
de una vía proteolítica altamente regulada, irreversible y retroalimentada. Estas caspasas son capaces de clivar procaspasas y por
lo tanto, capaces de activar a las FDVSDVDVHIHFWRUDV FDVSDVDV
\ RGHDPSOL¿FDUODFDVFDGDSRUXQDXPHQWRHQODDFWLYDFLyQ
de las caspasas iniciadoras. Las caspasas efectoras son comunes
DDPEDVYtDVGHPXHUWH H[WUtQVHFDHLQWUtQVHFD SRUORWDQWRODV
características morfológicas y bioquímicas de la apoptosis son relativamente independientes del inductor apoptótico.
A través del procesamiento proteolítico, las caspasas pueden acWLYDU R LQKLELU GLIHUHQWHV SURWHtQDV TXH H[KLEHQ UROHV WDOHV FRPR OD
manutención de la morfología celular, la muerte celular, el metabolismo del DNA, la regulación del ciclo celular o la transducción de
VHxDOHV/DHVSHFL¿FLGDGGHODVcaspasas para dichos blancos resulta
HQXQDFRQWURODGD\H¿FLHQWHUHPRFLyQGHFpOXODVGDxDGDVRSUHVFLQGLEOHVHQXQWHMLGR$VtSRUHMHPSORODIUDJPHQWDFLyQROLJRQXFOHRVRPDO
GHO'1$HVFDXVDGDSRUODDFFLyQGHODFDVSDVDVREUHHOFRPSOHMR
&$'L&$' Caspase-Activated DNase / inactive &$' YpDVHOD¿JXUD'XUDQWHODapoptosis, dicha caspasa cliva al inhibidor iCAD
permitiendo que la nucleasa CAD corte la cromatina. Por otra parte,
es conocido que las caspasas producen cambios en la morfología ceOXODUSRUFOLYDMH\DFWLYDFLyQGHODVSURWHtQDVJHOVROLQD\IRGULQDSURGXFLHQGRODGLVRFLDFLyQGHODPHPEUDQDSODVPiWLFDGHOFLWRHVTXHOHWR
7DPELpQSXHGHQFOLYDUDODSURWHtQD5EGHVUHJXODQGRHOFLFORFHOXODUR
clivar proteínas implicadas en la adhesión celular, entre otras.
5.2. FAMILIA DE PROTEÍNAS B CL -2
Como lo indica su nombre, el gen bcl-2 fue descubierto en linfomas humanos de células B donde, por translocación cromosómica,
VHXELFyHQ\X[WDSRVLFLyQFRQORVHOHPHQWRVSRWHQFLDGRUHVGHOD
WUDQVFULSFLyQ enhancers HQHOORFXVGHODFDGHQDSHVDGDGHODVLQPXQRJOREXOLQDV(OUHVXOWDGRIXHODGHVUHJXODFLyQGHODH[SUHVLyQ
GHOPLVPR\SRUORWDQWRODVREUHH[SUHVLyQGHODSURWHtQD%FO'H
esta forma, bcl-2 es considerado un proto-oncogén que prolonga la
vida celular por inhibir la apoptosis.
+DQVLGRLGHQWL¿FDGDVYDULDVSURWHtQDVKRPyORJDVD%FOHQ
vertebrados, constituyendo la familia de proteínas %FO(VWDIDmilia incluye proteínas que pueden promover la supervivencia o la
muerte celular. Las cantidades relativas o el equilibrio entre estas
SURWHtQDVDQWL\SURDSRSWyWLFDVLQÀXHQFLDQODVXVFHSWLELOLGDGGH
las células a las señales de muerte.
0DVDOOiGHVXUROHQODDSRSWRVLVODFODVL¿FDFLyQGHORVPLHPbros de esta familia esta basada en la presencia o ausencia de dominios con homología %FO GRPLQLRV%+ +DQVLGRGHVFULSWRVFXDWURGRPLQLRV%+%+%+%+\%+ORVFXDOHVFRUUHVSRQGHQ
DVHJPHQWRVĮKHOLFRLGDOHV/DVSURWHtQDVDQWLDSRSWyWLFDV%FO
Bcl-XL0FO%FO:FRQWLHQHQORVFXDWURGRPLQLRVPLHQWUDVTXH
ODV SURWHtQDV SURDSRSWyWLFDV HVWiQ FDUDFWHUL]DGDV SRU OD SpUGLGD
GHOGRPLQLR%++DQVLGRLGHQWL¿FDGDVGRVVXEIDPLOLDVGHPLHPbros pro-apoptóticos de la familia %FOODIDPLOLDED[ %D[%DN
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
173
Figura 7.34. Vía intrínseca de la apoptosis. 9pDVHHOWH[WR)XHQWH0LQDVVLDQ0/WHVLVGRFWRUDO)DFXOWDGGH)DUPDFLD\%LRTXtPLFD8%$
Figura 7.35. Vía intrínseca de la apoptosis. 'HWHUPLQDFLyQPHGLDQWHPDUFDFLyQFRQ$QH[LQD9),7&,RGXURGHSURSLGLR ,3 \FLWRPHWUtD
GHÀXMRGHODDSRSWRVLVWHPSUDQD\WDUGtDQHFURVLVHQFpOXODV+H/DFRQ\VLQH[SUHVLyQWUDQVLWRULDGHODVSURWHtQDVCore de los genotipos 1b
\FGHOYLUXVKHSDWLWLV& +&9 GXUDQWHK\OXHJRWUDWDGDVFRQVWDXURVSRULQD 675 , A.&pOXODVWUDQVIHFWDGDVFRQHOSOiVPLGRFRQWURO
sin el gen core B.&pOXODVFRQH[SUHVLyQWUDQVLWRULDGH&RUHEGXUDQWHKC. &pOXODVFRQH[SUHVLyQWUDQVLWRULDGH&RUHFGXUDQWHK
D.&pOXODVWUDQVIHFWDGDVFRQHOSOiVPLGRFRQWURO\OXHJRGHKWUDWDGDVFRQ675—0GXUDQWHK(&pOXODVFRQH[SUHVLyQWUDQVLtoria de &RUHEGXUDQWHKWUDWDGDVFRQ675—0 HQODV~OWLPDVKGHH[SUHVLyQ F. &pOXODVFRQH[SUHVLyQWUDQVLWRULDGHCore
FGXUDQWHKWUDWDGDVFRQ675—0 HQODV~OWLPDVKGHH[SUHVLyQ 6HPXHVWUDQORVSRUFHQWDMHVGHFpOXODVHQapoptosis tardía/
QHFURVLV FXDGUDQWHVXSHULRUGHUHFKR \HQDSRSWRVLVWHPSUDQD FXDGUDQWHLQIHULRUGHUHFKR HQORVJUi¿FRVGHÀXRUHVFHQFLDHPLWLGDSRU,3
HQIXQFLyQGHODÀXRUHVFHQFLDHPLWLGDSRU$QH[LQD9),7&/RVUHVXOWDGRVFRUUHVSRQGHQDOSURPHGLRGHH[SHULPHQWRVLQGHSHQGLHQWHV
,, &RPSDUDFLyQGHSRUFHQWDMHVGHFpOXODVHQapoptosis temprana, tardía/necrosis y apoptosis total determinada mediante marcación con
$QH[LQD9),7&,3\FLWRPHWUtDGHÀXMRFRUUHVSRQGLHQWHVDODVLPiJHQHVGHOFXDGURVXSHULRU , S 174
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
%RN TXHFRQWLHQHQORVGRPLQLRV%+%+\%+\ODIDPLOLD
%+only %LG%LP%LN%DG%PI+UN1R[D\380$ TXH
FRPR VX QRPEUH OR LQGLFD VyOR FRQWLHQHQ HO GRPLQLR %+ 6H
presume que este dominio es un dominio de muerte crítico en los
miembros pro-apoptóticos. Muchos miembros de la familia %FO
FRQWLHQHQXQGRPLQLRKLGURIyELFRHQHOH[WUHPR&22+WHUPLQDO
GRPLQLR70 TXH SHUPLWH OD LQVHUFLyQ GH OD SURWHtQD HQ OD FDUD
citosólica de membranas intracelulares. No todas las proteínas de
la familia %FOSRVHHQGRPLQLRV70
5.3. VÍA INTRÍNSECA DE LA APOPTOSIS
En la vía intrínseca de muerte celular las señales pro-apoptóticas
resultan de una alteración en la homeostasis intracelular. La mitocondria es el principal sitio de iniciación intracelular aunque
WDPELpQKDVLGRLPSOLFDGRHOUHWtFXORHQGRSOiVPLFR 5( 8QJUDQ
Q~PHURGHSURWHtQDVDSRSWyWLFDVHVWiQFRPSDUWLPHQWDOL]DGDVGHQtro de la PLWRFRQGULDGHVGHGRQGHVRQOLEHUDGDVDQWHXQDLQMXULD
DSRSWyWLFD FRORFiQGRODV HQ SUR[LPLGDG FRQ VXV VLWLRV GH DFFLyQ
)LJXUD (Ocitocromo c F\Wc ±QRUPDOPHQWHORFDOL]DGRHQ
el espacio intermembrana de la mitocondria– es liberado al citosol donde interactúa con $SDI Apoptotic Protease-Activating
Factor-1, R )DFWRU DFWLYDGRU GH SURWHDVDV DSRSWyWLFDV $73
G$73\FDVSDVDSDUDIRUPDUHODSRSWRVRPD$SDIFRQWLHQH
un dominio CARD, a través del cual interactúa con la caspasa-9.
En presencia de cyt c\$73G$73$SDIH[SHULPHQWDXQFDPELR
FRQIRUPDFLRQDO TXH SHUPLWH VX DXWRDJUHJDFLyQ (VWR H[SRQH HO
dominio CARD induciendo el reclutamiento de la procaspasa-9 y
su subsiguiente activación proteolítica. Luego, la caspasa-9 puede
activar directamente a las FDVSDVDV\UHVXOWDQGRHQXQDPXHUWHRUGHQDGDDWUDYpVGHFRQWURODGRVFOLYDMHVSURWHROtWLFRVGHYDULDV
GLDQDVFRUULHQWHDEDMR6PDF',$%/2 Second Mitochondrial Activator of Caspases /Direct IAP-Binding protein of LOw isoelectric point>[email protected] \2PL+WU$ Omi stress-regulated endoprotease/
High Temperatura Requirement protein A2 WDPELpQVRQOLEHUDGRV
desde la mitocondria al citosol en respuesta a un estímulo apoptótico. 6PDF',$%/2\2PL+WU$VHXQHQDORVGRPLQLRV%,5
Baculovirus IAP Repeat SUHVHQWHVHQODVSURWHtQDVLQKLELGRUDVGH
la DSRSWRVLV,$3V Inhibitor of Apoptosis Proteins HOLPLQDQGRVX
efecto inhibitorio sobre la actividad de las caspasas.
Otro factor implicado en la apoptosis es el $,) Apoptosis Inducing Factor (VWHIDFWRULQGXFWRUGHODDSRSWRVLVHVXQDÀDYRSURteína mitocondrial que se transloca al núcleo luego de un estímulo
apoptótico, donde induce la fragmentación parcial del DNA y la condensación de la cromatina. De igual forma actúa la endonucleasa G
(QGR* OXHJRGHVHUOLEHUDGDDOFLWRVROAIF y Endo G promueven
la apoptosis independientemente de la activación de caspasas.
$PRGRGHHMHPSORVHLQFOX\HQLPiJHQHVGHapoptosis celular
LQGXFLGDSRUODYtDLQWUtQVHFDFRPRFRQVHFXHQFLDGHODH[SUHVLyQin
vitro del gen coreGHOYLUXVKHSDWLWLV&HQFpOXODV+H/D )LJXUD 5.3.1. Rol de las proteínas de la familia
Bcl-2 en la regulación de la apoptosis
/DSHUPHDELOL]DFLyQGHODPHPEUDQDPLWRFRQGULDO 300 HVFRQsiderada como "el punto de no retorno" dentro de la cascada de
eventos que llevan a la muerte celular programada. La PMM afecta
WDQWRDODPHPEUDQDPLWRFRQGULDOLQWHUQDFRPRH[WHUQDFXOPLQDQdo en la liberación de factores apoptogénicos que normalmente
HVWiQFRQ¿QDGRVDOHVSDFLRLQWHUPHPEUDQDGHODmitocondria, incluyendo los activadores de FDVSDVDV FRPRF\Wc \ORVHIHFWRUHV
de muerte independiente de FDVSDVDV FRPR$,) Las proteínas de la familia %FO DQWL\SURDSRSWyWLFDV UHgulan la DSRSWRVLVHMHUFLHQGRVXDFFLyQVREUHODmitocondria. Los
miembros pro-apoptóticos de la familia %FO SXHGHQ LQGXFLU OD
PMM, mientras que los miembros anti-apoptóticos preservan la integridad mitocondrial, bloqueando de esta manera la liberación de
las proteínas solubles de intermembrana. Se han propuesto diferenWHVPHFDQLVPRVSDUDH[SOLFDUHODXPHQWRHQOD300DVRFLDGDFRQ
ODPXHUWHFHOXODU ODVHxDOGHPXHUWHSXHGHDFWLYDUDODVSURWHtQDV
pro-apoptóticas de la familia %FOODVFXDOHVVHSXHGHQPRYLOL]DU
GHVGH HO FLWRVRO D OD PHPEUDQD PLWRFRQGULDO H[WHUQD %D[ %LG R H[SHULPHQWDU FDPELRV FRQIRUPDFLRQDOHV %DN SDUD SURPRYHU
la formación de grandes canales homo- o hétero-multiméricos a
WUDYpV GH ORV FXDOHV VRQ OLEHUDGRV ORV IDFWRUHV DSRSWRJpQLFRV los miembros pro-apoptóticos de la familia %FODFWLYDGRVSXHGHQ
LQWHUDFWXDUFRQFRPSRQHQWHVGHOFRPSOHMRGHOSRURGHWUDQVLFLyQ
GH OD SHUPHDELOLGDG 373& Permeability Transition Pore Complex IDYRUHFLHQGR RLQKLELHQGR ODSHUPHDELOLGDGWUDQVLWRULDGHOD
membrana mitocondrial interna, lo que conduce a la ruptura física
GH OD PHPEUDQD PLWRFRQGULDO H[WHUQD (VWRV GRV PHFDQLVPRV QR
QHFHVDULDPHQWHVRQPXWXDOPHQWHH[FOX\HQWHV
Luego de una variedad de señales de muerte, las proteínas que
VyORH[KLEHQXQGRPLQLR%+ HQLQJOpV%+only H[SHULPHQWDQPRGL¿FDFLRQHVSRVWWUDGXFFLRQDOHV SRUHMHPSORGHVIRVIRULODFLyQFOLYDMHSURWHROtWLFR UHVXOWDQGRHQODDFWLYDFLyQ\PRYLOL]DFLyQGHGLFKDVSURWHtQDVDODPHPEUDQDPLWRFRQGULDOGRQGHHMHUFHQ
VXV IXQFLRQHV ELROyJLFDV /DV PROpFXODV %+only FRPR Bid,
%LP%DG\1R[D UHTXLHUHQGH%D[\%DNSDUDHMHUFHUVXVDFWLYLdades pro-apoptóticas mitocondriales.
%D[\%DNGL¿HUHQHQVXORFDOL]DFLyQLQWUDFHOXODUDQWHVGHOHVtímulo de muerte celular. Mientras que Bak es una proteína integral
GHODPHPEUDQDPLWRFRQGULDOH[WHUQD%D[UHVLGHFRPRPRQyPHUR
en el citosol de las células viables. La activación de %D[FRQGXFH
a su reubicación e LQWHJUDFLyQHQODPHPEUDQDPLWRFRQGULDOH[WHUQD OXHJR GH H[SHULPHQWDU XQ FDPELR FRQIRUPDFLRQDO TXH H[SRQH ORV H[WUHPRV 1+ \ &22+WHUPLQDO GRQGH IRUPD FRPSOHMRV
homo-oligoméricos que resultan en poros por donde son liberados
los factores apoptogénicos. La oligomerización de %D[OXHJRGHVX
inserción mitocondrial gatilla un cambio conformacional en Bak
provocando su homo-oligomerización. La oligomerización y/o activación de %D[\%DNSXHGHVHUWDPELpQLQGXFLGDSRUODSURWHtQDSUR
DSRSWyWLFD%+only" truncada %LG W%LG 'LFKDSURWHtQDWDPELpQ
puede insertarse en la membrana mitocondrial. La disrupción de la
membrana mitocondrial por las proteínas %D[\W%LGSXHGHRFXUULU
también por un mecanismo independiente de caspasas.
La proteína anti-apoptótica %FOSUHYLHQHODWUDQVORFDFLyQFLtosólica-mitocondrial de %D[ODROLJRPHUL]DFLyQGH%D[\%DNHQ
la membrana mitocondrial y la inserción de tBid, al interaccionar
con ellas formando heterodímeros neutralizando sus actividades
pro-apoptóticas. Por otro lado, el gen bcl-x puede generar dos proteínas por un mecanismo de "splicing" alternativo: Bcl-XL IRUPD
PiVODUJD>[email protected] \%FO;S IRUPDPiVFRUWD>[email protected] $PEDV
proteínas tienen funciones antagónicas, mientras Bcl-XL promueve
la supervivencia celular, Bcl-XS activa la apoptosis al unirse a BclSUHYLQLHQGRGHHVWDPDQHUDODLQWHUDFFLyQGHHVWD~OWLPDFRQ%D[
ODFXDOSXHGHHMHUFHUGHHVWDPDQHUDVXVIXQFLRQHVSURDSRSWyWLFDV
En presencia de señales de supervivencia, Bad se encuentra fosforilada y secuestrada en el citosol al interaccionar con la proteína
± )UHQWH D XQ HVWtPXOR DSRSWyWLFR %DG HV GHVIRVIRULODGD
OLEUiQGRVHGHGLFKDLQWHUDFFLyQ\SXGLHQGRDVtHMHUFHUVXVDFWLYLGDdes pro-apoptóticas. %D[WDPELpQSUHVHQWDXQDUHJXODFLyQQHJDWLYD
SRU OD SURWHtQD ± \ VX GLVRFLDFLyQ SXHGH RFXUULU WDQWR SRU
mecanismos dependientes o independientes de caspasas.
7DPELpQ VH KD SRVWXODGR TXH ORV PLHPEURV SURDSRSWyWLFRV
de la familia %FOFRPR%D[\%DNFDXVDQODDSHUWXUDGHOSRUR
GHO373&PLHQWUDVTXHORVPLHPEURVDQWLDSRSWyWLFRVFRPR%FO
y Bcl-XL favorecen el cierre de estos canales. La apertura de los
poros de transición de la permeabilidad causa la disipación del poWHQFLDOGHWUDQVPHPEUDQDPLWRFRQGULDOSURYRFDQGRXQLQÀXMRGH
ÀXLGRVGHQWURGHODmitocondria. Se ha postulado que el resultado
HVODUXSWXUDGHODPHPEUDQDPLWRFRQGULDOH[WHUQD\ODOLEHUDFLyQ
de las proteínas pro-apoptóticas. Sin embargo, se ha demostrado
que la liberación de cyt c ocurre antes de la pérdida del potencial
de membrana mitocondrial.
5.3.2. Rol de las proteínas c-IAPs
en la regulación de la apoptosis
En las células normales que no hubieran recibido estímulos apoptóti-
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
175
Figura 7.36. Vía extrínseca de la apoptosis mediada por Fas. 2EVpUYHVHODUHODFLyQHQWUHODVYtDVH[WUtQVHFDHLQWUtQVHFD9pDVHHOWH[WR
)XHQWH0LQDVVLDQ0/WHVLVGRFWRUDO)DFXOWDGGH)DUPDFLD\%LRTXtPLFD8%$
Figura 7.37. Vía extrínseca de la apoptosis mediada por 71)Į9pDVHHOWH[WR)XHQWH0LQDVVLDQ0/WHVLVGRFWRUDO)DFXOWDGGH
)DUPDFLD\%LRTXtPLFD8%$
176
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
A
%
+
K
CD8+ CTL
++
++
+
+
CD4+ CTL
+
+
CD4+ Tregs
-
+
NK
+
+/-
&pOXODVPLHORLGHV
-
+
Rápida pérdida de la integridad de la membrana plasmática*
+
+
+
+
?
Traslocación de fosfatidil serina al lado externo de la
membrana plasmática
+
+
+
+
?
Condensación de la cromatina
+
+
+
+
?
Granzima
M
Expresión
+
Características comunes
'DxRGHO'1$QXFOHDU
+
+
+
+
?
Despolarización mitocondrial
+
+
+
+
?
Activación de las caspasas
-
+
-
-
?
)UDJPHQWDFLyQROLJRQXFOHRVyPLFDGHO'1$
-
+
-
-
?
Cortes en el DNA de cadena única
+
-
+
+
-
Marcación con TdT (terminal d-transferasa)
+
+
+
+
?
Marcación con el fragmento de Klenow de la DNA polimerasa
+
+
+
+
-?
Tipo del daño del DNA
Tipo de daño mitocondrial
,QKLELFLyQPHGLDQWHVREUHH[SUHVLyQGH%FO
-
+
?
?
?
Liberación del citocromo c
-
+
+?
?
?
+LQFKD]yQPLWRFRQGULDO
+
+
++
+
+
$XWRIDJLD
-
-
-
-
+?
Tabla 7.10. Características de las diferentes vías de muerte celular inducida por las granzimas. 0HGLGDPHGLDQWH FDSWDFLyQ GH LRGXUR GH SURSLGLR \ FLWRPHWUtD GH ÀXMR 0HGLGD PHGLDQWH WLQFLyQ FRQ DQH[LQD 9 \ FLWRPHWUtD GH ÀXMR
)XHQWH&KRZGKXU\' /LHEHUPDQJ.; Annual Reviews in Immunology,
cos, la activación aberrante de las caspasas se encuentra inhibida por
las ,$3 Inhibitor of Apoptosis Proteins /DVSULPHUDVIAP fueron
LGHQWL¿FDGDV HQ HO JHQRPD GH ORV EDFXORYLUXV YLUXV GH LQVHFWRV al observarse su capacidad de suprimir la apoptosis en células de
insectos infectadas. Las proteínas humanas c-IAP, c-IAP y XIAP
X-linked Inhibitor of Apoptosis homólogas a las IAP de los baFXORYLUXV FRQWLHQHQ HQ VX H[WUHPR 1+-terminal dominios BIRs
Baculovirus IAP Repeats PHGLDQWHORVFXDOHVVHXQHQHLQDFWLYDQ
las FDVSDVDVHIHFWRUDV\\ODFDVSDVD/DVFIAP poseen una
forma dual de impedir la función de las caspasas, a través del bloqueo de sus sitios activos y mediante su ubiquitinación conduciendo
a su degradación proteosomal. Este último sería un mecanismo de
seguridad contra el escape de FDVSDVDV DFWLYDGDVHVSRQWiQHDPHQWH a la inhibición directa de las c-IAP en células no apoptóticas. Las
c-IAP contienen un dominio con actividad de ubiquitina-ligasa, que
cataliza la ubiquitinación de las caspasas, así como de sí mismas y
–por ende– su degradación por la vía del proteasoma ante estímulos
inductores de apoptosis. Las c-IAP también podrían inhibir la apopWRVLVLQGXFLGDSRUODLQWHUDFFLyQGHO71)D\VXUHFHSWRU 71)5 debido a que interaccionan mediante sus BIR con los factores asoFLDGRVDO71)575$)\75$) YHUtWHP /D H[SUHVLyQ GH ORV JHQHV FRGL¿FDQWHV SDUD ODV FIAP es diUHFWDPHQWHHVWLPXODGDSRUHOIDFWRUGHWUDQVFULSFLyQ1)N%/RV
mecanismos centrales de supresión apoptótica de las c-IAP operan
mediante inhibición de caspasas y mediante modulación del factor
GHWUDQVFULSFLyQ1)ț%/DVF,$3VVRQLQGXFLGDVSRU1)ț%\D
VXYH]±DWUDYpVGHVXLQWHUDFFLyQFRQ75$)\75$)±SXHGHQ
SRWHQFLDUODDFWLYDFLyQGH1)ț%IRUPDQGRXQEXFOHGHUHWURDOLmentación positiva. Por otra parte, las proteínas pro-apoptóticas
6PDF',$%/2 \ 2PL+WU$ ±XQD YH] OLEHUDGDV GHVGH OD mitocondria tras un estímulo apoptótico– se unen a los dominios BIR
presentes en las proteínas inhibidoras de la apoptosis c-IAP eliminando su efecto inhibitorio sobre la actividad de las caspasas.
5.4. VÍA EXTRÍNSECA DE LA APOPTOSIS
(QODYtDH[WUtQVHFDODVHxDOOHWDOSURYLHQHGHOPHGLRH[WUDFHOXODU
/RVUHFHSWRUHVGHPXHUWH '5V SHUWHQHFHQDODVXSHUIDPLOLDGHUHFHSWRUHVGHO71) 71)5 7UDQVPLWHQVXVVHxDOHVGHPXHUWHOXHJR
de la unión con sus respectivos ligandos de muerte. Los miembros
GHODIDPLOLDPHMRUFDUDFWHUL]DGRVVRQORVUHFHSWRUHVSDUD)DV R
$SR \71)5DXQTXHWDPELpQVHFRQRFHQORVUHFHSWRUHV'5
R$SR '5'5 R$SR \'5(VWRVUHFHSWRUHVGHWUDQVPHPEUDQD HVWiQ FDUDFWHUL]DGRV SRU SRVHHU GRPLQLRV H[WUDFHOXODUHVULFRVHQ&LVWHtQD Cysteine-Rich Domains>&5'@ \GRPLQLRV
LQWUDFHOXODUHV GH PXHUWH Death Domains >''[email protected] /XHJR GH OD
unión receptor-ligando, se produce la auto-asociación del receptor y su subsiguiente activación donde -mediante la interacción de
los DDs- son reclutadas otras proteínas que contienen los mismos
dominios y funcionan como moléculas adaptadoras dentro de la
cascada de transducción de señales.
5.4.1. Señalización mediada por Fas/FasL
La interacción )DV)DV/SURPXHYHHOUHFOXWDPLHQWRGHODSURWHtQD
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
citosólica )$'' Fas-Associated Death Domain protein ODFXDO
DGHPiVGHORVGRPLQLRV''VFRQWLHQHXQGRPLQLR1+-terminal
DED responsable de su asociación con otras proteínas que contienen el mismo dominio como las FDVSDVDV\ )LJXUD (OFRPSOHMRIRUPDGRSRU)DV)DV/)$''\ODFDVSDVDy
HVOODPDGR',6& Death-Inducing Signaling Complex, o complejo
de señalización inductor de muerte /DDFWLYDFLyQGHHVWDVcaspaVDVLQLFLDGRUDVOOHYDDODHMHFXFLyQGHODDSRSWRVLVSRUFOLYDMHGH
VXVWUDWRVFRUULHQWHDEDMR6HKDQLGHQWL¿FDGRGRVWLSRVGHFpOXODV
según la vía de señalización de )DVXWLOL]DGD/DVFpOXODVtipo I reTXLHUHQODDFWLYDFLyQGHFDVSDVDODFXDODFWLYDDODFDVSDVD(Q
las células WLSR,,ODOLPLWDGDDFWLYDFLyQGHODFDVSDVDFRQGXFHD
XQDYtDGHDPSOL¿FDFLyQPHGLDGDSRUODDFWLYDFLyQPLWRFRQGULDO
(QHVWD~OWLPDYtDODFDVSDVDPHGLDHOFOLYDMH\DFWLYDFLyQGHOD
proteína Bid. Luego tBid induce la liberación de los factores apoptogénicos mitocondriales con la subsiguiente activación de la vía
intrínseca de la apoptosis
5.4.2. Señalización por 71)Į71)5
La unión del ligando 71)Į FRQ HO UHFHSWRU 71)5 )LJXUD
SURPXHYH OD GLVRFLDFLyQ GH OD SURWHtQD 62'' Silencer
Of Death Domains GH OD SRUFLyQ FLWRSODVPiWLFD GHO receptor,
permitiendo así el reclutamiento de la proteína adaptadora
75$'' T1) Receptor-Associated DD /XHJR GH VX DVRciación, 75$'' SXHGH LQWHUDFWXDU FRQ )$'' 75$) TNF
Receptor-Associated Factor-2 \ 5,3 Receptor-Interacting
Protein /DLQWHUDFFLyQFRQ)$''LQGXFHODapoptosis por una
vía similar a la de )DV(O71)WDPELpQSXHGHLQGXFLUODapoptosis mediante su interacción con los DDs de las proteínas RIP
\5$,''&5$'' RIP-Associated ICH-1/Ced-3 homologous
protein with DD/Caspase and RIP Adaptor with DD 5$,''
contiene un dominio CRAD a través del cual puede interactuar
FRQODFDVSDVDSDUDLQGXFLUODDSRSWRVLV/DFDVSDVDDFWLYDGD SURPXHYH HO FOLYDMH GHBid, el cual induce la liberación de
los factores pro-apoptóticos mitocondriales como cyt c, Smac/
DIABLO y $,)DFWLYDQGRFRQVLJXLHQWHPHQWHODYtDLQWUtQVHFD
de la DSRSWRVLV DXQTXHSDUHFHUtDH[LVWLUXQDYtDDOWHUQDWLYDLQdependiente de %LG (OUHFOXWDPLHQWRGH75$)SRU75$''SXHGHSURGXFLUODDFWLYDFLyQ GH 1)ț% \ -1. /D DFWLYDFLyQ GH -1. SXHGH LQGXFLU
la apoptosis o la supervivencia dependiendo del tipo celular y la
SUHVHQFLDRDXVHQFLDGHHVSHFLHVUHDFWLYDVGHR[tJHQR
/DDFWLYDFLyQGH1)ț%TXHRFXUUHWUDVODGHJUDGDFLyQSURWHRVRPDOGHVXLQKLELGRU,ț% Inhibitor of 1)ț% SURWHJHDODV
células de la DSRSWRVLVLQGXFLGDSRU71)\DTXHDOWUDQVORFDUVHDO
Q~FOHRFRQWURODODH[SUHVLyQGHODVSURWHtQDVFIAP.
5.4.3. Señalización mediada por perforinas y granzimas
(VWDYtDHVHPSOHDGDWDQWRSRUODUHVSXHVWDLQQDWD SRUHMHPSORcélulas 1. FRPRODDGDSWDWLYD &7/&'+, &7/CD4+>XVXDOPHQWH
[email protected]\DXQFLHUWDV7UHJ 3DUDHOORHORUJDQLVPRKXPDQRGLVSRQHGHXQPHFDQLVPRGHOLEHUDFLyQH[RFtWLFDGHSURWHtQDV
con capacidades proteolíticas diversas que culminan en la muerte
celular programada.
Las perforinas son utilizadas habitualmente como vehícuORSDUDHQYLDUORVJUiQXORVFLWRWy[LFRVTXHWDPELpQFRQWLHQHQ
granzimas DEUHYLDGR*]PHQ]LPDV>[email protected] HQ JUiQXORV \ TXH VRQ GLUHFFLRQDGRV KDFLD OD FpOXOD GLDna HQODTXHSURPRYHUiODDFWLYLGDGSURDSRSWyWLFDDOPHQRV
mediante tres víaV YpDVH PiV DGHODQWH . Para ello, inicialmente
ORVJUiQXORVVHGLULJHQGHQWURGHODFpOXODFLWRWy[LFDKDFLDHOOXJDU
donde se produce la sinapsis inmune entre ésta y la célula diana,
IXVLRQiQGRVHLQLFLDOPHQWHODPHPEUDQDFRQWHQLHQGRHOJUiQXORFLWRWy[LFRFRQODPHPEUDQDSODVPiWLFDGHODFpOXODGRQGHVHVLQWHWL]y3RVWHULRUPHQWHVHOLEHUDHOFRQWHQLGRGHOJUiQXORHQHOYDOOH
VLQiSWLFRSDUDDOFDQ]DUODFpOXODGLDQD'LYHUVDVPROpFXODVFRPR
+V3\RWUDVSXHGHQSRWHQFLDOPHQWHVHUWDPELpQXWLOL]DGDVFRPR
transporte y promover el efecto citolítico mediado por Gzm.
Las Gzm poseen una importante función en la respuesta
177
citotóxica frente a patógenos intracelulares y ante tumores.
Recientemente, también se ha demostrado su relevancia en la
regulación de la sobrevida de los LT, en la tolerancia inmunoOyJLFDDVtFRPRHQHYHQWRVLQÀDPDWRULRV\DQLYHOGHOFRPSDUtimiento extracelular, favoreciendo la migración linfocitaria, al
producir la proteólisis de proteínas extracelulares o de recepWRUHVGHVXSHU¿FLH Hasta el presente, se han descubierto 5 Gzm
KXPDQDV$%+.\0ODVTXHH[KLEHQHOHPHQWRVHQFRP~Q
y diferenciales en la inducción de la apoptosis 7DEOD /DV
*]P$\%VRQODVPiVDEXQGDQWHV\HVWD~OWLPDODPiVHVWXGLDGD
La Gzm B cliva proteínas –al igual que las caspasas– luego del
UHFRQRFLPLHQWRGHUHVLGXRVGHiFLGRDVSiUWLFR ' OD*]P$\OD
Gzm K actúan como triptasas, y la H como la quimiotripsina, cliYDQGRSURWHtQDVOXHJRGHDPLQRiFLGRVDURPiWLFRV
Sólo la Gzm B promueve la apoptosis mediante la actividad
de las caspasas.
$FRQWLQXDFLyQVyORVHKDUiXQDEUHYHUHIHUHQFLDDDOJXQRVGH
ORVDVSHFWRVPiVVDOLHQWHVLQGLFDGRVHQOD7DEOD
Granzima A. Esta proteasa dimérica promueve la muerte celular, indistinguible de la apoptosis, aunque sin participación de
las FDVSDVDV/DVFpOXODVPXHUHQUiSLGDPHQWHFRQDIHFWDFLyQPLWRFRQGULDO \ GLVUXSFLyQ GH OD PHPEUDQD SODVPiWLFD VHJXLGRV GH
WUDVORFDFLyQ GH IRVIDWLGLO VHULQD DO ODGR H[WHUQR GH OD PHPEUDQD
SODVPiWLFD UHYHODGRPHGLDQWHWLQFLyQFRQ$QH[LQD9 \GDxRGHO
'1$ FRUWHVHQKHEUDVGHFDGHQDVLPSOHTXHSURGXFHQIUDJPHQtos de megabases, en contraposición con los pequeños fragmentos
internucleosómicos producidos por la JUDQ]LPD% El daño mitocondrial no se traduce en la permeabilización de su membrana
externa MOMP: Mitochondrial Outer Membrane Permeabilization 6LQ HPEDUJR HO GDxR PLWRFRQGULDO HV OD SULQFLSDO FDXVD
de muerte celular. Esta granzima es transportada desde el citosol a
la matriz mitocondrial posiblemente a través de chaperonas, donGHFOLYDXQFRPSRQHQWHGHOFRPSOHMR,GHODFDGHQDGHWUDQVSRUWH
GH HOHFWURQHV OR TXH DIHFWD HO SRWHQFLDO UHGR[ OD JHQHUDFLyQ GH
$73 \ OD PDQWHQFLyQ GHO SRWHQFLDO GH WUDQVPHPEUDQDǻȥm , a la
YH]TXHSURPXHYHODJHQHUDFLyQGHOLRQVXSHUy[LGReVWHFRQGXFHDXQFRPSOHMRGHUHVSXHVWDGHHVWUpVR[LGDWLYRDVRFLDGRDO5(
GHQRPLQDGR FRPSOHMR 6(7 DO Q~FOHR GRQGH SURPXHYH HO GDxR
GHO'1$(OFRPSOHMR6(7FRQVWDGHQXFOHDVDVSURWHtQDGH
XQLyQDO'1$GDxDGR\SURWHtQDVPRGL¿FDGRUDVGHODFURPDWLQD
(VWHFRPSOHMRWLHQGHDGHWHFWDUGDxRVHQHO'1$\UHSDUDUOR6LQ
embargo, la Gzm A al clivar a un inhibidor de la endonucleasa,
SHUPLWHJHQHUDUHOGDxRGHO'1$TXHOXHJRVHH[WLHQGHSRUDFFLyQ
GHXQDH[RQXFOHDVDFRQWHQLGDHQHOFRPSOHMR6(7$VLPLVPROD
*]P$LQDFWLYDHOFRPSOHMRGHUHSDUDFLyQGHEDVHVHVFLQGLGDVGHO
'1$ %(5Base Excision Repair \RWURVVLVWHPDVGHUHSDUDFLyQ
del genoma. )LQDOPHQWH*]P$HVFDSD]GHSURPRYHUODDSHUWXUD
de la cromatina en el núcleo, al clivar la histona H-I y remover los
H[WUHPRVGHRWUDVKLVWRQDVORTXHWRUQDPiVVXVFHSWLEOHDO'1$
celular a la acción de las nucleasas, al tiempo que disrumpe la laminina de la envoltura nuclear.
Granzima B. Esta proteasa promueve la apoptosis mediante
la actividad de las caspasas, pero también en un modo independiente de ellas, \DTXHPXFKRVGHORVVXVWUDWRVGHDPEDVVH\X[WDSRQHQSRUUHFRQRFHUVHHQDPERVFDVRVUHVLGXRVGHiFLGRDVSiUWLFR
Gzm B cliva Bid y la DNAsa iCAD inactive Caspase Activated
DNAse ORFXDOJHQHUDELGWUXQFDGR W%LG \&$'UHVSHFWLYDPHQWH
lo TXHDVXYH]SURGXFLUiHOGDxRPLWRFRQGULDOHLQWHUQXFOHRVymico )LJXUD (VWD~OWLPDDFFLyQVH\X[WDSRQHFRQODGHODFDVSDVD(QWUHODVPROpFXODVGLDQDVHHQFXHQWUDQODWXEXOLQD3$53
ODPLQLQD%HWFDGLFLRQiQGRVHRWURVVXVWUDWRVVHPHMDQWHVDORV
reconocidos por las FDVSDVDV\/D*]P% DOLJXDOTXHODV
FDVSDVDV SURPXHYHODJHQHUDFLyQGHHVSHFLHVUHDFWLYDVGHR[tJHQR
526 ODDIHFWDFLyQGHOSRWHQFLDOGHWUDQVPHPEUDQDPLWRFRQGULDO
ǻȥm y MOMP lo cual libera cyt c y otras moléculas proapoptóticas
tales como Smac/DIABLO desde el espacio intermembrana.
Granzima H. Esta proteasa promueve la muerte celular independiente de FDVSDVDVDVRFLDGDDOGDxRPLWRFRQGULDO VLQDIHFWDUVH
la liberación del cyt c \ODIUDJPHQWDFLyQQXFOHDU VLQSDUWLFLSD-
178
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
Figura 7.38. Evolución temporal de la apoptosis promovida por
CTLs en células que expresan antígenos de HBV. (OFOLYDMHGHO
'1$FURPRVyPLFRDQLYHOLQWHUQXFOHRVyPLFRGHODFpOXODGLDQDUHconocida por el &7/DFDHFHSRUODDFWLYLGDGGHXQD'1$VDDFWLYDGD
SRUODFDVSDVDOXHJRGHVHUDFWLYDGDSRUODYtDH[WUtQVHFDGHOD
DSRSWRVLVORTXHSURPXHYHODIRUPDFLyQGHIUDJPHQWRVHQHVFDOHUD8QFORQGHLT CD4+HVSHFt¿FRSDUDHO+%V$JLQGXFHapoptosis
de KHSDWRFLWRVGHUDWRQHVWUDQVJpQLFRVSDUD+%9(O'1$FURPRVyPLFRIXHSUHSDUDGRDSDUWLUGHPH]FODVGHFpOXODVDGKHUHQWHV\
QRDGKHUHQWHV\GHGHWULWXVGHFXOWLYRVGHKHSDWRFLWRVQRWUDWDGRVR
GHFXOWLYRVKHSDWRFtWLFRVGXUDQWHSHUtRGRVYDULDEOHVGHWLHPSRFRQ
el clon de &7/FRQ\VLQXQLQKLELGRULUUHYHUVLEOHGHODFDVSDVD=
'(9'±)0. '(9' (O'1$IXHIUDFFLRQDGRPHGLDQWHHOHFWURIRUHVLVHQXQJHOGHDJDURVDDO0PDUFDGRUGHWDPDxRPROHFXODU
HQHVFDOHUDGHSDUHVGHEDVHV SE 7*3WUDQVDPLQDVDJOXWiPLFRSLU~YLFRFX\RQLYHOHQHOVREUHQDGDQWHVHH[SUHVDHQ8,O(O
SRUFHQWDMHGHFpOXODVCD8+HQODIUDFFLyQGHFpOXODVQRDGKHUHQWHV
VHLQGLFDDOSLH $$' )XHQWH3DVTXHWR9et al. Journal of Virology5HSURGXFLGRFRQDXWRUL]DFLyQ
FLyQGH&$' *]P+SDUHFHUtDHMHUFHUXQHIHFWRUHGXQGDQWHFRQ
la Gzm B. Algunos virus como los adenovirus, han desarrollado
mecanismos de inactivación de Gzm B, pero la infección puede ser
limitada tempranamente por la actividad de Gzm H presente en las
NK, antes de la participación de la respuesta adaptativa mediada
por &7/TXHSRVHHQ*]P%
Granzima K. Esta proteasa monomérica, parecería duplicar
la actividad proteolítica nuclear promovida por la Gzm A. Sin embargo, no se ha establecido si a nivel mitocondrial se comporta
FRPROD*]P$ GLVIXQFLyQVLQMOMP: ROS y diferencias en el
SRWHQFLDOGHPHPEUDQDǻȥm pero sin liberación de cyt c RFRPROD
*]P% DOWHUDFLyQPLWRFRQGULDOFRQ0203 RVLHVXQPHFDQLVPR
híbrido de ambas.
Granzima M. Esta proteasa que cliva luego de residuos de Leu o
0HWHVWiSULQFLSDOPHQWHDVRFLDGDDODLQPXQLGDGLQQDWD\DTXHHVWi
presente fundamentalmente en células NK y /7Ȗį$~QQRVHKDHVWDblecido si esta granzima actúa como la Gzm B o si utiliza nuevas vías.
6. CONTROL
DE LA INFECCIÓN VIRAL
(QXQDVLQIRQtDQRWRGRVORVLQVWUXPHQWRVVRQHMHFXWDGRVVLPXOWiQHDPHQWH(QPRGRDQiORJRDQWHXQDLQIHFFLyQYLUDOLQWHUYLHQHQ
diversos componentes de la respuesta inmune innata y adaptativa
LQÀXLGRVSRUVXHVSHFt¿FDGLVWULEXFLyQWpPSRURHVSDFLDO(QHVWH
capítulo se ha descripto parcelarmente la participación de algunos
HOHPHQWRVVROXEOHV\¿JXUDGRVGHODUHVSXHVWDLQPXQH6LQHPEDUJRHOOHFWRUGHEHUiLPDJLQDUODVLPXOWDQHLGDGFRQTXHDFRQWHFHQ
YDULRVGHORVSURFHVRVKDVWDDTXtH[SXHVWRV
Los virus han evolucionado para persistir en la naturaleza.
Como contrapartida, la respuesta inmune innata y adaptativa del
ser humano debe poder sobreponerse a la infección viral. Para ello,
KDGHVDUUROODGRP~OWLSOHV\H¿FDFHVVLVWHPDVTXHUHVSRQGHQWHPpranamente a ella, y que pueden protegerlo por períodos prolongados. Dado que los virus pueden evadirse de la acción de algunos
de ellos, los mecanismos de defensa antiviral son muchas veces
UHGXQGDQWHVFRQHOREMHWRGHRIUHFHUXQVLVWHPDGHUHVJXDUGR$Vt
DPRGRGHHMHPSORVDQWHODHYHQWXDOLQDFWLYDFLyQGHODYtDFOiVLFD
del sistema FRPSOHPHQWRH[LVWHODYtDDOWHUQDWLYDRHOVLVWHPDGH
FROHFWLQDVODVHFUHFLyQGH,)1ȖSXHGHHVWDUSURGXFLGDSRUcélulas
NK, por /7ȖįRSRU/7ĮȕGHPHPRULDODIDJRFLWRVLVSXHGHVHU
llevada a cabo tanto por macrófagos como por polimorfonucleares,
la secreción de citoquinas antivirales como ,)1Ȗ71)Į71)ȕ
R,/SXHGHSURYHQLUGHP~OWLSOHVHVWLUSHVFHOXODUHV
Una vez producida la implantación viral en la puerta de entrada
DO RUJDQLVPR SRU HMHPSOR OD VXSHU¿FLH GHO HSLWHOLR UHVSLUDWRULR
R GLJHVWLYR \ OXHJR GHO UHFRQRFLPLHQWR SRU ORV 553 VH VLQWHWLzan elevados niveles de ,)1ȕeVWHVHXQHDOreceptor y promueve
la síntesis de múltiples moléculas efectoras antivirales. A su vez,
VHQVLELOL]D FpOXODV FROLQGDQWHV \ GLVWDOHV SDUD SURGXFLU PiV ,)1
OXHJRGHSURGXFLUVHODLQIHFFLyQYLUDO6LPXOWiQHDPHQWHVHLQLFLD
el mecanismo de transferencia de la actividad antiviral inducida
por ,)1DFpOXODVFRQWLJXDVFX\DUHVSXHVWDDOPLVPRHVPiVOHQWD
R HVWi OLPLWDGD SRU HO JUDGR GH DFFHVLELOLGDG GH DTXpO /D LQIHFción de leucocitos, a su vez, puede producir la liberación de ,)1Į
Este interferón puede ser también liberado por dichas células en
el sitio inicial de implantación viral, una vez que las mismas conÀX\HQDHVWD]RQD(O,)1ĮGLIXQGHKDFLDODFLUFXODFLyQFRQPD\RUH¿FDFLDTXHORVWLSRVȕ\Ȗ/DLQWHUIHURQHPLDSXHGHFRQIHULU
protección a órganos ubicados a distancia donde podría replicar el
virus. El ,)1ȖHVFDSD]GHSRWHQFLDUORVHIHFWRVGHORVWLSRVĮ\
ȕ/DUHVXOWDQWHGHGLFKDVLQWHUDFFLRQHVHVODDPSOL¿FDFLyQJHQHUDO
GHO VLVWHPD VH SURGXFHQ PiV PROpFXODV HIHFWRUDV FRQ DFWLYLGDG
antiviral y se potencian otros mecanismos defensivos mediados
por la activación de células NK y macrófagos y de FLWRWR[LFLGDG
mediada por DQWLFXHUSRV/DDFWLYLGDGPi[LPDGHODVcélulas NK
WLHQHOXJDUDORVGtDVGHLQLFLDGDODLQIHFFLyQ(QVHJXQGRWpUPLno, el LQWHUIHUyQ LQGXFH OD H[SUHVLyQ GH PROpFXODV &0+, (OOR
LPSOLFDSDUDHVWDVFpOXODVGRVHIHFWRVLQPHGLDWRV GLVPLQXFLyQ
de la sensibilidad a las células 1. FRQYHUVLyQDGLDQDSDUDORV
&7/&'+TXHDSDUHFHQDSUR[LPDGDPHQWHDORVGtDVGHLQLFLDGD
la infección. Existe sinergismo entre el sistema IFN y los anticuerpos séricos antivirales OD FRH[LVWHQFLD GH DPERV HV capaz
GHSRWHQFLDUPiVGHPLOYHFHVHOHIHFWRTXHFDGDXQRGHHOORV
ejercería individualmente sobre la infección.
7RGDVHVWDVLQWHUDFFLRQHVIXQFLRQDQHQSOHQLWXGVLHOYLUXVFRQtinúa su replicación y diseminación a distancia a órganos blanco.
Debido a la respuesta innata y adaptativa del hospedero, esta situaFLyQH[LVWHHQXQQ~PHUROLPLWDGRGHFDVRV
Es menester subrayar, sin embargo, que el ,)1QRHVOD~QLFDQL
ODPiVLPSRUWDQWHFDXVDGHUHFXSHUDFLyQGHXQDLQIHFFLyQYLUDO6L
así fuera, la producción del mismo ante una primera infección sistémica, o bien ante la administración de una vacuna viral atenuada,
debería conferir protección contra cualquier virus no relacionado,
al menos durante un cierto lapso de tiempo. Sin embargo, este fenómeno no ocurre generalmente. Sólo parecería ser responsable
de cierta protección temporal al ocurrir infecciones por un virus
en el tracto respiratorio o digestivo frente a otros agentes que penetran por la misma puerta de entrada. Esto sugiere una limitación
témporo-espacial del efecto del interferón: su principal mecanismo
antiviral sería la protección de células vecinas a las del sitio inicial
de implantación viral durante un período restringido de tiempo. A
la LQWHUIHUHQFLD HMHUFLGD VREUH OD UHSOLFDFLyQ YLUDO SRU HO VLVWHPD
Interferón, debe añadirse el silenciamiento transcripcional promoYLGRSRUORV51$LXWLOL]DQGRHO5,6&SDUDHOVXEVLJXLHQWHFOLYDMH
de RNAs virales.
/DUHVSXHVWDLQPXQHHVSHFt¿FDHVXQDIXQFLyQGHODDFWLYLGDG
de linfocitos HVSHFt¿FDPHQWH FRPSURPHWLGRV, que son estimulados por las CD en los órganos linfoides secundarios desde don-
Capítulo 7 / Mecanismos de defensa del hospedador frente a las infecciones virales
Grupo de
galectinas
Ejemplos
Valencia
Prototípicas
Galectina-1, -2, -5, -7, -10,
-11, -13, -14, y -15
Divalentes al dimerizarse
Con repetición en
tándem
Galectina-4, -6, -8, -9 y -12
Intrínsecamente divalentes
4XLPpULFD
Galectina-3
0RQRYDOHQWHHQVROXFLyQ
PXOWLYDOHQWHOXHJRGHXQLUVH
DVXVJOLFROLJDQGRV
179
Estructura
Tabla 7.11. &ODVL¿FDFLyQGHODVgalectinas según su estructura y valencia.
de pueden migrar hacia los diversos sitios del organismo donde
son requeridos. La eliminación viral durante la fase aguda de
la infección acontece como función de la actividad de los CTL
CD8+. El balance ajustado entre dicha eliminación y la (limitada) producción de daño tisular es regulado por las Tregs. La
promoción de una efectiva respuesta de anticuerpos antivirales
por parte de los LB es función de los LT CD4+ ayudadores (Th).
([LVWHQSULQFLSLRVHQFRP~QHQODH[SDQVLyQFORQDOGHHVWDVHVWLUSHVOLQIRFtWLFDVFRQODH[FHSFLyQGHTXHPLHQWUDVORV/7H[KLEHQ
VLHPSUHHOPLVPR7&5TXHSUHVHQWDQODVFpOXODVSUHFXUVRUDVORV
/%PXHVWUDQXQSURFHVRGHPDGXUDFLyQGHODD¿QLGDGGHVXrecepWRU%\XQFDPELRVRPiWLFRTXHJHQHUDGLYHUVLGDG/DPHPRULDLQPXQROyJLFDUHÀHMDODFRQWLQXD\GXUDGHUDSUHVHQFLDGHXQQ~PHUR
incrementado de LB y /7SUHFXUVRUHVMientras los plasmocitos
HWDSD¿QDOGHODGLIHUHQFLDFLyQGHOOLQDMHFHOXODU% SURGXFHQ
anticuerpos persistentemente, los LT precursores no secretan
producto alguno en ausencia de un subsiguiente desafío. IdealPHQWH ODV SREODFLRQHV 7 GH PHPRULD SHUVLVWHQ FRQ HOHYDGD IUHFXHQFLDHQXQHVWDGRSDUFLDOPHQWHDFWLYRTXHSHUPLWHXQDUiSLGD
UHVSXHVWDGHIXQFLRQHVHIHFWRUDV/DDMXVWDGD\¿QDUHJXODFLyQGH
la respuesta innata y adaptativa por las galectinas ha permitido no
sólo comprender las bases de su homeostasis, sino también proveer
potenciales dianas, para futuros ensayos terapéuticos que permitan
la erradicación de infecciones virales persistentes y eviten algunas
de las complicaciones autoinmunitarias asociadas a la infección
por determinados virus.
180
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
Bibliografía
‡ Aliyari R, Ding S-W. "RNA-based viral immunity initiated by the Dicer
family of host immune receptors". Immunol Rev±
‡ Amanna IJ, Carlson NE, Slifka MK. "Duration of humoral immunity to common viral and vaccine antigens". N Engl J Med ‡ Beard MR, Helbig KJ. "Control of HCV replication: when size
does not matter". Hepatology ‡ %URHULQJ7-, Garrity KA, Boatright NK, Sloan SE, 6DQGRU), 7KRPDV
WD Jr, et al. ",GHQWL¿FDWLRQDQGFKDUDFWHUL]DWLRQRIEURDGO\QHXWUDOL]LQJKXPDQPRQRFORQDODQWLERGLHVGLUHFWHGDJDLQVWWKH(HQYHORSH
glycoprotein of hepatitis C virus". J Virol
‡ Carthew RW, Sontheimer EJ. "Origins and mechanisms of miRNAs and siRNAs". Cell ‡ &KDEOH%HVVLD&0H]LDQH2/DWUHLOOH'7ULERXOHW5=DPERUOLQL
A, Wagschal A, et al. "Suppression of +,9 UHSOLFDWLRQ E\ PLcroRNA effectors". Retrovirology ‡ Choudhury D, Lieberman J. "Death by a thousand cuts: ranzyme pathways
of programmed cell death". Ann Rev Immunol ‡ Cullen BR. "Viral and cellular messenger RNA targets of viral microRNAs". Nature ‡ Diana J, Lehuen A. 1.7FHOOVIULHQGRUIRHGXULQJYLUDOLQIHFWLRQV"Eur J Immunol
‡ )OLQW6-(QTXLVW/:5DFDQLHOOR956NDOND$03ULQFLSOHVRI
9LURORJ\$603UHVVrd(GLWLRQ
‡ *R,GIUH\',6WDQNRYLF6%D[WHU$*5DLVLQJWKH1.7FHOOIDmily". Nat Immunol 5HY
‡ Ghosh Z, Mallick B, Chakrabarti J. "Cellular versus viral microRNAs
in host–virus interaction". Nucleic Acids Res
‡ ,EDUUHJXL -0 &URFL '2 %LDQFR *$7RVFDQR 0$ 6DODWLQR 0
Vermeulen ME, et al. 7ROHULJHQLF VLJQDOV GHOLYHUG E\ GHQGULWLF
FHOOV WR 7 FHOOV WKURXJK D JDOHFWLQGULYHQ LPPXQRUHJXODWRU\
FLUFXLWLQYROYLQJLQWHUOHXNLQDQGLQWHUOHXNLQNat Immunol
‡ Klein MI, Bergel E, Gibbons L, Coviello S, Bauer G, Benitez A,et
al. "Differential gender response to respiratory infections and to
the protective effect of breast milk in preterm infants". Pediatrics
H±H
‡ 0DKDMDQ96'UDNH$&KHQ-9LUXVVSHFL¿FKRVWPL51$VDQWLYLUDOGHIHQVHVRUSURPRWHUVRISHUVLVWHQWLQIHFWLRQ"Trends Immunol
‡ Nandi A, Lavine CL, Wang P, Lipchina I, Goepfert PA, Shaw GM,
et al. "Epitopes for broad and potent neutralizing antibody responVHVGXULQJFKURQLFLQIHFWLRQZLWKKXPDQLPPXQRGH¿FLHQF\YLUXV
W\SHVirology
‡ Norling LV, Perretti M, Cooper D. "Endogenous galectins and the
FRQWURO RI WKH KRVW LQÀDPPDWRU\ UHVSRQVH J Endocrinol ‡ 3DVTXHWWR9:LHODQG6&KLVDUL)9,QWUDFHOOXODUHepatitis B viUXVQXFOHRFDSVLGVVXUYLYHF\WRWR[LF7O\PSKRF\WHLQGXFHGapoptosis". J Virol
‡ Pedersen IM, Cheng G, Wieland S, Volinia S, Croce CM, Chisari
)9et al. "Interferon modulation of cellular microRNAs as an antiviral mechanism". Nature ‡ 3ROL$0LFKHO77KpUpVLPH0$QGUqV(+HQWJHV)=LPPHU-
&'EULJKWQDWXUDONLOOHU 1. FHOOVDQLPSRUWDQWNK subset".
Immunology
‡ 5DELQRYLFK*$7RVFDQR07XUQLQJVZHHWRQLPPXQLW\JDOHFWLQJO\FDQLQWHUDFWLRQVLQLPPXQHWROHUDQFHDQGLQÀDPPDWLRQ
Nat Rev Immunol
‡ Rabinovich GA, Ibarregui JM. "Conveying glycan information
LQWR 7FHOO KRPH67$7LF SURJUDPV D FKDOOHQJLQJ UROH IRU JDOHFWLQ LQ LQÀDPPDWRU\ DQG WXPRU PLFURHQYLURQPHQWV Immunol
Rev
‡ Sato S, St-Pierre C,Bhaumik P,Nieminen J. "Galectins in innate
LPPXQLW\ GXDO IXQFWLRQV RI KRVW VROXEOH ȕ JDODFWRVLGHEQGLQJ
OHFWLQVDVGDPDJHDVVRFLDWHGPROHFXODUSDWWHUQV '$03V DQGDV
UHFHSWRUVIRUSDWKRJHQDVVRFLDWHGPROHFXODUSDWWHUQV 3$03V Immunol ReY;
‡ 6HJHY<, Rager-Zisman B, Isakov N, Schneider-Schaulies S, ter
Meulen V, Udem S, et al. "Reversal of the measles virus-mediated
increase of phosphorylating activity in persistently infected mouse
neuroblastoma cells by anti-measles virus antibodies". J Gen Virol
‡ Serruys B, 9DQ+RXWWH), Verbrugghe P, /HURX[5RHOV*, Vanlandschoot P. "Llama-derived single-domain intrabodies inhibit secretion
of hepatitis B virions in mice". Hepatology ; ‡ 6FKHLG -), Mouquet H, )HOGKDKQ 1, Seaman MS, Velinzon K,
Pietzsch J, et al. "Broad diversity of neutralizing antibodies isolated from memory B cells in HIV-infected individuals". Nature
‡ YDQ.RR\N<5DELQRYLFK*$3URWHLQJO\FDQLQWHUDFWLRQVLQWKH
control of innate and adaptive immune responses". Nat Rev Immunol
‡ :DVRZVNDD %$ /HH &< %DOGZLQ :0 UG 1HZ FRQFHSWV RI
FRPSOHPHQWLQDOORUHFRJQLWLRQDQGJUDIWUHMHFWLRQCell Immunol
‡ =KX-3DXO:(+HWHURJHQHLW\DQGSODVWLFLW\RI7KHOSHUFHOOV
Cell Res
8
Evasión viral a la respuesta inmune del hospedador
Verónica Lidia Mathet - José Raúl Oubiña
Los diversos mecanismos de infección, propagación y eventualmente persistencia de los virus en las células permisivas del hospedador son los que permiten a estas entidades genéticas preservar su
HVSHFL¿FLGDGHLGHQWLGDGHQODSHUSHWXLGDG3DUDORJUDUHVWDEOHFHUVH
en el hospedador, los virus muchas veces requieren disminuir o
alterar el tenor de la respuesta inmune. Como en una hipotética
batalla, tras el inicial ataque viral, el hospedador inmunocompetente
pone en funcionamiento diversos mecanismos de GHIHQVD UHVSXHVWD
LQPXQHLQQDWD\DGTXLULGD DQWHORVTXHODSREODFLyQYLUDOSURSRQH
estrategias de contraataque o VXEYHUVLyQ )LJXUD Los virus pueden evadir la respuesta inmune mediante dos estrategias generales: ya sea evitando el reconocimiento por parte del
sistema inmune o alterando los mecanismos de defensa del hospeGDGRU 7DEOD Los virus que producen infecciones persistentes emplean esWUDWHJLDVGLYHUVDVSDUDORJUDUOR(MHPSORVGHpVWDVHVWiQGDGRVSRU
los virus +,9 YLUXVGHODLQPXQRGH¿FLHQFLDKXPDQD +%9 virus
KHSDWLWLV% +&9 YLUXVKHSDWLWLV& (%9 YLUXV(SVWHLQ%DUU \
+7/9 YLUXVGHODOHXFHPLD7KXPDQD 6HKDHVWDEOHFLGRTXHHQ
JHQHUDOORVYLUXVD'1$ FRQH[FHSFLyQGHO+%9 QRSURGXFHQ
LQIHFFLRQHVSHUVLVWHQWHVDVRFLDGRVDXQDVLJQL¿FDWLYDYLUHPLD3RU
HOFRQWUDULRVXHOHQXWLOL]DUODHVWUDWHJLDGHOFDPXÀDMHRODsubversión a la respuesta inmune para lograrlo. Por el contrario, los virus
a RNA habitualmente utilizan con el mismo propósito la estrategia
GHH[KLELUXQDYHOR]UHSOLFDFLyQ\GHPXWDUVLJQL¿FDWLYDPHQWHVX
JHQRPDDVRFLiQGRVHFRQIUHFXHQFLDDHOHYDGRVWtWXORVGHYLUHPLD
Para persistir, los virus a RNA modulan la respuesta inmune meGLDQWHODHVWUDWHJLDGHHYDVLyQDODSUHVLyQLQPXQH FRPRKDFHQ
SRUHMHPSORHOHIV y el +&9 RODGHSURPRYHUHODJRWDPLHQWRGH
A
t
a
q
u
e
E
v
a
s
i
ó
n
C
o
n
t
r
a
a
t
a
q
u
e
ODVFpOXODVGHOVLVWHPDLQPXQH FRPRRFXUUHFRQHIV y HCV en el
KRPEUH\FRQHOYLUXVGHODFRULRPHQLQJLWLVOLQIRFLWDULD>/&[email protected]
HOPRGHORPXULQR $FRQWLQXDFLyQVHPHQFLRQDUiQDOJXQRVGHORVPHFDQLVPRVXWLlizados con mayor frecuencia por los virus para evadir la respuesta
inmune del hospedador.
1. ALTERACIÓN
DEL RECONOCIMIENTO
POR PARTE DEL SISTEMA INMUNE
1.1. VARIACIÓN ANTIGÉNICA
8QRGHORVPHFDQLVPRVPiVLPSRUWDQWHVGHHYDVLyQDODUHVSXHVWD
inmune del hospedador es la variación antigénica. Ésta se da como
resultado de la aparición de variantes genómicas ya sea por reasoFLDFLyQJHQpWLFD GHQRPLQDGDWDPELpQUHRUGHQDPLHQWRJHQpWLFR recombinación o PXWDFLRQHVSXQWXDOHV 7DEOD 1.1.1. Reasociación genética
Este fenómeno se produce en genomas segmentados tales como el de
LQÀXHQ]DGDQGROXJDUDOHYHQWRGHFDPELRPD\RURshift antigénico.
En este proceso, al llevarse a cabo la infección de una célula del hosSHGDGRUFRQGRVRPiVYDULDQWHVYLUDOHV±\OXHJRGHSURGXFLUVHXQ
ciclo de replicación completo– la progenie resultante puede contener
fragmentos genómicos procedentes de variantes parentales diferentes,
originando variantes virales nuevas. Esta estrategia permite la emerJHQFLDGHQXHYRVVXEWLSRVRODUHHPHUJHQFLDGHRWURV8QHMHPSOR
SDUDGLJPiWLFRGHOSULPHURORFRQVWLWX\HQODVpandemias de gripe de
\TXHUHVXOWDURQGHODreasociación de genes de origen
DEFENSA
Hospedador
Virus
Figura 8.1. Relación entre el virus y el hospedador. (QHOHMHPSORVHOHFFLRQDGRHOYLUXVORJUDLPSRQHUVHDOKRVSHGDGRU6LQHPEDUJR
HQP~OWLSOHVLQIHFFLRQHVHOLQGLYLGXRSXHGHOLPLWDUODVPLVPDV\HUUDGLFDUHODJHQWH
182
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
Evitar el reconocimiento por el sistema inmune
Variación antigénica
'LVPLQXFLyQGHODexpresión génica viral
'LVRFLDFLyQWHPSRUDOGHODexpresión génica viral
Alteración de los mecanismos de defensa del hospedador
,QKLELFLyQGHODSUHVHQWDFLyQDQWLJpQLFD
,QKLELFLyQRPRGL¿FDFLyQGHODDFWLYLGDGPHGLDGDSRUHOVLVWHPDInterferón (IFN)
0RGL¿FDFLyQGHODDFWLYLGDGPHGLDGDSRURWUDVFLWRTXLQDV
,QIHFFLyQGHFpOXODVGHOVLVWHPDLQPXQH\RDFFLyQVREUHODVPLVPDV
D$JRWDPLHQWRGHOVLVWHPDLQPXQH
E$FWLYLGDGGHVXSHUDQWtJHQRV
5HJXODFLyQGHODapoptosis
0RGL¿FDFLyQGHODDFWLYLGDGGHOVLVWHPDGHOcomplemento
6REUHH[SUHVLyQGHUHFHSWRUHVSDUD)F\FRQVLJXLHQWHXQLyQGH,JV
,QWHUDFFLyQGHSURWHtQDVYLUDOHVFRQUHFHSWRUHVFRUUHFHSWRUHVFHOXODUHV
Tabla 8.1. Mecanismos de evasión viral: algunos ejemplos.
DYLDUHQXQFRQWH[WRJpQLFRGHYLUXVLQÀXHQ]DKXPDQR(QODSULPHUD
SDQGHPLDVHUHDVRFLDURQORVJHQHVFRGL¿FDQWHVGHSURWHtQDVGHODHQvoltura viral hemaglutinina y QHXUDPLQLGDVD +1 \ODSROLPHUDVD
EiVLFD 3% HQXQFRQWH[WRJpQLFR ORVUHVWDQWHVIUDJPHQWRVGH
51$ GHYLUXVLQÀXHQ]DKXPDQR(QPRGRDQiORJRHQGRV
genes de LQÀXHQ]DGHORVSDWRV +\3% VHUHDVRFLDURQFRQJHQHV
GHYLUXVLQÀXHQ]DKXPDQR(ODFWXDOEURWHGHLQÀXHQ]DDYLDUFDXVDGR
por el subtipo +1GHOtipo A corresponde a un virus cuya totalidad
GHJHQHVHVGHRULJHQDYLDU HVGHFLUQRH[KLEHVHJPHQWRVJHQyPLFRV
UHDVRFLDGRV 6LQHPEDUJRODGLVHPLQDFLyQYLUDOLQWHUKXPDQDKDVLGR
H[FHSFLRQDOKDVWDHOPRPHQWR'DGRTXHHVWHYLUXVWLHQHXQDPX\
VLJQL¿FDWLYDWDVDGH¿MDFLyQGHmutaciones y que por la naturaleza
segmentada de su genoma podría producirse un evento de reasociaFLyQJHQpWLFDFRQFHSDVGHYLUXVGHLQÀXHQ]DKXPDQRHOULHVJRGH
XQDSDQGHPLDHVWiODWHQWH )LJXUD 1.1.2 Recombinación genética
El evento de recombinación genética se ha documentado en diversos virus, entre genotipos y/o subtipos diferentes del mismo
agente, al producirse el salto de cadena de las respectivas polimerasas desde un templado determinado a otro de diferente genotipo o subtipo que coinfecta la misma célula. Este evento ha sido
IHKDFLHQWHPHQWHGRFXPHQWDGRSRUHMHPSORHQYLUXVTXHSRVHHQ
una transcriptasa inversa como HIV y HBV, y en múltiples virus
con RNA polimerasas RNA dependientes y genomas a RNA de
polaridad positiva tales como algunos enterovirus, rinovirus, o
+&9 PX\LQIUHFXHQWHPHQWH RGHSRODULGDGQHJDWLYDVHJPHQWDGRVFRPRLQÀXHQ]DR±UDUDPHQWH±QRVHJPHQWDGRVFRPRHOYLUXV
VLQFLFLDOUHVSLUDWRULR 569 HWF(Q$UJHQWLQDVHKDQGHWHFWDGR
UHFRPELQDQWHVHQWUHORVVXEWLSRV%\)GH+,9 &5)B%) \
entre los tipos A y D de +%9FX\DVLJQL¿FDFLyQELROyJLFDD~Q
VHGHVFRQRFH )LJXUDV$\% 7DPELpQVHKDQREVHUYDGR
eventos de recombinación entre distintos virus de un mismo géneURFRPRSRUHMHPSORHQWUHYLUXVpolio derivado de la vacuna Sabin y otros miembros del género Enterovirus HEV-C o especies
del género Enterovirus humano-C (QHVWHFDVRGLFKRHYHQWRVH
DVRFLyHQDODHPHUJHQFLDGHXQEURWHGHpoliomielitis
HQ5HS~EOLFD'RPLQLFDQD\+DLWt GHULYDGDGHOVHURWLSRYDFXQDO
UHFRPELQDQWH DSHVDUGHODHUUDGLFDFLyQSUHYLDGHOYLUXVpolio
VDOYDMHHQODV$PpULFDV\WDPELpQUHFLHQWHPHQWHDSDUiOLVLVÀiFFLGDHQ&DPER\D GHULYDGRGHOVHURWLSRYDFXQDOUHFRPELQDQWH 1.1.3 Mutaciones
(OSURFHVRGHYDULDFLyQJHQyPLFDPiVIUHFXHQWHPHQWHREVHUYDGR
es la aparición de mutaciones puntuales como resultado del proceso
de replicación del genoma viral, ya sea éste a DNA o a RNA, siendo
VLJQL¿FDWLYDPHQWHPiVIUHFXHQWHHQJHQRPDVGHHVWH~OWLPRtipo.
Estas mutaciones pueden o no traducirse en cambios aminoacídicos
‡Reasociación genética (reordenamiento) en genomas segmentados:
- ,QÀXHQ]D: shift antigénico (cambios mayores)
‡Recombinación genética+,9+&9+%9HQWHURYLUXVUKLQRYLUXV569HWF
‡Mutaciones puntuales
- Mutantes de escape a la respuesta inmune humoral:
+,9PXWDFLRQHVHQODUHJLyQYDULDEOH9
+%9PXWDFLRQHVHQHOGHWHUPLQDQWHDQWLJpQLFRa\HQODUHJLyQKLGURItOLFDSULQFLSDOGHO+%V$J
+&9PXWDFLRQHVHQODUHJLyQKLSHUYDULDEOHGHODHQYROWXUD(
,QÀXHQ]Ddrift antigénico (cambios menores)
- Mutantes de escape a la respuesta inmune celular:
+%9PXWDFLRQHVHQHStWRSHVGHO+%F$JSDUDLT asociadas al antagonismo para el receptor T
SRUHMHPSORVXVWLWXFLRQHVHQHOHStWRSHSUHVHQWDGRSRU+/$$ RPXWDFLRQHVHQ
HStWRSHVGHODSROLPHUDVDRGHODSURWHtQDGHHQYROWXUD +%V$J
Tabla 8.2. Algunos ejemplos de variación antigénica viral.
183
Capítulo 8 / Evasión viral a la respuesta inmune del hospedador
Fuente
aviar
Reasociación
Virus
Humano
N2
N1
H5
H3
1
4
2
5
H5
?
H5*
N1
N1
Virus aviar
3
Humano
infectado
Mutación
Figura 8.2. ,QÀXHQ]DDYLDU\ODSRVLELOLGDGGHXQDHYHQWXDOIXWXUDSDQGHPLDGHLQÀXHQ]DEl brote de LQÀXHQ]DDYLDUVHRULJLQySRUOD
HPHUJHQFLDHQODSREODFLyQKXPDQDGHXQYLUXVLQÀXHQ]DGHOtipo A VXEWLSR+1 +KHPDJOXWLQLQD1QHXUDPLQLGDVD FX\RFyGLJRJHQpWLFR
HVGHRULJHQWRWDOPHQWHDYLDU\TXHLQIHFWyDLQGLYLGXRVHQiUHDVLQLFLDOPHQWHOLPLWDGDV /DWUDQVPLVLyQHQWUHKXPDQRVGHHVWHVXEWLSRYLUDO
KDVLGRH[FHSFLRQDODOFRPLHQ]RGHOEURWH GHELGRDODGL¿FXOWDGYLUDOSDUDDGDSWDUVHDODQXHYDHVSHFLH6LQHPEDUJRODSRVLELOLGDGGHTXH
HVWHYLUXVDOFDQFHXQDPD\RUH¿FLHQFLDGHSURSDJDFLyQLQWHUKXPDQDHVWiODWHQWH OtQHDYHUWLFDOGHSXQWRV 8QHVFHQDULRSRVLEOHLQGLFDTXHHO
YLUXVLQÀXHQ]DDYLDU+1SRGUtDDGTXLULUHVDPD\RUH¿FLHQFLDGHELGRDPXWDFLRQHVGHVXJHQRPD SRUHMHPSORHQHOJHQGHODKHPDJOXWLQLQD
+GHHQYROWXUDRHQORVFRUUHVSRQGLHQWHVDODVSURWHtQDVGHODSROLPHUDVD>@ RDOSURGXFLUVHODFRLQIHFFLyQGHLQGLYLGXRVFRQXQYLUXVLQÀXHQ]D
KXPDQR SRUHMHPSORtipo A VXEWLSR+1>@ \GHLQÀXHQ]DDYLDUORTXHSXHGHJHQHUDUXQHYHQWRGHUHDVRFLDFLyQJHQpWLFD 6HGHVFRQRFH
(indicado con el símbolo ?) la HYROXFLyQTXHWHQGUiHQORVSUy[LPRVDxRVHVWDYLURVLVHPHUJHQWH(OHYHQWRGHreasociación entre genes virales
GHRULJHQDYLDU\KXPDQRKDGDGRRULJHQDODVSDQGHPLDVGHJULSHTXHRFXUULHURQHQ +1 \ +1 'HELGRDODDXVHQFLDGH
PHPRULDLQPXQROyJLFDGHODSREODFLyQHQODTXHVHGLVHPLQyODUHDVRFLDFLyQJHQpWLFDFRQH[SUHVLyQGHQXHYRVDQWtJHQRVFRQ¿ULyDGLFKRV
VXEWLSRVXQDYHQWDMDFUXFLDOSDUDVXSURSDJDFLyQ
y éstos, a su vez, pueden o no afectar la funcionalidad de las difeUHQWHVSURWHtQDVYLUDOHV HQ]LPDVHStWRSHVDQWLJpQLFRVHWF /RV
antígenos virales afectados pueden ser cruciales para la respuesta
LQPXQHKXPRUDORFHOXODU(OYLUXVSDWRJQRPyQLFRSRUH[FHOHQFLD
asociado a la generación de variabilidad es el HIV. Con su elevada
WDVDGH¿MDFLyQGHmutaciones, este agente evade la respuesta inmune de un modo sorprendente. La actividad de su transcriptasa
inversa carente de lectura de prueba es proclive a la introducción de
errores en la polimerización del DNA a partir del templado a RNA,
especialmente en regiones que se conocen como variables. Una de
HOODVHODVtGHQRPLQDGR9loop –que es blanco de la acción de los
DQWLFXHUSRV±H[KLEHXQDDOWtVLPDWDVDGH¿MDFLyQGHPXWDFLRQHV HQ
HORUGHQGH[QWVLWLRDxR FRPSDUDGDFRQODGHDSUR[LPDGDPHQWH[-4 para todo el genoma del +,9RDOUHGHGRUGH[
para +%9 YDORUTXHDXPHQWDHQODVLQIHFFLRQHVVLQSURGXFFLyQGHO
DQWtJHQRVROXEOHH>+%[email protected]pDVHHOFDStWXOR+HSDWLWLV% y[-9 de otros virus con genoma a DNA. Sin embargo, dicha
WDVDGH¿MDFLyQGHPXWDFLRQHV GRQGHSUHGRPLQDQODVQRVLQyQLPDV
VREUHODVVLQyQLPDV HVGHSHQGLHQWHGHFDGDKRVSHGDGRUORTXH
sugiere que es dependiente de la presión de selección del sistema
inmune de cada individuo.
&RPRRWURHMHPSORGHYLUXVDVRFLDGRDLQIHFFLRQHVTXHSXHGH
H[KLELUYDULDELOLGDGDQWLJpQLFDFDEHGHVWDFDUODHPHUJHQFLDGH
mutantes de escape a los anticuerpos neutralizantes en cepas de
HBV. Estas mutaciones se registraron frecuentemente en el determinante antigénico a de la proteína de envoltura viral –principal
blanco de acción de los DQWLFXHUSRVQHXWUDOL]DQWHV±HQDPLQRiFLdos esenciales para el mantenimiento de la correcta estructura del
DQWtJHQRGHVXSHU¿FLH +%V$J DVtFRPRHQVLWLRVFUtWLFRVGHOD
región hidrofílica principal, que –incluyendo al determinante a
HQVXSRUFLyQFHQWUDO±VHH[WLHQGHHQWUHORVDPLQRiFLGRV
YpDVHHOFDStWXOR+HSDWLWLV% (QFHSDVGHOPLVPRYLUXV
también se detectaron mutaciones en epítopes necesarios para el
reconocimiento por /7XELFDGRVHQHO+%F$JRODSROLPHUDVD
Estos cambios aminoacídicos impiden el correcto reconocimiento
del antígeno viral por estos linfocitos y la consiguiente activación
de los mismos. Un epítope muy inmunogénico para la respuesta
7 FLWRWy[LFD HVWi UHSUHVHQWDGR SRU OD UHJLyQ GHOcore de
HBV. 0XWDFLRQHVHQORVUHVLGXRV\DIHFWDQDOVLWLRGHUHFRnocimiento del UHFHSWRU7 7&5 \ODD¿QLGDGGHODXQLyQFRQOD
PROpFXOD+/$UHVSHFWLYDPHQWH(OORWRUQDDOSpSWLGRPXWDGR
LQH¿FD]SDUDSURPRYHUXQDVHxDOGHDFWLYDFLyQDGHFXDGDSURGXFLpQGRVHHQVXOXJDUODLQGXFFLyQGHDQHUJLD GHOODWtQanVLQ
ergosHVWDGR GHFORQHV7'DGRTXHODPD\RUtDGHORVFORQHV7
QRUHFRQRFHQDOSpSWLGRPXWDGRHOHIHFWRDQWDJyQLFR DQWDJRQLVmo para el UHFHSWRU7 FRQVWLWX\HXQPHFDQLVPRGHHYDVLyQDOD
UHVSXHVWDLQPXQH(QPRGRDQiORJRODinfección persistente por
HCV se asocia a un permanente defecto de la respuesta inmune
del hospedador por neutralizar la infectividad viral tanto a través
de anticuerpos neutralizantes como mediante la cooperación entre
OLQIRFLWRV7CD4+ y &'+. La continua presión de selección de la
respuesta humoral y celular se asocia a la emergencia permanente
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
184
|
|
!
:
A
Z
|
|
|
|
Genoma A
|
|
Genoma B
Ruptura de las hebras en cada uno de los genomas parentales
!
:
A
Z
Invasión y desplazamiento de las hebras de DNA
!
:
A
Z
Ligación
!
:
A
Z
!
Formación de la estructura de Holliday
:
Z
Isomerización
A
!
!
Corte
transversal
:
:
Corte
longitudinal
Z
Z
A
!
A
Empalme
A
Z
!
:
A
:
Z
Parche
Figura 8.3A. Recombinación homóloga. /DIRUPDFLyQGHODXQLyQGH+ROOLGD\ RLQWHUFDPELRFUX]DGRGHFDGHQDV VHSURGXFHDODOLQHDUVH
GRVGREOHKpOLFHVKRPyORJDVHQODVTXHXQDGHODVFDGHQDVGHFDGDG~SOH[HVFOLYDGD\OXHJRLQYDGHDORWURG~SOH[(VWDVUHDFFLRQHV\ODV
VXEVLJXLHQWHVPLJUDFLRQHVGHFDGHQDVRQFDWDOL]DGDVSRUSURWHtQDVTXHIXQFLRQDOPHQWHDFW~DQFRPRUHFRPELQDVDV/RVVLWLRVGHFRUWHGHOD
XQLyQGH+ROOLGD\OXHJRGHVXLVRPHUL]DFLyQGHWHUPLQDQVLVHSURGXFHHOLQWHUFDPELRGHSHTXHxRVIUDJPHQWRVGH'1$HQXQDFDGHQD SDUFKH RVLVHSURGXFHODUHFRPELQDFLyQGHORVG~SOH[ HPSDOPH 185
Capítulo 8 / Evasión viral a la respuesta inmune del hospedador
1,02
A
B
C
D
E
F
G
H
O
1,0
0,98
0,96
0,94
0,92
0,9
0,88
0,86
Similitud
0,84
0,82
0,8
0,78
0,76
0,74
0,72
0,7
0,68
0,66
0,64
0,62
0,6
0,58
0,56
0,54
0
20
40
60
80
100 120
140
160
180
200
220
240
260
280
300
320
340
360 380
400
420
440
460
480
Posición nucleotídica
Secuencia recombinante más probable:
1
A
B
C
D
E
F
G
H
Gib
Ch
WM
0,9
Valor de agrupamiento
0,8
0,7
0,6
0,5
0,4
0,3
0,2
0,1
0
350
400
450
500
550
600
650
700
750
Posición nucleotídica
Figura 8.3B. Análisis de una secuencia parcial del gen S de un aislamiento de HBV (Rec.Arg-1) donde se evidencia un evento de
recombinación entre secuencias consenso adscriptas a los genotipos A y D, demostrado mediante los comandos Similarity Plot
(arriba) y Grouping Scan (abajo) contenidos en los programas Simplot y Simmonic Sequence Editor Package, respectivamente.
/DPXHVWUDVpULFDIXHREWHQLGDGHXQSDFLHQWHDGXOWRDUJHQWLQRFRQDQWHFHGHQWHVGHGURJDGLFFLyQHQGRYHQRVDFRQVHURORJtDSRVLWLYDSDUD+%9
+&9\+,9$+JHQRWLSRVGHO+%&*LE+%9GHOJLEyQ&K+%9GHOFKLPSDQFp:0+%9GHOPRQRODQXGR(ODQiOLVLVHQHOSURJUDPDSimmonic
Sequence Editor PackageIXHJHQWLOPHQWHUHDOL]DGRSRUHO3URI'U3HWHU6LPPRQGV 8QLYHUVLGDGGH(GLPEXUJR5HLQR8QLGR (QWUHDPEDVLPiJHQHVVHPXHVWUDXQHVTXHPDGHODVHFXHQFLDUHFRPELQDQWHPiVSUREDEOH&HQWURSDUDHO(VWXGLRGHODV+HSDWLWLV9LUDOHV'HSWR0LFURELRORJtD
)DFGH0HGLFLQD8%$
186
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
Latencia
Flia. Herpesviridae SRUHMHPSOR+69(%9HWF
HPV
HBV en linfocitos
Adenovirus en linfocitos T
HIV en ciertos LT en reposo
Tabla 8.3. Algunos ejemplos de disminución de la expresión génica viral.
de mutantes de escape a ambas. La pregunta que aún no tiene
UHVSXHVWDGH¿QLWLYDHVVLODYDULDELOLGDGSURPXHYHODSHUVLVWHQFLD
del HCV o si es ésta la que contribuye a una mayor variabilidad.
Sorprendentemente, se ha demostrado que también el virus
VLQFLFLDO UHVSLUDWRULR 569 ±LPSRUWDQWH FDXVD GH EURQTXLROLWLV
DJXGDVHQODFWDQWHVPHQRUHVGHGRVDxRV±HVFDSD]GHH[KLELUXQ
VLJQL¿FDWLYRJUDGRGHYDULDELOLGDGJHQyPLFD\DQWLJpQLFDQRVyOR
HQWUHGLYHUVRVDLVODPLHQWRVHQORFDOL]DFLRQHVJHRJUi¿FDVGLVWDQWHV
VLQRWDPELpQHQXQDPLVPDXELFDFLyQJHRJUi¿FDHQWHPSRUDGDV
VXFHVLYDV/RVPHFDQLVPRVTXHFRQWULEX\HQDHOORLQFOX\HQD OD
HPHUJHQFLDGHPXWDQWHVHQHStWRSHV%E ODJHQHUDFLyQGHSpSWLGRV
PRGL¿FDGRVDWUDYpVGHHYHQWRVGHFDPELRVGHPDUFRGHOHFWXUD
frame shifting PHGLDQWHODLQVHUFLyQGHXQQXFOHyWLGRTXHSURGXFH
codones diferentes hasta ser subsiguientemente compensado por
XQDGHOHFLyQQXFOHRWtGLFDF KLSHUPXWDFLRQHVDVRFLDGDVDP~OWLSOHVFDPELRV$ĺ*\G GXSOLFDFLRQHVJHQyPLFDV(VWRVFDPELRV
podrían contribuir a la escasa protección conferida por infecciones
previas por RSV en sucesivas HSLGHPLDVHQXQPLVPRSDFLHQWH KDELWXDOPHQWHSHGLiWULFR 1.2 DISMINUCIÓN DE LA EXPRESIÓN GÉNICA VIRAL
La disminución de la H[SUHVLyQJpQLFDHQODIDVHGHlatencia de
ciertos virus de la familia HerpesviridaeHVXQPHFDQLVPRH¿FD]
para evitar el reconocimiento por parte del sistema inmune de la
FpOXODKRVSHGDGRUD 7DEOD /DLQKLELFLyQGHODSURGXFFLyQGH
la progenie viral en esta fase latente implica la puesta en marcha
de diferentes mecanismos por distintos virus, aun correspondientes
DXQDPLVPDIDPLOLDYLUDO(OORSXHGHDEDUFDUGHVGHODFDVLH[FOX\HQWHH[SUHVLyQGHWUDQVFULSWRVGH51$FRQSRODULGDGGHDQWLPHQVDMHUR GHQRPLQDGRV/$7V±GHOLQJOpVLatency Associated Transcripts– HQQHXURQDVODWHQWHPHQWHLQIHFWDGDVSRUHOYLUXVKHUSHV
VLPSOH[ +69 KDVWDODREOLJDGDVtQWHVLVGHODSURWHtQD(%1$
para mantener el DNA en estado episomal durante la fase latente
en la infección por (%9(QHOSULPHUFDVRODH[SUHVLyQGHORV
/$7VLQKLEHODapoptosis neuronal, al tiempo que la ausencia de
H[SUHVLyQVLJQL¿FDWLYDGHSpSWLGRVYLUDOHVHQHOFRQWH[WRGHPROpculas del &0+,HQODVQHXURQDV DVXYH]SUHVHQWDGRUDVGH¿FLHQWHVGHDQWtJHQRV JDUDQWL]DODpersistencia viral. La síntesis de la
SURWHtQD(%1$GXUDQWHODIDVHODWHQWHGHODLQIHFFLyQSRUEBV
en OLQIRFLWRV% \UHJXODUPHQWHH[SUHVDGDVHQWXPRUHVDVRFLDGRVD
(%9 HVGHHVSHFLDOLQWHUpV6LELHQVXFRQVWLWXFLyQULFDHQGRPLnios repetidos de glicina-alanina, fue inicialmente postulada como
la razón de una inadecuada degradación proteasómica, y por ende
de la consiguiente evasión a la vigilancia inmune por los linfocitos
7&'+HOKDOOD]JRUHFLHQWHGHSpSWLGRVGH(%1$SURYHQLHQWHV
de productos de neosíntesis ribosomal defectuosa presentados en el
FRQWH[WRGHO&0+,SHUPLWLyUHYHODUODH[LVWHQFLDGHOLQIRFLWRV7
&'+HVSHFt¿FRV'DGRTXH(%1$GHELGRDVXGRPLQLRUHSHWLWLvo glicina-alanina inhibe su propia síntesis, se ha postulado que la
evasión a los OLQIRFLWRV7CD4+ y &'+ podría ocurrir debido a que
no se alcanza un umbral necesario para la presentación.
La disminución de la H[SUHVLyQJpQLFDYLUDOHVXQDHVWUDWHJLD
TXHSXHGHSURGXFLUHIHFWRVDQiORJRVDODinhibición de la presentación antigénica, dado que en ambos procesos se afecta el reconocimiento de péptidos virales por los OLQIRFLWRV7FLWRWy[LFRV &7/V 1.3 DISOCIACIÓN TEMPORAL DE LA EXPRESIÓN GÉNICA
2WUDHVWUDWHJLDSRFRFRQYHQFLRQDOSHURLJXDOPHQWHH¿FD]SDUD
promover infecciones persistentes en reservorios animales es la
llevada a cabo por los miembros de la familia Arenaviridae, cuyo
principal representante en nuestro país es el virus Junín, agente
etiológico de la )LHEUHKHPRUUiJLFDDUJHQWLQD
(QFRQMXQWRODGLVRFLDFLyQWHPSRUDOGHODH[SUHVLyQ in vitro e
in vivoGHORVJHQHV1\* FRGL¿FDGRVHQHOVHJPHQWR6>Small,
[email protected] GHO51$\GHORVJHQHV/\= FRGL¿FDGRVHQHOVHJPHQWR/>[email protected] GHO51$GHORVDUHQDYLUXVVXJLHUHTXHpVWRV
podrían permanecer temporalmente ocultos en el citoplasma celular
y pasar –al menos parcialmente– desapercibidos para el sistema
inmune.
6HKDGHPRVWUDGRTXHVyORFXDQGRVHVLQWHWL]DVX¿FLHQWHFDQWLGDGGHSURWHtQD1 GHODQXFOHRFiSVLGH ODPLVPDIXQFLRQDFRPR
anti-terminadora de la transcripción y puede sintetizarse luego la
glicoproteína G de envoltura. La transcripción y la replicación viral son a su vez reguladas por Z, una proteína de matriz implicada
WDPELpQHQODEURWDFLyQYLUDO YpDVHODUHSOLFDFLyQGHORVDUHQDYLUXV
FDStWXOR (QODLQIHFFLyQH[SHULPHQWDOPXULQDFRQHOYLUXV
/&0 HOPiVHVWXGLDGRGHORVDUHQDYLUXV HVWDH[SUHVLyQDQWLJpQLca peculiar afecta la actividad de los &7/V\HYLWDWHPSRUDOPHQWH
la de los anticuerpos neutralizantes preformados.
5DWRQHVLQIHFWDGRVH[SHULPHQWDOPHQWHFRQ/&0H[KLEHQXQD
H[SUHVLyQWHPSRUDOPHQWHGLIHUHQFLDGDGHODVSURWHtQDV1 LQLFLDOPHQWHSURGXFLGD \* VXEVLJXLHQWHPHQWHVLQWHWL]DGD (QFRQVHFXHQFLD 1 DQWHFHGH HQ DSUR[LPDGDPHQWH KV VX SUHVHQWDFLyQ
DQWLJpQLFDHQHOFRQWH[WRGHPROpFXODVGHOCMH-I respecto a G. La
GLIHUHQWHFLQpWLFDLQLFLDOGHH[SUHVLyQGH1YV*PROGHDODUHVSXHVWDLQPXQRGRPLQDQWHGHORV&7/V\DTXHORVOLQIRFLWRVHVSHFt¿FRV
SDUD1 &7/V1 VRQVHQVLELOL]DGRVDQWHVTXHORVHVSHFt¿FRVSDUD
G, por lo que inician el control de la infección con cargas virales
PD\RUHVTXHODVTXHHQIUHQWDUiQVXEVLJXLHQWHPHQWHORV&7/V*
$QWH HVWD FLUFXQVWDQFLD OD VHQVLELOL]DFLyQ GH HVWRV ~OWLPRV HVWi
DIHFWDGD\DTXHKDEUiPHQRVFpOXODVLQIHFWDGDVFRQODVTXHSRdrían interactuar.
/DUHVSXHVWD7FLWRWy[LFDWHPSUDQDKDELWXDOPHQWHHOLPLQDOD
mayor parte de la población viral presente en una infección determinada, pero si no logra dicho cometido y la carga viral inicial es alta,
H[LVWHHOULHVJRGHDJRWDPLHQWRGHORV&7/VGHELGRDODHQpUJLFD
activación y subsiguiente pérdida funcional o física de los mismos
YpDVHHOtWHPDHQHVWHFDStWXOR (OORRFXUUHFRQORV&7/V1JHQHUDGRVDOLQLFLRGHODLQIHFFLyQH[SHULPHQWDOPXULQDFRQLCM. Se
KDREVHUYDGRTXHVLELHQ*QRHVGHWHFWDEOHPiVDOOiGHORVGtDV
1SHUVLVWHD~QGHVSXpVGHORVGtDV6HKDSRVWXODGRTXHODH[SUHsión diferencial de proteínas virales, debido al delicado mecanismo
de autorregulación negativa del virus, favorece la persistencia viral
HQHOUDWyQ\TXHODDXVHQFLDGH&7/VREVHUYDGDHQHOPRGHORH[SHULPHQWDOPXULQRFRQWUDHStWRSHVYLUDOHVHVSHFt¿FRVGHLCM, es
consecuencia de dicha persistencia viral y no su causa.
Asimismo, la ausencia temporal de síntesis de glicoproteínas
de envoltura impide la consiguiente formación de viriones, cuya
HVWUXFWXUDH[WHUQDHVHOEODQFRGHDFFLyQGHORVanticuerpos neuWUDOL]DQWHVIRUPDGRVFRQDQWHULRULGDG(VWDVHVWUDWHJLDVMXQWRDOD
HPHUJHQFLDGHPXWDQWHVHQHStWRSHVYLUDOHV%\7\DODLQKLELFLyQ
Capítulo 8 / Evasión viral a la respuesta inmune del hospedador
187
6HKDUHSRUWDGRODLQKLELFLyQGHODH[SUHVLyQGHPROpFXODV
del CMH-II inducida por ,)1HQODLQIHFFLyQSRUHOYLUXVYDULFHOD]yVWHU 9=9 (QHVWHFDVRGLFKRDJHQWHDFW~DVREUHGLYHUVDV
proteínas de la cascada de transducción de señales inducidas por
,)1Ȗ±FRPR67$7\-$.±LQKLELHQGRVXHIHFWRLQGXFWRU
de la transcripción de los genes del CMH-II, impidiendo así la
H[SUHVLyQGHHVWDVPROpFXODVSUHVHQWDGRUDVGHDQWtJHQRVD/7
CD4+$VXYH]ODSURWHtQD%=/)GHEBV se une y secuestra
a las moléculas del CMH-II –tanto a aquellas que se encuentran en el citoplasma como a las localizadas en la membrana
SODVPiWLFD±LPSLGLHQGRODH[SUHVLyQGHHVWDVPROpFXODVHQOD
VXSHU¿FLHFHOXODU
2. ALTERACIÓN DE LOS MECANISMOS
2WURPHFDQLVPRXWLOL]DGRSRUFLHUWRVYLUXVSDUDLQKLELUODH[DE DEFENSA DEL HOSPEDADOR
presión del CMH-I y/o II es la degradación de estas moléculas por
HOSURWHDVRPDLQGXFLGDSRUSURWHtQDVYLUDOHV8QHMHPSORGHHOORHV
2.1 INHIBICIÓN DE LA PRESENTACIÓN ANTIGÉNICA
HOHIHFWRHMHUFLGRSRUHOSURGXFWRGHOJHQ86GHO+&09
La estrategia de evasión que implica la inhibición de la preSe ha demostrado que diversas familias de virus poseen esta estrategia de escape, que es llevada a cabo mediante la implementación sentación antigénica puede llevarse a cabo impidiendo la correcta
GHGLYHUVRVPHFDQLVPRV 7DEOD TXH±HQJHQHUDO±SRGUtDQFOD- generación del péptido viral antigénico, o bien inhibiendo el adeVL¿FDUVHHQGRVJUDQGHVJUXSRVD ODLQKLELFLyQGHODH[SUHVLyQGH FXDGRWUDQVSRUWHGHOPLVPRKDFLDODVXSHU¿FLHFHOXODU8QHMHPSOR
moléculas del CMH-I y/o &0+,,\E ODLQKLELFLyQGHOSURFHVD- GHOSULPHUFDVRHVHODQWtJHQR(%1$GHEBV, que –como se
mencionó anteriormente– es procesado de manera subóptima por
PLHQWRDQWLJpQLFR )LJXUDV$\% 'HQWURGHOSULPHUJUXSRODVHVWUDWHJLDVPiVFRP~QPHQWHXWLOL- el proteasoma al no alcanzar un umbral cuantitativo adecuado, no
]DGDVSRUORVYLUXVVRQODLQKLELFLyQGHODH[SUHVLyQGHCMH-I y/o SHUPLWLHQGRFRQHOORVXDSURSLDGDSUHVHQWDFLyQHQHOFRQWH[WRGH
&0+,,HQODVXSHU¿FLHFHOXODU\ODGHJUDGDFLyQGHHVWDVPROpFXODV moléculas de histocompatibilidad. En el segundo caso, se puede
HQHOSURWHDVRPDDPERVPHFDQLVPRVLQWHU¿HUHQFRQHOFRUUHFWR destacar la acción de ciertas proteínas virales en el R.E., ya sea
uniéndose a las proteínas transportadoras 7$3V 86GH+&09
funcionamiento de las moléculas presentadoras de antígenos.
/DHVWUDWHJLDGHLQKLELUODH[SUHVLyQGHPROpFXODVGHOCMH-I es y ICP47 del +69 RUHWHQLHQGRDOFRPSOHMRSpSWLGRYLUDO&0+
habitualmente empleada en el inicio de las infecciones virales, lo que HQHOUHWtFXOR 86GH+&09 PHGLDQWHHVWDVGRVHVWUDWHJLDVVH
impide el reconocimiento por parte de los /7&'+FLWRWy[LFRVDXQ- impide el transporte de los péptidos antigénicos desde el R.E. a la
que permite la participación inicial de las NK. Subsiguientemente, la VXSHU¿FLHFHOXODU\SRUFRQVLJXLHQWHVXDGHFXDGDSUHVHQWDFLyQ
producción de ,)1ȖSRUODV1.LQFUHPHQWDODH[SUHVLyQGHDTXHOODV 2EVHUYHHOOHFWRUTXHXQPLVPRYLUXV +&09 SURSRQHP~OWLSOHV
PROpFXODVGHVXSHU¿FLH±\SRUHQGHODSUHVHQWDFLyQGHSpSWLGRVYLUD- HVWUDWHJLDV HQFRQVHFXWLYRVSDVRVGHXQDPLVPDYtD SDUDHYLWDUHO
OHV±ORTXHVLJQL¿FDUiHO¿QDOGHODDFWLYLGDGGHGLFKDHVWLUSHFHOXODU reconocimiento por los OLQIRFLWRV7&'+.
con la subsiguiente participación de la población &'+.
'LYHUVDV SURWHtQDV YLUDOHV VH XQHQ D OD PROpFXOD ȕ 2.2. INHIBICIÓN O MODIFICACIÓN DE LA ACTIVIDAD DEL
PLFURJOREXOLQDVHFXHVWUiQGRODHLPSLGLHQGRODSUHVHQWDFLyQGH SISTEMA INTERFERÓN (IFN)
péptidos por moléculas del &0+,HMHPSORVGHODVPLVPDVVRQODV
SURWHtQDV(GHDGHQRYLUXVPol de +%9\ODFRGL¿FDGDSRUHOJHQ Luego de la infección de una célula por un virus determinado, éste
8/GHOFLWRPHJDORYLUXVKXPDQR +&09 (QHOPLVPRVHQWL- debe multiplicarse y enfrentar la gran batería de mecanismos de
GR±SHURGHPDQHUDLQGLUHFWD±ODSURWHtQD16%GHHCV impide defensa que monta el sistema inmune del hospedador. Una de estas
el transporte de las moléculas del &0+,DODVXSHU¿FLHFHOXODUDO primeras barreras de defensa es el sistema ,)1/RVGLIHUHQWHVWLunirse a proteínas de membrana ubicadas en el sistema de vesícu- SRVGH,)1VVHFUHWDGRVFLUFXODQHQHORUJDQLVPRGHOKRVSHGDGRU\
ODVGHWUDQVSRUWH/DLQKLELFLyQGHODH[SUHVLyQGHOCMH-I puede SURPXHYHQODH[SUHVLyQ±HQORVGLVWLQWRVWLSRVFHOXODUHV±GHPHFDSURGXFLUVHGHPDQHUDJHQHUDO±FRPRHQORVHMHPSORVDQWHULRUPHQWH nismos DQWLYLUDOHVTXHSRGUiQOLPLWDUODUHSOLFDFLyQ\GLVHPLQDFLyQ
mencionados– o diferencial como en el caso del HIV y herpesvirus viral.
Los virus han desarrollado diversos mecanismos para evadir
KXPDQR ++9 &RQUHODFLyQDHOORPLHQWUDVTXHODSURWHtQD
Nef de +,9LQKLEHODH[SUHVLyQHQODVXSHU¿FLHFHOXODUGH+/$$ a los efectos antivirales e inmunomoduladores del sistema ,)1
\+/$%\DXPHQWDODGH+/$(ODVSURWHtQDV.\.GH++9 /DPD\RUtDGHORVYLUXVVLQRWRGRVSRVHHQH¿FLHQWHV\YDULDGRV
UHJXODQGLIHUHQFLDOPHQWHODH[SUHVLyQGH+/$$\+/$%VHJ~Q mecanismos para inhibir –en diverso grado– la respuesta inmune
la etapa del ciclo de replicación del virus. La estrategia magistral del hospedador producida por ,)1/RVPHFDQLVPRVPROHFXODUHV
del HIV logra evadir tanto a los /7&'+ VHLQKLEHQPROpFXODV involucrados en este evento pueden abarcar desde un bloqueo geIXQFLRQDOHVGHFODVH,FRPR+/$$R+/$% FRPRDODVNK neral de los procesos de transcripción y traducción de la célula hosKD\XQDPROpFXODGHKLVWRFRPSDWLELOLGDGQRFOiVLFDFRPR+/$ pedadora hasta la inhibición selectiva de algún factor involucrado
E, pero que es útil para interactuar con el receptor lectínico tipo C en el sistema ,)1
3DUDXQDPHMRUFRPSUHQVLyQGHORVPHFDQLVPRVPROHFXODUHV
&'1.*$%VREUHODVNK para enviar una señal inhibitoria
de evasión al sistema ,)1pVWRVVHFODVL¿FDUiQVHJ~QODinterfeVREUHHVWDVFpOXODV de la síntesis de ,)1ȕSRGUtDQFRQWULEXLUHQFLHUWDVFLUFXQVWDQFLDV
a evadir la vigilancia inmunológica del UHVHUYRULRDQLPDOQDWXUDO HO
UDWyQGRPpVWLFR\HOKiPVWHUSDUD/&0 SHUVLVWHQWHPHQWHLQIHFWDGR
7DEOD (OOHFWRUGHEHUiWHQHUSUHVHQWHTXHODVFRQFOXVLRQHVUHIHULGDV
HQSiUUDIRVDQWHULRUHVDODJRWDPLHQWRGHORV&7/VHQODLQIHFFLyQ
H[SHULPHQWDOSHUVLVWHQWHPXULQDFRQ/&0KDQVLGRH[WUDSRODGDV
DLQIHFFLRQHVKXPDQDVGHH[FHSFLRQDOLPSRUWDQFLDFRPRODVSURducidas por HIV, HBV y HCV, aunque en ellas las causas virales
asociadas a la persistencia son diferentes.
Genoma bisentido
Arenavirus:VyORFXDQGRVHH[SUHVDVX¿FLHQWHFXDQWtDGHODSURWHtQD
GHODQXFOHRFiSVLGH 1 FRPRDQWLWHUPLQDGRUDGHODWUDQVFULSFLyQSXHGH
VLQWHWL]DUVHODJOLFRSURWHtQD*/DWUDQVFULSFLyQ\ODUHSOLFDFLyQYLUDOHVWiQ
UHJXODGDVSRU=
Tabla 8.4. Disociación temporal de la expresión génica.
188
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
rencia viral se produzca sobre los siguientes eventos, procesos o
moléculas:
a. ([SUHVLyQJHQHUDOGHORVJHQHVGHODFpOXODKRVSHGDGRUD
b. &RPSRQHQWHVHVSHFt¿FRVGHORVPHFDQLVPRVGHLQGXFFLyQGH
,)1
c. Cascadas de transducción de señales activadas por ,)1
d. Proteínas efectoras del sistema ,)1
se unen y secuestran al RNAdc impidiendo su reconocimiento por
parte del sistema ,)1\SRUHQGHODLQGXFFLyQGHOPLVPR
Un segundo blanco en la inhibición de las vías de inducción del
,)1HVHOIDFWRUGHWUDQVFULSFLyQ,5)&LHUWDVSURWHtQDVYLUDOHV
93GHOvirus eEROD16$GHO+&9\1616GHO569 impiden la fosforilación de este factor y su consiguiente activación,
dimerización y traslocación al núcleo, inhibiendo así la transcripFLyQGHORVGLIHUHQWHVJHQHVUHJXODGRVSRUpVWH ,6* 3RUHOFRQ2.2.1 Interferencia viral sobre la expresión general de los genes trario, otros virus como +69±DWUDYpVGHODSURWHtQD,&3±\
de la célula hospedadora
LCM –mediante su nucleoproteína N– impiden la acumulación en
La interferencia viral sobre el sistema ,)1 QR QHFHVDULDPHQWH el núcleo de ,5)DFWLYDVLQLQWHUYHQLUHQORVSDVRVSUHYLRVGH
GHEHDIHFWDUDODVYtDVHVSHFt¿FDVGHLQGXFFLyQGHOPLVPRRDVXV fosforilación de dicho factor. A su vez, el virus ++9±DJHQWHFDXmoléculas efectoras. Otro mecanismo de LQWHUIHUHQFLDPiVJHQHUDO sal del VDUFRPDGH.DSRVL±SRVHHSURWHtQDVKRPyORJDVDODV,5)V
HVODLQKLELFLyQGHODH[SUHVLyQGHORVJHQHVGH,)1DWUDYpVGHOD GHQRPLQDGDVY,5)VTXHUHHPSOD]DQDODVGHRULJHQFHOXODU F,5)V inhibición de la transcripción en la célula hospedadora. Este pro- como antagonistas en las vías de inducción del ,)1LQKLELHQGRDVt
ceso es logrado por diferentes virus de diversas maneras, algunas GLFKDYtD DH[FHSFLyQGHY,5)TXHODHVWLPXOD GHODVFXDOHVVHGHWDOODQHQOD7DEOD(QJHQHUDOVHKDGRFX$OJXQDVGHODVSURWHtQDVYLUDOHVTXHLQWHU¿HUHQHQORVPHFDQLVmentado la acción directa de proteínas virales sobre diferentes mos de inducción del ,)1\VXVEODQFRVFHOXODUHVVHGHWDOODQHQOD
etapas en los eventos de transcripción y traducción de los RNAm. 7DEOD\ODV)LJXUDV\
8QHMHPSORGHHOORHVODSURWHtQD16GHLQÀXHQ]DTXHLQKLEHHO
procesamiento de los pre-RNAm y su transporte desde el núcleo 2.2.3. Interferencia viral sobre las cascadas de transducción de
DOFLWRSODVPD\SRUHQGHLQWHU¿HUHHQGLFKRVHYHQWRVFHOXODUHV
señales activadas por IFN
/DSURWHtQDYKV viral host shut off GHHSV degrada los RNAm Diversos virus suprimen las diferentes cascadas de transducción de
celulares y virales, pero como la velocidad de síntesis de estos últi- VHxDOHVDFWLYDGDVSRU,)1V 7DEOD\)LJXUD QRVyORSDUD
PRVHVWDQVLJQL¿FDWLYDPHQWHPD\RUHOHIHFWRQHWRHVODLQKLELFLyQ HYLWDUODH[SUHVLyQGHORVJHQHVHVWLPXODGRVSRUpVWRV ,6* VLQR
de la síntesis de proteínas celulares pero no del HSV.
WDPELpQSDUDLPSHGLUODSURGXFFLyQGHORVSURSLRV,)1V(VWR~OWLPR
(Op[LWRGHODUHSOLFDFLyQYLUDOGHSHQGHGHXQHQWRUQRFHOXODU HVGHELGRDTXHH[LVWHXQSURFHVRGHUHWURDOLPHQWDFLyQSRVLWLYDSRUHO
funcional, por lo que los virus no pueden abolir por completo el que estas cascadas de señalización –activadas por el ,)1±SURGXFHQ
PHWDEROLVPRGHODFpOXODKRVSHGDGRUDHQFDPELRSXHGHQLQKLELU XQDXPHQWRHQODH[SUHVLyQGHORVJHQHVTXHFRGL¿FDQSDUDHVWHtipo
FRPSRQHQWHVHVSHFt¿FRVGHOVLVWHPD,)1
de citoquinas.
(OPiVLPSRUWDQWHEODQFRGHODinterferencia viral en este as2.2.2. ,QWHUIHUHQFLDYLUDOVREUHFRPSRQHQWHVHVSHFt¿FRVGHORV SHFWRHVODYtDGHODV-$.67$7'LIHUHQWHVYLUXVFDXVDOHVGHLQIHFmecanismos de inducción del IFN
FLRQHVDJXGDV sarampión, 569SDUDLQÀXHQ]DSDURWLGLWLVDGHQR8QEODQFRLPSRUWDQWHSDUDLQKLELUHOVLVWHPD,)1UHVLGHHQXQDGH YLUXV1LSDKGHQJXHHWF RSHUVLVWHQWHV HCV, +69+39HWF las señales principales de la infección viral: el RNA a doble cadena LQWHU¿HUHQFRQODDGHFXDGDDFWLYLGDGGHHVWDVSURWHtQDVFHOXODUHV
51$GF \DVHDH[WUDFHOXODURLQWUDFHOXODU(QHVWHVHQWLGRGLYHU- LQDFWLYiQGRODVVHFXHVWUiQGRODVRLQGXFLHQGRVXGHJUDGDFLyQ3RU
VDVSURWHtQDVYLUDOHV 16GHLQÀXHQ]D\(/GHOYLUXVYDFFLQLD su parte, DGHQRYLUXV±DWUDYpVGHVXSURWHtQD($±QRVyORDFW~D
‡Inhibición de la expresión de moléculas del CMH-I y/o CMH-II
- Inhibición de la expresión de moléculas del &0+,HQODVXSHU¿FLHFHOXODU
HIV: 1HILQKLEH+/$$\+/$%\DXPHQWDODH[SUHVLyQGH+/$(
HBV: 3ROLQKLEHȕPLFURJOREXOLQDHQODVXSHU¿FLHGHKHSDWRFLWRV
Adenovirus: (VHFXHVWUDODȕPLFURJOREXOLQD
HCMV:8/VHFXHVWUDODȕPLFURJOREXOLQD
HHV-8: . FRQ+/$$ \. FRQ+/$$\+/$% UHJXODQGLIHUHQFLDOPHQWHODH[SUHVLyQ
por endocitosis del &0+,
HCV:16%LQKLEHODH[SUHVLyQGHPROpFXODVGHO&0+,HQODVXSHU¿FLHFHOXODU
- Inhibición de la expresión de moléculas del &0+,,HQODVXSHU¿FLHFHOXODU
VZV:DFW~DVREUH67$7\-$.LQKLELHQGRODH[SUHVLyQGHPROpFXODVGHO&0+,,LQGXFLGD
por ,)1Ȗ
EBV: %=/)VHFXHVWUDPROpFXODVGHO&0+,,LQWUDFHOXODU\GHVXSHU¿FLH
- Degradación de moléculas del CMH-I y CMH-II en el proteasoma
HCMV:86GLULJHDODVPROpFXODVGHO&0+DOSURWHDVRPD
‡Inhibición del procesamiento antigénico
- Inhibición de la generación del péptido antigénico
EBV: HODQWtJHQR(%1$HVSURFHVDGRGHPDQHUDVXEySWLPDSRUHOSURWHDVRPD
- Inhibición del transporte intracelular de los antígenos virales
HCMV (US6) y HSV (ICP47):VHXQHQDODVTAPs e impiden el transporte de los antígenos
HQHO5(
HCMV (US3):UHWLHQHDOFRPSOHMRSpSWLGR&0+HQHO5(
Tabla 8.5. Algunos ejemplos de inhibición de la presentación antigénica.
Capítulo 8 / Evasión viral a la respuesta inmune del hospedador
189
HIV*
HHV -8*
Presentación en la
superficie celular
HCMV
CMH -I + Ag
Membrana plasmática
HCV
HCMV
Citoplasma
Transporte a la
superficie
celular
R.E.
Calnexina
CMH-I
B M
Adenovirus
HBV
HCMV
Tap1
Tap2
HSV
HCMV
Péptidos
PROTEÍNA
EBV
PROTEASOMA
Figura 8.4A. Efecto de la acción viral sobre el procesamiento y presentación antigénica por la vía endógena. 1yWHVHTXHHQWRGRV
ORVHMHPSORVODLQIHFFLyQYLUDOHMHUFHXQDDFFLyQQHJDWLYDVREUHODVGLVWLQWDVHWDSDVGHOSURFHVDPLHQWR\SUHVHQWDFLyQDQWLJpQLFDJOREDOPHQWH
consideradas, excepto en los casos (*) de +,9\++9GRQGHHOHIHFWRVREUHODH[SUHVLyQGHO&0+,VHSURGXFHGHPDQHUDGLIHUHQFLDOVHJ~Q
ODPROpFXODGH+/$LPSOLFDGD YpDVHHOWH[WR 5(UHWtFXORHQGRSOiVPLFR
VREUH67$7VLQRTXHWDPELpQVHFXHVWUDDOIDFWRU,5)LPSLGLHQGRGHHVWDPDQHUDODIRUPDFLyQGHOFRPSOHMR,6*)2EVHUYH
HOOHFWRUTXHODLQKLELFLyQGH67$7FRQGXFHDODLQKLELFLyQGHOD
H[SUHVLyQGHORVJHQHVLQGXFLGRVSRU,)1Į\ȕ WLSR, PLHQWUDV
TXHODGH67$7SURPXHYHHOGp¿FLWGHODH[SUHVLyQGHORVJHQHV
inducidos por ,)1Įȕ\WDPELpQȖ WLSR,, YpDVHOD)LJXUD
Otra proteína celular blanco de la acción viral es la proteín-quinasa
7<.DODTXHVHXQHODSURWHtQD(GHHPV impidiendo su actiYDFLyQ\SRUHQGHODFDVFDGDGHODV-$.67$7/RVSR[YLUXVXWLOLzan una estrategia diferente para producir el mismo efecto. En este
sentido, el virus vaccinia produce una proteína soluble que se une al
,)1DFWXDQGRGHPDQHUDDQiORJDDOUHFHSWRUFHOXODU YLURUUHFHSWRU pero sin producir el efecto activador de la cascada.
2.2.4 Interferencia viral sobre proteínas
efectoras del sistema IFN
8QDIRUPDH¿FLHQWHGHHYDGLUODDFFLyQGHORV,)1VHVLQKLELUGLUHFWDPHQWHODVSURWHtQDVHVSHFt¿FDVTXHPHGLDQODUHVSXHVWDDQWLYLUDO
7DEOD\)LJXUD $OJXQDVGHHVWDVSURWHtQDVantivirales dependen de las moléculas de 51$GFSDUDVXDFWLYDFLyQHQ]LPiWLFD
Es por ello que aquellos virus que poseen proteínas con capacidad
de secuestrar al RNAdc son capaces de evitar la activación de los
mecanismos mediados por la 3.5\RSRUODYtD¶¶2$651$VD
L. Dado que la molécula de RNAdc desempeña un rol central en
la inducción del ,)1ORVYLUXVTXHSUHVHQWDQODFDSDFLGDGGHXQLU
DDTXHOODPROpFXODSRVHHQODYHQWDMDGHEORTXHDUWDQWRODSURGXFción como la acción del ,)19LUXVWDOHVFRPRHCV, HIV, EBV y
adenovirus, utilizan una estrategia diferente para producir el misPRHIHFWR/RVJHQRPDVGHpVWRVFRGL¿FDQSDUDSHTXHxRV51$V
que compiten con el RNAdc para unir a la PKR, y así impedir la
DFFLyQDQWLYLUDOGHHVWDSURWHtQD YpDVHHOFDStWXOR0HFDQLVPRV
de GHIHQVD Ciertos virus producen proteínas que inhiben la acción de la
PKR directa o indirectamente. En el primer caso actuando como
un pseudo-sustrato para esta proteína celular como ocurre con
ODVSURWHtQDV(GH+&97DWGH+,9\./GHOYLUXVYDFFLQLDR
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
190
EB V
(-)
Presentación en la
superficie celular
Proteína
CMH-II + Ag
Membrana plasmática
Endocitosis
Citoplasma
pH 7,5
Transporte a la
superficie
celular
Endosomas
VZV
pH 5,5
(-)
Expresión de
genes CMH-II
(-)
EB V
R.E.
Péptidos
CMH-II
Cadena
invariante
Vesícula de fusión
Figura 8.4B. Efecto de la acción viral sobre el procesamiento y presentación antigénica por la vía exógena. 5(5HWtFXORHQGRSOiVPLFR
inactivando a la 3.5FRPRORKDFHODSURWHtQDȖGH+69
A su vez, esta misma proteína de +69LQKLEHLQGLUHFWDPHQWHOD
acción de la 3.5DOLQGXFLUODGHVIRVIRULODFLyQGHH,)ĮUHYLUtiendo de este modo el bloqueo de la traducción producida por
esta proteína antiviral. Otra manera indirecta de inhibir la PKR
HVODTXHVHSURGXFHHQODLQIHFFLyQSRUHOYLUXVLQÀXHQ]D$(VWH
virus estimula la acción de un inhibidor natural de esta proteína
denominado SIPK.
/D YtD GH OD ¶¶2$651$VD / HV EORTXHDGD SRU GLYHUVRV
virus como HIV y +69(OYLUXVGHODLQPXQRGH¿FLHQFLDKXPDna induce la síntesis de un inhibidor celular natural de la RNAsaL
GHQRPLQDGR5/,PLHQWUDVTXHHOYLUXVKHUSHVKXPDQR±WDQWRtipo
FRPR±DFWLYDODVtQWHVLVGHDQiORJRVIXQFLRQDOHVGH¶¶2$
TXHVHXQHQDOD51$VD/\ODLQDFWLYDQ0iVD~QHOHSV también
LQKLEHODSURSLDVtQWHVLVGHODHQ]LPD¶¶2$VLQWHWDVD
(QFRQMXQWRORVPHFDQLVPRVGHHYDVLyQDTXtGHVFULWRVHYLWDQ
los dos efectos principales inducidos por el ,)1FRPRDQWLYLUDOOD
inhibición de la transcripción/replicación viral y la inhibición de la
VtQWHVLVGHSURWHtQDVYLUDOHV )LJXUD Considerando la biología de la interacción virus-hospedador, es
entendible que los antagonistas del ,)1VHDQPRGXODGRUHVPiVTXH
inhibidores totales del mismo.
Capítulo 8 / Evasión viral a la respuesta inmune del hospedador
Virus
Proteína viral
Efecto sobre la célula
3CPro
3URWHDVDTXHLQKLEHDOIDFWRUGHWUDQVFULSFLyQEDVDO
TFIID
NS1
Impide el procesamiento y transporte de RNAm ceOXODUHV
+69
ICP27
vhs
,QKLEHODVtQWHVLV\splicingGH51$PFHOXODUHV
'HVHVWDELOL]DDORV51$PFHOXODUHV\YLUDOHV
Familia
Bunyaviridae
NSs
,QKLEHDOFRPSOHMRWUDQVFULSFLRQDOGHOD51$Pol II
3ROLRYLUXV
,QÀXHQ]D$
191
Tabla 8.6. Interferencia viral sobre la expresión general de los genes de la célula hospedadora. 9pDVHHOWH[WR
Virus
Proteína viral
Efecto sobre la célula
,QÀXHQ]D
NS1
6HFXHVWUDRNAdc
,QKLEHODDFWLYDFLyQGH,5)$3\1)N%
RSV
NS1 y NS2
,QKLEHQODDFWLYDFLyQGHIRF-3
Ébola
VP35
,QKLEHODDFWLYDFLyQGHIRF-3
+&9
NS3/NS4
,QKLEHODDFWLYDFLyQGHIRF-3
+69
ICP0
,PSLGHODDFXPXODFLyQGHIRF-3 activa en el núcleo
LCM
N
,PSLGHODDFXPXODFLyQGHIRF-3 activa en el núcleo
++9
vIRF-1 y vIRF-2
Impiden la correcta acción de IRF-1 e IRF-2
vIRF-3
(VWLPXODODDFFLyQGHIRF-3 e IRF-7
+39
E6
6HXQHHLQDFWLYDDIRF-3
5RWDYLUXV
NSP1
6HXQHHLQDFWLYDDIRF-3
$GHQRYLUXV
E1A
,QKLEHD&%3XQFRDFWLYDGRUGHIRF-3
Vaccinia
E3L
6HFXHVWUDRNAdc
Tabla 8.7. ,QWHUIHUHQFLDYLUDOVREUHFRPSRQHQWHVHVSHFt¿FRVGHORVPHFDQLVPRVGHLQGXFFLyQGHIFN.
Cabe destacar que ciertos virus en la naturaleza no sólo no bloquean el sistema ,)1VLQRTXHSRUHOFRQWUDULRVRQSRWHQWHVLQGXFtores del mismo. Éste es el caso de la proteína Y,5)GHO++9OD
TXHFRQWUDULDPHQWHDRWUDVY,5)VH[SUHVDGDVSRUHOPLVPRYLUXV±
produce inducción del sistema ,)1PiVTXHVXLQKLELFLyQDOXQLUVH
a los factores celulares ,5)H,5)/DDFFLyQGHY,5)HVWLPXla la unión de ,5)H,5)DO'1$HQODVUHJLRQHVSURPRWRUDVGH
ORVJHQHVTXHFRGL¿FDQSDUD,)1ĮȕHVWLPXODQGRODSURGXFFLyQ
de los mismos. Como consecuencia, el efecto global de la infección
SURPXHYHODYLJLODQFLDLQPXQHHMHUFLGDHQODIDVHGHlatencia.
El estudio de los mecanismos mediante los cuales los virus regulan –ya sea inhibiendo o induciendo– el sistema ,)1HVLPSRUWDQWHQRVyORSDUDDOFDQ]DUXQDPHMRUFRPSUHQVLyQGHODpatogénesis
viral, sino también para permitir el desarrollo de nuevas estrategias
de SUR¿OD[LV\KHUUDPLHQWDVWHUDSpXWLFDV
2.3 MODIFICACIÓN DE LA ACTIVIDAD MEDIADA POR OTRAS CITOQUINAS
7HQLHQGRHQFXHQWDODYDVWDUHGGHcitoquinas elaboradas por las
GLVWLQWDVHVWLUSHVFHOXODUHVH[LVWHQDOPHQRVFXDWURHVWUDWHJLDV
192
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
VIRUS
IKK/TBK-1
HHV-8
HHV-8
(+)
(+)
IRF-3
IRF-7
IRF-7 IRF-7
IRF-7
IRF-3
(-)
Influenza
RSV
Ébola
HCV
HSV
HPV
Rotavirus
LCM
+1
IRF-7
IRF-7
IFN
)LJXUD9LUXVTXHLQWHU¿HUHQHQODLQGXFFLyQGHIFN de tipo I.
OOHYDGDVDFDERSRUORVYLUXVSDUDPRGL¿FDUODDFWLYLGDGPHGLDGD
por citoquinas y así evadir a la respuesta inmune del hospedador
7DEOD (VWDVHVWUDWHJLDVVRQD ODVtQWHVLVGHSURWHtQDVYLUDOHVVtPLO
FLWRTXLQDVE GHPDQHUDDQiORJDODVtQWHVLVGHSURWHtQDVVtPLO
receptores de FLWRTXLQDVF ODLQKLELFLyQGHODSURGXFFLyQGHpVWDV
RG ODDFFLyQGLUHFWDGHSURWHtQDVYLUDOHVVREUHODVPLVPDV
(QHOSULPHUFDVRORVHMHPSORVPiVHVWXGLDGRVVRQODSURWHtQD%&5)GH(%9\ODSURWHtQDFPY,/(VWDVPROpFXODVVRQ
KRPyORJDVDOD,/KXPDQDSRUORTXHVRQDJUXSDGDVGHQWURGH
las así llamadas viroquinas. Por ende, promueven una respuesta
7KHQHOKRVSHGDGRUORTXHIDYRUHFHHOHQWRUQRHQHOTXHVHHVtablece la infección persistente. Asimismo, estas moléculas son,
por ende, antagonistas del ,)1ȖGHOKRVSHGDGRU SURPRWRUGHOD
respuesta 7K Diversos miembros de la familia Herpesviridae +&09
++9HHV-7 y ++9 \PoxviridaeH[KLEHQODFDSDFLGDG
GHVLQWHWL]DUDQiORJRVGHUHFHSWRUHVSDUDFLWRTXLQDV FRPRVH
mencionó anteriormente, también denominados YLURUUHFHSWRUHV ,PDJLQHHOOHFWRUTXHpVWHHVXQPHFDQLVPRDQiORJRDOTXHHQ
XQDKLSRWpWLFDEDWDOODXQHMpUFLWRHMHFXWDHOODQ]DPLHQWRGHXQ
PLVLO XQDFLWRTXLQD FRQWUDXQEODQFRGHWHUPLQDGR ODFpOXOD
LQIHFWDGD 6LQHPEDUJRHOHMpUFLWRHQHPLJR ODSREODFLyQYLUDO SURGXFH\OLEHUD VHFUHWD EODQFRVDOWHUQDWLYRVSDUDGLFKRV
PLVLOHV YLURUUHFHSWRUHVVROXEOHV (VWDVXWLOHVWUDWHJLDSXHGHGHVDUUROODUVHFXDQGRVHFXHQWDFRQVX¿FLHQWHLQIRUPDFLyQ YLUXV
con genomas muy grandes que albergan un número muy elevado
de genes, como algunos de los miembros de las familias virales
DTXtPHQFLRQDGDV Otras estrategias de inhibición de citoquinas pueden involucrar un impedimento para su secreción como la proteína CrmA de
YDFFLQLDTXHPHGLDQWHVXDFWLYLGDGGHVHUSLQD PROpFXODLQKLELGRUD
GHVHULQDSURWHDVDV LQKLEHDODHQ]LPDFHOXODU,&( Interleukin-1
Converting Enzyme ORTXHLPSLGHODOLEHUDFLyQGH,/
(QPRGRPiVLQIUHFXHQWHFLHUWDVSURWHtQDVYLUDOHVSXHGHQXQLUVH
directamente a citoquinas, como ocurre con la proteína de envoltura
SUH6GHO+%9DOKDFHUORFRQOD,/
2.4. INFECCIÓN DE CÉLULAS DEL SISTEMA INMUNE O
(TABLA 8.11)
ACCIÓN SOBRE LAS MISMAS
8QDPX\H¿FD]HVWUDWHJLDYLUDOGHHYDVLyQDOVLVWHPDLQPXQHGHO
hospedador es la infección de los componentes celulares de dicho
sistema, como son los /7LB, macrófagos, células dendríticas, etc.
Esto puede en algunos casos producir la muerte de la célula infectada –con la consiguiente merma en la batería de células del sistema inmune– o simplemente ser utilizado como un vehículo para la
diseminación del virus por el organismo.
Mientras que para algunos virus estas células son el blanco
SULPDULRGHLQIHFFLyQ +,9 SDUDRWURV HBV, +&9HWF VRQXQ
reservorio de la misma. Esto último –en algunos casos– permite al
virus persistir en el organismo en forma latente, o inclusive alcanzar
VLWLRVUHVWULQJLGRVGHQWURGHOKRVSHGDGRU SRUHMHPSORHOSDVDMH
pasivo transendotelial del virus VDUDPSLyQDO61& (QHVWH~OWLPR
FDVRODFpOXODLQIHFWDGDDFWXDUtDFRPRHOFDEDOORGH7UR\DTXHSRUWD
en su interior a los viriones –enemigos del hospedador– que verían
favorecida su entrada al SNC al no ser detectados por el sistema
inmune. Ciertos virus como HIV, no sólo utilizan esta estrategia
SDUDDWUDYHVDUODEDUUHUDKHPDWRHQFHIiOLFDVLQRTXHWDPELpQSXHGHQ
Capítulo 8 / Evasión viral a la respuesta inmune del hospedador
Virus
Proteína viral
Efecto sobre la célula
CyV
,QKLEH-$.
+&9
Core y NS5
Impide la formación del factor ISGF-3
(VWLPXODODDFFLyQGHORVLQKLELGRUHVFHOXODUHVQDWXUDOHVGHODYtDGHODV-$.67$7 62&6Suppressor
of Cytokine Signalling 3)
+69
Desconocida
$GHQRYLUXV
E1A
,PSLGHODIRUPDFLyQGHOIDFWRU,6*)DOXQLUD67$7
e IRF-9
+39
E6
Impide la activación de TYK-2, y por ende la cascada
de las JAK/STAT
Vaccinia
%5\%5
6HFXHVWUDQ,)1Įȕ
'HQJXH
16%
Inactiva STAT-1
,QÀXHQ]D
NS1
,PSLGHODXQLyQGH,6*DSURWHtQDV\SRUHQGHOD
degradación de éstas por el proteasoma
RSV
Desconocida
,QKLEHODH[SUHVLyQGH67$7SURPRYLHQGRVXGHJUDdación en el proteasoma
3DUDLQÀXHQ]D
KXPDQR
V
,QKLEHODH[SUHVLyQGH67$7\SURPRYLHQGRVX
degradación en el proteasoma
Parotiditis
V
,QKLEHODH[SUHVLyQGH67$7\SURPRYLHQGRVX
degradación en el proteasoma
Sarampión
193
(VWLPXODODDFFLyQGHORVLQKLELGRUHVFHOXODUHVQDWXUDles de la vía de las JAK/STAT
Tabla 8.8. Interferencia viral sobre las cascadas de transducción de señales activadas por IFN.
con este mecanismo diseminarse por vía transplacentaria y lograr
DVtODLQIHFFLyQGHOIHWRHQODPXMHUHPEDUD]DGDLQIHFWDGDFRQGLFKR
agente.
Diversos miembros de las familias Herpesviridae HSV,
HCMV, EBV y ++9 Flaviviridae +&9 Retroviridae HIV
\+7/9 Papillomaviridae +39 \Poxviridae YLUXVYDFFLQLD han desarrollado estrategias para evadir la acción de las NK, las
TXHSXHGHQFODVL¿FDUVHHQFLQFRJUXSRVSULQFLSDOHVD VtQWHVLVGH
homólogos del &0+, +&09 E UHJXODFLyQGHODH[SUHVLyQGH
moléculas del &0+, +&09++9+,9 F interferencia en
la interacción entre el UHFHSWRUGHDFWLYDFLyQ\HOOLJDQGR +&09
++9+,9 G PRGXODFLyQGHORVQLYHOHVGHcitoquinas o quimioquinas relevantes para 1. +&09(%9++9+39 \H HIHFWRVYLUDOHVGLUHFWRV HIV, HSV y +&9 YpDVHOD7DEOD
Múltiples virus, tales como HCV, HSV, EBV, dengue o sarampión afectan la función de las células dendríticas, alterando su
maduración y/o su capacidad de estimular /7\GHSURGXFLU,)1Ȗ
De especial relevancia FOtQLFDHVODLQWHUDFFLyQGHFHSDVVDOYDMHV
del virus VDUDPSLyQ DLVODGDVGHFXOWLYRVGHOtQHDVOLQIRLGHV% con el UHFHSWRU6/$0 Signalling Lymphocyte Activation Molecule (VWDPROpFXODHVWiSUHVHQWHHQcélulas dendríticas, macrófagos y linfocitos activados y timocitos inmaduros. Si bien SLAM
UHJXODODSURGXFFLyQGH,/H,/SRUORV/7CD4+, así como
la de ,/71)Į\y[LGRQtWULFRSRUORVPDFUyIDJRVSURPXHYH
el estado de anergia principalmente a través de la supresión de la
producción de ,/PHGLDGDSRUHO7/5$VLPLVPRGLYHUVRV
YLUXV FRPRHCV o +&09 DIHFWDQODDFWLYLGDGGHODVNK, inhibiendo la producción de ,)1Ȗ\IDFLOLWDQGRHOYLUDMHKDFLDXQD
respuesta 7K(VWDDOWHUDFLyQFRQGLFLRQDHOGLiORJRPHGLDGRSRU
citoquinas con las células dendríticas, lo que a su vez restringe
la respuesta de los /7/DDIHFWDFLyQGHODUHVSXHVWDLQQDWDWHPpranamente, después de iniciada la infección, podría conferir al
+&9XQDYHQWDMDSDUDVXSURSDJDFLyQTXHOXHJRQRSXHGHVHU
controlada por la respuesta inmune adaptativa del hospedador.
En la infección por HIV, la respuesta 7KHVWiGLVPLQXLGDREVHUYiQGRVHXQSHU¿OSUHGRPLQDQWHGHODrespuesta 7K/DVcélulas
dendríticas pueden secuestrar partículas de HIV a través de la forPDFLyQGHFXHUSRVPXOWLYHVLFXODUHV QROLVRVRPDOHVTXHFRQWLHnen '&6,*1\ODVWHWUDVSDVPLQDV&'\&'HQDXVHQFLDGH
&0+,, TXHVRQHQGRFLWDGRV/DVSDUWtFXODVGHHIV permanecen
VHFXHVWUDGDVKDVWDTXHD ORVFRPSDUWLPLHQWRVVRQUHFLFODGRVKDFLDODVXSHU¿FLH\WUDQVPLWLGRVDRWUDFpOXODRELHQE SXHGHQVHU
degradados en el proteasoma. La interacción de HIV con células
dendríticas a través del receptor '&6,*1 FRPRORVUHFHSWRUHV
Toll, también un receptor de reconocimiento de patrones molecuODUHV SURPXHYHODLQKLELFLyQGHODVHxDOL]DFLyQGHO7/5DO
tiempo que se mantiene un estado inmaduro de dichas células, lo
TXHIDYRUHFHODHYDVLyQYLUDO$VLPLVPRODSURGXFFLyQGH0,3Į
y 5$17(6DWUDHD/7CD4+ de memoria permisivos –principal
blanco de la acción del HIV– al sitio donde se encuentran las
células dendríticas conteniendo las vesículas endocíticas con partículas de +,9ODVTXHOXHJRGHVXUHFLFODGRDODVXSHU¿FLHFHOXODU
pueden infectar /7CD4+ mediante una –así denominada– sinapsis
YLUDO WUDQVLQIHFFLyQ /DPHUPDHQODH[SUHVLyQGHJHQHVUHJXODdos por el sistema ,)1\GHRWUDVcitoquinas de la respuesta 7K
así como de las moléculas del &0+,,&'\JaggedMXQWRDO
DXPHQWRGHODH[SUHVLyQGH$7) SURWHtQDLQKLELGRUDGHO7/5 promueven una respuesta incapaz de limitar la infección por HIV.
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
194
IFN-Ȗ
IFN-Į /ȕ
IFNAR
IFN GR
(-)
Sarampión
IFN- Ȝ
Dengue
(-)
TYK-2
JAK-1
HPV JAK-2
Parotiditis
Parainfluenza
(-)
STAT-1
(-)
(-)
STAT-2
CRFII
(-)
(-)
STAT-4
STAT-1
STAT-5
STAT-3
STAT-5
(-)
(-)
Parotiditis
Parainfluenza
IRF-9
STAT-1
IRF-9
STAT-2
(-)
STAT-1
STAT-2
STAT-3
RSV
STAT-4
TYK-2
Dengue
RSV
(-)
JAK-1
JAK-2
JAK-1
Dengue
STAT-1
MAPKs
STAT-1
ISGF-3
GAF
Adenovirus
HCV
+1
ISRE
ISG
+1
GAS
ISG
)LJXUD9LUXVTXHLQWHU¿HUHQHQODVFDVFDGDVGHWUDQVGXFFLyQGHVHxDOHVDFWLYDGDVSRUORV,)1VGHtipo I, II y III.
0iVGHOGHORVQHRQDWRVTXHVHLQIHFWDQFRQHOHBV a parWLUGHXQDLQIHFFLyQPDWHUQDFRQHOPLVPRYLUXV \HQFX\DVDQJUH
también circula una proteína viral soluble denominada antígeno e
>+%[email protected] HYROXFLRQDQKDFLDODinfección persistente. Estudios realizados en animales transgénicos permitieron comprender las bases
moleculares de este fenómeno. El HBe Ag es capaz de alcanzar el
timo e inducir tolerancia inmunológica mediante deleción funcional
de OLQIRFLWRV7CD4++%H+%FHVSHFt¿FRVUHVWULQJLGRVSRUPROpculas de Clase II. Esa tolerancia se mantiene mientras persiste el
+%H$J7UDQVSRODGRDOVHUKXPDQRHOORLPSOLFDTXHVLHQODYLGD
intrauterina el +%H$JWUDVSDVDODSODFHQWDHOIHWRHVWDUiH[SXHVWR
DOWROHUyJHQR\GHVDUUROODUiXQDinfección persistente. Un efecto
DQiORJRVHREVHUYDVLODLQIHFFLyQFRQXQDSREODFLyQYLUDOGHHBV
productor de +%H$JHVFRQQDWDO DOPRPHQWRGHDWUDYHVDUHOFDQDO
GHSDUWR promovería la estimulación continua clonotípica sobre receptores
7TXHDVXYH]FRQGXFLUtDDODapoptosis de dichos linfocitos. En
IRUPDDQiORJDODSREODFLyQGH&7/SUHFXUVRUDSRGUtDH[KLELU
un desenlace apoptótico, dado que por necesidad se sintetizarían
PiVFpOXODVHIHFWRUDVTXHGHPHPRULD(Oagotamiento del sistePDLQPXQHIXHLQLFLDOPHQWHSRVWXODGRWDPELpQSDUDH[SOLFDUOD
PHUPDVLJQL¿FDWLYDGHODUHVSXHVWDFLWRWy[LFDTXHVHREVHUYDHQ
la infección con HIV.
El advenimiento de poderosas herramientas de Biología moOHFXODUSDUDODPHGLFLyQGHODVDFWLYLGDGHVGHORV&7/VSHUPLWLy
adquirir una nueva visión de este fenómeno de deleción/alteración
GHGLFKDSREODFLyQFHOXODU6HDFHSWDHQODDFWXDOLGDGTXHORV&7/V
pueden estar agotados como resultado de infecciones tales como las
producidas por HIV y HCV en el humano. En dichas infecciones
FUyQLFDVVHKDREVHUYDGRTXHHODJRWDPLHQWRGHORV&7/VHVWiLQGXFLGRSRUODVREUHH[SUHVLyQGHODPROpFXOD3' Programmed
Death HQODVXSHU¿FLHGHGLFKRVlinfocitos. Este receptor inmune
2.4.1 Agotamiento del sistema inmune
(QHOJUXSRGH5ROI0=LQNHUQDJHO SUHPLR1REHOHQ0H- actúa como regulador negativo de los OLQIRFLWRV7DFWLYDGRVHLQGLFLQDR)LVLRORJtDHQ GH¿QLyFRPRWDODODDXVHQFLDSUL- teractúa alternativamente con los ligandos 3'/y3'/ H[maria o secundaria de respuesta de &7/HQODLQIHFFLyQPXULQD SUHVDGRVHQFpOXODVSUHVHQWDGRUDV /DLQWHUDFFLyQHQWUH3'\
persistente con LCM. Se postuló que este fenómeno era debido a 3'/SURPXHYHHOUHFOXWDPLHQWRGHODWLURVLQDIRVIDWDVD6+3TXH
XQDSDUiOLVLVLQPXQHDVRFLDGDDODPDVLYDLQIHFFLyQYLUDOODTXH GHIRVIRULODIDFWRUHVGHSHQGLHQWHVGHO7&5FRPR6LN=$3\
Capítulo 8 / Evasión viral a la respuesta inmune del hospedador
Virus
+,9
+&9
Proteína viral
Tat
TAR RNA (RNAp)
Desconocida
NS5A
E2
IRES
NS1
,QÀXHQ]D
5RWDYLUXV
+69
Efecto sobre la célula
Inactiva a la 3.5DODFWXDUFRPRSVHXGRVXVWUDWR
Impide la activación de la PKR al competir con el
RNAdc
,QGXFHODVtQWHVLVGHXQLQKLELGRUFHOXODUQDWXUDOGHOD
RNAsa L (RLI)
Inactiva a la PKR
Inactiva a la 3.5DODFWXDUFRPRSVHXGRVXVWUDWR
Impide la activación de la PKR al competir con el
RNAdc
6HFXHVWUDDO51$GFLQWUDFHOXODUHLQKLEHDODPKR
Desconocida
(VWLPXOD D XQ LQKLELGRU FHOXODU QDWXUDO GH OD PKR
(p58IPK)
NSP3
6HFXHVWUDDO51$GFLQWUDFHOXODUHLQKLEHDODPKR
Ȗ
Desconocida
US11
195
'HIRVIRULODDOH,)ĮHLQDFWLYDPKR
,QGXFH OD VtQWHVLV GH DQiORJRV GH ¶¶2$ TXH VH
XQHQDOD51$VD/\ODLQDFWLYDQ
6HFXHVWUDDO51$GFLQWUDFHOXODUHLQKLEHDODPKR y la
VtQWHVLVGH¶¶2$VLQWHWDVD
(%9
(%(551$
(RNAp)
Impide la activación de la PKR al competir con el
RNAdc
$GHQRYLUXV
VAI RNA (RNAp)
Impide la activación de la PKR al competir con el
RNAdc
++9
vIRF-2
Inactiva la PKR
Vaccinia
E3L
K3L
6HFXHVWUDDO51$GFLQWUDFHOXODUHLQKLEHDODPKR
Inactiva a la 3.5DODFWXDUFRPRSVHXGRVXVWUDWR
Tabla 8.9. Interferencia viral sobre proteínas efectoras del sistema IFN. 51$S0ROpFXODVSHTXHxDVGH51$,5(6 Internal Ribosome
Entry Site 6LWLRLQWHUQRGHHQWUDGDDOULERVRPD 3,.HLPSLGHODDFWLYDFLyQGHORVOLQIRFLWRV7(OORGHYLHQHHQXQD
DIHFWDFLyQIXQFLRQDO DJRWDPLHQWR GHGLFKDSREODFLyQ )LJXUD 3'HVWiH[SUHVDGRHQSREODFLRQHVDFWLYDGDVWDOHVFRPRlinIRFLWRV7 CD4+ y &'+ %\FpOXODVPLHORLGHVPLHQWUDVTXHHO
OLJDQGR3'/ORHVWiHQcélulas dendríticas, macrófagos, linfocitos
%\FpOXODVSDUHQTXLPiWLFDVQROLQIRLGHVDODYH]TXH3'/VH
H[SUHVDHQPDFUyIDJRVDFWLYDGRV\células dendríticas.
(OQLYHOGHH[SRVLFLyQDDQWtJHQRVGHHIV condiciona la funcionalidad de los OLQIRFLWRV7&'+REVHUYiQGRVHTXHHVPiVOLmitada en pacientes que progresan al 6,'$ DOWDFDUJDYLUDO TXH
en no progresores. En el primer grupo se ha observado una sobreH[SUHVLyQGH3'DVRFLDGDDXQGp¿FLWGHSURGXFFLyQGHgranzima
B y de ,)1Ȗ
Sorpresivamente, otros estudios recientes han documentado que
HQUDWRQHVLQIHFWDGRVH[SHULPHQWDOPHQWHFRQLCM y en el limitado número de pacientes infectados con HIV analizado se produce
XQDGLFRWRPtDHQWUHODUHVSXHVWDHMHUFLGDSRUORV&7/VPHGLDQWHHO
LPSDFWROHWDO GHJUDQXODFLyQ\FLWRWR[LFLGDG \ODSURGXFFLyQGH
citoquinas. Se ha observado que en pacientes infectados persistentemente con HIV la respuesta de degranulación y FLWRWR[LFLGDGGH
ORV&7/VVHPDQWLHQHFRQVHUYDGDHQFRQWUDSRVLFLyQFRQODPHUPD
en la producción de ,)1Ȗ\71)Į'DGRTXHORVHYHQWRVGHcito-
WR[LFLGDGVRQGHSHQGLHQWHVGHOLQÀXMRGH&D++GLVSDUDGRSRUHO7&5
pero son independientes de la calcineurina, mientras que la liberación de citoquinas tales como las mencionadas es dependiente de
esta última vía, se ha postulado un silenciamiento selectivo de ella,
PHGLDGRSRUXQDIDOWDGHWUDQVORFDFLyQHVSHFt¿FDGHOIDFWRU1)$7
GHVGHHOFLWRSODVPDDOQ~FOHR'HORH[SXHVWRVHLQ¿HUHTXHHQODV
LQIHFFLRQHVSHUVLVWHQWHVDQDOL]DGDV LCM en el ratón, y al menos
en algunos pacientes infectados con +,9 HODJRWDPLHQWRLQPXQH
es funcionalmente selectivo.
Pacientes infectados crónicamente con +&9H[KLEHQVREUH
H[SUHVLyQGH3'HQlinfocitos &'+LQWUDKHSiWLFRVDVRFLDGDD
la ausencia del marcador de OLQIRFLWRVGHPHPRULD&'ORTXH
GH¿QHWDPELpQHOHVWDGRGHDJRWDPLHQWRGHORV&7/V
2.4.2 Actividad de superantígenos
8QVXSHUDQWtJHQR 6$J HVXQDPROpFXODFDSD]GHHVWLPXODUHQpUJLcamente a OLQIRFLWRV7R%HQXQPRGRQRFRQYHQFLRQDO/RV6$JV
para los OLQIRFLWRV7QRUHTXLHUHQVHUSUHYLDPHQWHSURFHVDGRV\DTXH
interactúan con porciones laterales de la molécula del CMH y del
UHFHSWRU7 SRUFLyQYDULDEOHGHODFDGHQDȕGHO7&5 (QPRGRDQilogo, los SAgs para linfocitos B se unen a Igs normales no inmunes
independientemente del isotipo de cadena liviana, a través del contac-
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
196
IF1
IF1 5
JA. 7Y. JA. PK5
2´5´OAS
Influenza
(+)
IP. 5NAdF9IRA/ 2´5´OAS
Activación de 2´ - 5´OAS
HIV (+)
R/, (-)
HSV (-)
(-)
(-)
PK5
HIV HCV Influenza Rotavirus
HSV EBV Adenovirus
HCV
HHV-8
Activación de PKR
RNAsa/ Activación de RNAsaL HSV
eIF2Į
eIFĮactivR
eIF2Į
(-)
Fosforilaciónde eIF2
Į DegradacióndeRNAsviraleVycelulareV
INHIBICIÓNDE/$75$16&5,3&,Ï1
<5(3/,&$&,Ï1'(*(120$69,5$/(6
INHIBIC,ÓNDE/A7RADUCCIÓ1
Figura 8.7. Virus que actúan inhibiendo las principales moléculas efectoras antivirales inducidas por Interferones: 2’ -5’ OAS y
PKR. 5/,,QKLELGRUGHOD51$VD/,3.,QKLELGRUGH3.5
Capítulo 8 / Evasión viral a la respuesta inmune del hospedador
197
‡3URWHtQDYLUDOVtPLOFLWRTXLQDV
EBV %&5) \HCMV FPY,/ VtPLO,/LQKLEHODH[SUHVLyQGH&0+,\,,OD
SURPRFLyQGHXQDUHVSXHVWD7K\ODSUROLIHUDFLyQGHPRQRFLWRV
‡3URWHtQDYLUDOVtPLOUHFHSWRUHVSDUDcitoquinas
HCMV (US27, US28, UL33 y UL78)
HHV-6 (U12 y U51) y HHV-7 (U12): receptores símil-CCR
HHV-8: 25)UHFHSWRUVtPLO&;&5
Vaccinia: véase aparte evasión al sistema IFN
‡,QKLELFLyQGHODVtQWHVLVGHcitoquinas
Vaccinia: CrmA (símil-serpina LQKLEHDODHQ]LPDFHOXODU,&(HLPSLGHODVHFUHFLyQGH,/
‡8QLyQDcitoquinas
HBV:SUH6VHXQHD,/HLQKLEHVXDFFLyQ
7DEOD$OJXQRVHMHPSORVGHPRGL¿FDFLyQGHODDFWLYLGDGPHGLDGDSRURWUDVcitoquinas.
‡,QIHFFLyQGHLT o LB
HIV, HBV, HCV, sarampión, adenovirus, etc.
‡,QIHFFLyQGHcélulas dendríticas y macrófagos
HIV, HBV, HCV, sarampión, etc.:GHVWUXFFLyQDIHFWDFLyQGHFpOXODVSUHVHQWDGRUDVGHDQWtJHQR
‡,QIHFFLyQGHFpOXODVWtPLFDV
LCM:LQGXFFLyQGHWROHUDQFLD
HBV:+%H$JGHOHFLyQFORQDOGHLT
‡$FWLYDFLyQGHlinfocitos T mediante superantígenos
HIV
‡,QGXFFLyQGHDJRWDPLHQWRLQPXQH
LCM, HIV, HCV
‡,QGXFFLyQGHapoptosis de LT
HIV, HSV, etc.
Tabla 8.11. Algunos ejemplos de infección de y/o acción sobre células del sistema inmune.
WRFRQODFDGHQDSHVDGDTXHH[SUHVDXQSURGXFWRGHWHUPLQDGRGHOD
IDPLOLDGHOJHQ9+LUUHVSHFWLYDPHQWHGHORVIUDJPHQWRVFRGL¿FDGRV
por los genes DH y JH e inducen in vitro una señal de activación y
diferenciación con secreción de Igs. Este modo de acción contrasta
con la necesidad del contacto del antígeno con la estructura terciaria
de las cadenas pesada y liviana de las Igs generadas en la respuesta
inmune humoral.
(OYLUXVGHOWXPRUPDPDULRPXULQR 0079 FRQVWLWX\HHO
PHMRUHMHPSORFRQRFLGRGRQGHDWUDYpVGHODH[SUHVLyQGHXQD
glicoproteína de membrana se produce la unión a la porción variable de la cadena beta del UHFHSWRU7DFWLYDQGRHVWDFpOXODH
LQGXFLHQGRVXSUROLIHUDFLyQ(VWHHIHFWRDVXYH]EHQH¿FLDDO
virus que replica en los LB, ya que la colaboración de los /7
CD4+SURPXHYHVXSUROLIHUDFLyQ\SRUHQGHDXPHQWDODH¿FLHQFLD
GHODSURSDJDFLyQYLUDO'DGRTXHVyORH[LVWHODSRVLELOLGDGGH
VLQWHWL]DUVHXQDVSRUFLRQHVYDULDEOHVGHODFDGHQDEHWDPXULQD
ello implica que la interacción con el superantígeno lleva a la
DFWLYDFLyQGHDOPHQRVXQ \DYHFHVKDVWDXQ GHORV
/7PXULQRV
Después de la transmisión viral a través de la leche, los LB
del intestino son infectados, y presentan el SAg a los /7ORVTXH
se activan y a su vez estimulan a los linfocitos vecinos. Durante la
pubertad y la preñez, las células epiteliales mamarias proliferan
y la transmisión ocurre a través de los linfocitos que migran a la
JOiQGXODKRPyQLPD(QRWURVWpUPLQRVHO0079XWLOL]DHOVLVWHPD
LQPXQHSDUDHVWDEOHFHUODLQIHFFLyQ\VLPXOWiQHDPHQWHHYLWDUOD
respuesta inmune del hospedador.
+,9SRVHHXQDJOLFRSURWHtQDGHHQYROWXUDGHQRPLQDGDJS
'LFKDSURWHtQDH[KLEHcaracterísticas de SAg para OLQIRFLWRV7\%
Se ha demostrado que la misma es capaz de activar /7DWUDYpVGHOD
interacción con la molécula CD4 y a los /%TXHH[SUHVHQSURGXFWRV
GHULYDGRVGHOJHQ9++.
6HKDSRVWXODGRTXHODSURWHtQDJSSRGUtDSURPRYHUHOGLVSDro apoptótico de OLQIRFLWRV7SUHYLDPHQWHDFWLYDGRV SHURQRLQIHFtados con +,9 PHGLDQWHODSURPRFLyQGHOHQWUHFUX]DPLHQWRGHOD
molécula CD4. Luego de este evento se observa una disminución de
la proteína anti-apoptótica %FO\ODDFWLYDFLyQGHODFDVSDVD7DPELpQJSSXHGHSURPRYHUODPXHUWHFHOXODUWHPSUDQDQRDSRSWyWLFD
a través de la interacción con CD4 y CXCR4 por una vía indepen-
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
198
Mecanismo
Virus
Proteína
Acción sobre las NK
Síntesis de homólogos del CMH-I
+&09
UL18
,QKLEHODcitotoxicidad de
VXESREODFLRQHVGHNK
Regulación de la expresión de
moléculas del CMH-I
Degradación citosólica de &0+,H[FHSWR
+/$&+/$(RDPEDV
+&09
US2, 11
3UREDEOHPHQWHLQKLEHVX
IXQFLRQDOLGDG
'HJUDGDFLyQRUHWHQFLyQLQWUDFHOXODU
GHPROpFXODVGHO&0+,SHURQRGHO
KRPyORJRYLUDO8/
+&09
US2, 3,
6, 11
,QKLEHODcitotoxicidad de
VXESREODFLRQHVGHNK
$XPHQWRGHODH[SUHVLyQGH+/$(
+&09
UL40
,QKLEHODcitotoxicidad
(QGRFLWRVLVGHPROpFXODVGHO&0+,
H[FHSWR+/$&\+/$(
+,9
Nef
3UREDEOHPHQWHLQKLEHOD
citotoxicidad
(QGRFLWRVLVGH+/$$\+/$%SHURQRGH
+/$(
++9
K5
3UREDEOHPHQWHLQKLEHOD
citotoxicidad
Interferencia con la interacción entre
receptores de activación y su ligando
'LVPLQXFLyQGHODH[SUHVLyQGH/)$
(ligando para CD2 en las NK)
+&09
?
3UREDEOHPHQWHLQKLEHOD
citotoxicidad
%ORTXHRGHODLQWHUDFFLyQHQWUHHOreceptor
+&09
1.*''$3\8/%3 SURWHtQDGHXQLyQ
a UL16)
UL16
,QKLEHODcitotoxicidad y
ODSURGXFFLyQGH,)1Ȗ
8ELTXLWLQDFLyQ\H[SUHVLyQGLVPLQXLGDHQOD ++9
VXSHU¿FLHFHOXODUGHICAM-1 y CD86
K5
,QKLEHODcitotoxicidad
6LDOLODFLyQGHUHFHSWRUHVFHOXODUHVHQ
FpOXODVLQIHFWDGDV
+,9\
+7/9
?
,QKLEHODcitotoxicidad
,QKLELFLyQGHOLQJUHVRGH&D++ mediado por
/)$DWUDYpVGHOEORTXHRGHOFDQDOGH
Ca++ tipo L
Modulación de los niveles de citoquinas
o quimioquinas
3URGXFFLyQGHDJRQLVWDVYLUDOHV,/VtPLO
+,9
Tat
,QKLEHODcitotoxicidad y la
SURGXFFLyQGHFLWRTXLQDV
(%9\
+&09
%&5)
cmvIL-10
Efecto probablemente
similar a IL-10
3URGXFFLyQGHDQWDJRQLVWDVGHODV
TXLPLRTXLQDV&&5 Y0,3, \0,3Į
0,3ȕ\RANTES (vMIP II)
++9
v-MIP I y
v-MIP II
3UREDEOHPHQWHLQKLEHQHO
WUi¿FRGHODVNK
,QKLELFLyQGH,/\GHOUHFHSWRU,/5Į
+39
E6 y E7
,QKLEHQODSURGXFFLyQGH
,)1Ȗ
Efecto viral directo
Infección de las NK
+,9
?
5HGXFHODYLDELOLGDGGH
las NK
Unión al receptor CD81
+&9
E2
,QKLEHODcitotoxicidad y
ODSURGXFFLyQGH,)1Ȗ
Infección de las NK
+69
?
,QKLEHODcitotoxicidad
Tabla 8.12. Mecanismos virales de inhibición de la actividad de las células NK.
Capítulo 8 / Evasión viral a la respuesta inmune del hospedador
199
Célula dendrítica
PD-L1 / L2
CMH-I
Antígeno viral
Receptor de LT
CD8
PD-1
Linfocito T
Inhibe la activaci ón
Figura 8.8. Agotamiento de los linfocitos T citotóxicos CD8+ mediado por la interacción de la proteína de muerte (Programmed
Death) 1 y sus ligandos PDL-1 ó 2. (OUHFOXWDPLHQWRGHODWLURVLQDIRVIDWDVD6+3SRUPD-1 defosforila diversos factores dependientes
del receptor de OLQIRFLWRV7LPSLGLHQGRVXDFWLYDFLyQ
GLHQWHGHODVKDELWXDOPHQWHLQYROXFUDGDV SLCK, señalización acoplada a proteínas G, o mediada por )DVRUHFHSWRUHVSDUD71) (VWRV
mecanismos son de singular relevancia ya que son independientes de
la infección de linfocitos por HIV, no requieren la presencia de virus
LQIHFFLRVR\SXHGHQVHUWDPELpQSURPRYLGRVSRULQPXQRFRPSOHMRV
HQORVTXHJSHVWiSUHVHQWH
La inducción de la apoptosis de células del sistema inmune
forma parte de los efectos promovidos por algunos virus. Dada
su relevancia y teniendo en cuenta que la regulación de eventos
apoptóticos también ocurre en otras células, este evento se analiza
separadamente a continuación.
2.5. REGULACIÓN DE LA APOPTOSIS
La DSRSWRVLVSXHGHVHULQGXFLGDDWUDYpVGHODYtDH[WUtQVHFDRLQtrínseca. Mientras que en el primer caso la muerte celular prograPDGDVHSURGXFHFRPRFRQVHFXHQFLDGHXQHVWtPXORH[WUDFHOXODU
que es detectado por algún tipo de receptor en la membrana citoSODVPiWLFDHQHOVHJXQGRODapoptosis es disparada por una señal
proveniente de la mitocondria.
$FRQWLQXDFLyQVHPHQFLRQDUiQDOJXQRVHMHPSORVHQORVTXHGLYHUVRVYLUXVHVWiQDVRFLDGRVDHYHQWRVGHLQKLELFLyQRGHSURPRFLyQ
de la DSRSWRVLV ¿JXUD 0iVD~QXQDPLVPDSURWHtQDYLUDOSXHGHH[KLELUHIHFWRVRSXHVWRVHQODUHJXODFLyQDSRSWyWLFDGHSHQGLHQGR
de su concentración o de la estirpe celular sobre la que actúe.
Las infecciones virales producen habitualmente activación de
los OLQIRFLWRV7FLWRWy[LFRVTXHHMHUFHQGLIHUHQWHVPHFDQLVPRVGH
acción antiviral, uno de los cuales es la inducción de la apoptosis en
la célula infectada. Es por ello que ciertos virus producen la inhibición de esta muerte celular programada –por diferentes vías– para
seguir manteniendo viva a la célula que parasitan y así terminar
su ciclo de replicación y generar progenie o –en otros casos– para
persistir sin ser eliminados por el sistema inmune del hospedador.
3DUDHOORORVYLUXVGHVDUUROODQXQDRPiVGHODVHVWUDWHJLDVTXHVH
GHWDOODQHQOD7DEOD
(OPHFDQLVPRPiVJHQHUDOHVODLQKLELFLyQGHODYtDH[WUtQVHFD
de activación de la apoptosis. En este sentido algunos virus impiden
la correcta actividad de las FDVSDVDV FLVWHtQSURWHDVDVTXHUHFRQRFHQUHVLGXRVGHiFLGRDVSiUWLFR ODVTXHDODFWLYDUVHLQGXFHQXQD
cascada de transducción de señales que culmina con la activación
GHORVSURFHVRVDSRSWyWLFRV(MHPSORVGHHVWRVRQODSURWHtQD(E
de DGHQRYLUXVTXHLQKLEHDODFDVSDVD\ODSURWHtQDFUP$GHYDFFLQLD QRLQFOXLGDHQOD)LJXUD ODTXHQRVyORLQKLEHDODFDVSDVDDQWHVPHQFLRQDGDVLQRTXHWDPELpQHMHUFHVXHIHFWRUHJXODGRU
QHJDWLYRVREUHODDFFLyQGHODFDVSDVD
Otro virus que produce inhibición de la apoptosis –pero en este
caso de la vía intrínseca– es el (%9DWUDYpVGHVXSURWHtQD%+5)
FRGL¿FDGDSRUHOJHQKRPyQLPR TXHWLHQHXQGRPLQLRKRPyORJR
a la proteína anti-apoptótica celular %FO
La proteína core del +&9VHXQHDOGRPLQLRLQWUDFLWRSODVPiWLFR±GHQRPLQDGR'('>Death Effector [email protected]±GHOreceptor para
71) 71)5 LPSLGLHQGRODLQWHUDFFLyQGHpVWHFRQODVSURWHtQDV
75$''R75$))ODVTXH±DVXYH]±DFWLYDQXQDYtDGHWUDQVducción de señales que desencadena la apoptosis. De esta manera,
la proteína viral inhibe la DSRSWRVLVLQGXFLGDSRU71)HQFLHUWDV
estirpes celulares.
Varias proteínas virales tienen la capacidad de desregular el
ciclo celular al interactuar con diferentes proteínas de la célula hosSHGDGRUD(QWDOVHQWLGRODVSURWHtQDV(\(GHOHPV interactúan
FRQS\S5%UHVSHFWLYDPHQWH/DSULPHUDVHXQHDODSURWHtQD
celular AP adquiriendo actividad ubiquitina-ligasa. La ubiquitinaFLyQGHSLQYROXFUDGLIHUHQWHVHQ]LPDVFHOXODUHV\WHUPLQDFRQHO
UHFRQRFLPLHQWRGHDTXpOODSRUHOFRPSOHMR($3HOTXHOXHJRVH
auto-ubiquitina para ser degradado en el proteasoma. Por otra parte,
pRB actúa durante el ciclo celular como un regulador negativo,
uniéndose su forma no fosforilada al factor de transcripción celular
()(QODIDVH6S5%HVIRVIRULODGDSRUTXLQDVDVGHSHQGLHQWHV
GHFLFOLQDV FGN OLEHUDQGRDOPHQFLRQDGRIDFWRUWUDQVFULSFLRQDO
Mediante el secuestro y la degradación de pRB, E7 lleva a la activación de los factores transcripcionales involucrados en la síntesis
del DNA y en la progresión de la fase S del ciclo celular.
200
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
Inhibición de la apoptosis
‡,QKLELFLyQGHODYtDGHODVcaspasas
Adenovirus:(ELQKLEHODFDVSDVD
Vaccinia:&UP$LQKLEHODVcaspasas 1 y 8
‡'RPLQLRBcl-2 homólogo
EBV: %+5)
‡,QWHUDFFLyQFRQGRPLQLRV'('
HCV: coreVHXQHDOGRPLQLR'('GHO71)5HLQKLEHODLQWHUDFFLyQGHpVWHFRQTRADD o
TRAF
‡'HVUHJXODFLyQGHOFLFORFHOXODU
HPV:(VHXQHDS\ODGLUHFFLRQDDOSURWHDVRPD(VHFXHVWUD\GHJUDGDDS5%
Ambos eventos favorecen la progresión del ciclo y la WUDQVIRUPDFLyQFHOXODU
HBV: ;SURPXHYHHOUiSLGRSDVDMHSRUORVSXQWRVGHFKHTXHR
‡$OWHUDFLyQGHOVLVWHPDIFN o de sus moléculas regulatorias
Véase la Tabla 9
Inducción de la apoptosis*
‡
HIV: YpDVHOD7DEOD
‡
$OWHUDFLyQGHODDFWLYLGDGPLWRFRQGULDO
,QÀXHQ]D 3%)LQGXFHODapoptosis de monocitos
Tabla 8.13. Algunos ejemplos de mecanismos de regulación de la apoptosis por parte de los virus. 1RVHLQFOX\HQHQHVWD7DEOD
RWURVPHFDQLVPRVLQGXFWRUHVGHODDSRSWRVLVWDOHVFRPRSRUHMHPSORD ODSRWHQFLDFLyQGHSE ODGHVUHJXODFLyQWUDQVFULSFLRQDORF OD
VREUHFDUJDGHOUHWtFXORHQGRSOiVPLFRFRQSURWHtQDVYLUDOHVGDGRTXHORVPLVPRVRFXUUHQHQHYHQWRVRFpOXODVQRYLQFXODGRVGLUHFWDPHQWH
FRQODHYDVLyQDODUHVSXHVWDLQPXQH9pDQVHORV&DStWXORV\
8QHMHPSORPX\HVSHFLDOGHregulación de la apoptosis es el
HMHUFLGRSRU+,9 7DEOD 'LFKDUHJXODFLyQSXHGHVHUDQDOL]Dda separadamente en células infectadas y en no infectadas, a la vez
que la muerte de estas últimas puede producirse por mecanismos
directos o indirectos. Dado que estimaciones previas documentaron
TXHVyORXQDSURSRUFLyQGHHQDHQGHORVlinfocitos
7CD4+ de sangre periférica se encuentra infectada en pacientes con
HIV, la disminución de esta población viral parecería no poderse
MXVWL¿FDUPHUDPHQWHSRUVXLQIHFFLyQ
La infección de /7CD4+ puede promover una alteración de
la viabilidad celular por mecanismos apoptóticos y no apoptóticos
SRUHMHPSORPHGLDQWHODIRUPDFLyQGHVLQFLFLRVGHFpOXODVJLJDQtes, o por aumento de la permeabilidad de la membrana celular
asociada a la brotación de partículas virales o al efecto de la proteíQDYLUDO9SX $VLPLVPRODDFXPXODFLyQWy[LFDGH'1$YLUDOQR
integrado, así como la actividad de proteasa viral que cliva inactivando la proteína anti-apoptótica %FO\DFWLYDQGRODSURFDVSDVD
WRUQDDODVFpOXODVPiVVHQVLEOHVDODGLVIXQFLyQPLWRFRQGULDODQWH
HVWtPXORVLQWHUQRVRH[WHUQRV
Por otra parte, los /7CD4+ y &'+VRQPiVSURSHQVRVDOD
DSRSWRVLVGDGRTXHH[SUHVDQHQVXSHU¿FLHXQDPD\RUFRQFHQWUDFLyQ
de )DVODTXHDXPHQWDFRQODSURJUHVLyQGHODHQIHUPHGDG/DVSURWHtQDVJS7DW\1HIDXPHQWDQORVQLYHOHVGH)DV\)DV/FRQWULEX\HQGRDOHYHQWRDSRSWyWLFR0iVD~Q7DWDFWLYDODSURFDVSDVD
\FRQMXQWDPHQWHFRQODSURWHDVDYLUDOLQKLEHDODSURWHtQDFHOXODU
anti-apoptótica %FO(VWHHIHFWRVHSRWHQFLDDOHVWLPXODUORVQLYHles de los miembros pro-apoptóticos de la familia homónima, %D[\
Bim. Este efecto global es aumentado parcialmente por la proteína
viral Vpu, la que mediante la inhibición del factor de transcripción
celular 1)ț%LPSLGHODVtQWHVLVGHRWUDSURWHtQDFHOXODUDQWLDSRStótica como es Bcl-XL. La proteína viral Vpr promueve un efecto
citoprotector al comienzo de la infección en la que se encuentra
FRQXQEDMRQLYHOGHH[SUHVLyQSDUDOXHJRFRODERUDUHQHWDSDVPiV
tardías en el disparo apoptótico, mediante la interacción con la proWHtQD$17 Adenine Nucleotide Translocator TXHSURPXHYHXQ
incremento en la permeabilidad de la membrana mitocondrial, liberando el citocromo C, y otras proteínas pro-apoptóticas, al tiempo
TXHLQFUHPHQWDODWUDQVFULSFLyQGHOJHQTXHFRGL¿FDODFDVSDVD
Al menos tres proteínas de +,9 1HI9SX\JS LQKLEHQOD
H[SUHVLyQHQVXSHU¿FLHGHODPROpFXOD&'HYLWDQGRDVtODVREUH
infección y la promoción de la apoptosis a través de su interacción
FRQJS/DLQKLELFLyQGHODH[SUHVLyQGHFLHUWDVPROpFXODVGHO
&0+,FOiVLFDV +/$$\% \ODH[SUHVLyQGHPROpFXODVQRFOiVLFDVFRPR+/$( SUHVHQWDQSpSWLGRVFRUUHVSRQGLHQWHVDODVHFXHQFLDOtGHUGH+/$$%&R* LQWHQWDHYLWDUHOUHFRQRFLPLHQWR
por /7&'+ y 1.UHVSHFWLYDPHQWH(QFRQMXQWRVHREVHUYDXQD
estrategia magistral del HIV, retardando o impidiendo la apoptosis
de la célula que lo alberga, y promoviéndola en células que pueden
UHFRQRFHUDGLFKDFpOXODFRPRLQIHFWDGD /7&'+ PHGLDQWHOD
interacción )DV)DV/$SHVDUGHWRGRODVREUHYLGDGHODVFpOXODV
CD4+ infectadas con +,9HVWiGLVPLQXLGDSRUORTXHVXLQIHFFLyQ
contribuye a la merma global de los CD4+DGHPiVGHODTXHHV
atribuible a la muerte apoptótica de las células no infectadas.
La muerte de células no infectadas por HIV puede ocurrir por
liberación de proteínas virales desde una célula infectada vecina, o
por la inducción de su activación.
Entre las proteínas de HIV que pueden promover la muerte de
/7YHFLQRVPHUHFHQLQGLFDUVHDJS7DW1HI\9SX/DSURWHtQD
GHHQYROWXUDJSVROXEOHRXQLGDDPHPEUDQDSXHGHSURPRYHU
la apoptosis por mecanismos )DVGHSHQGLHQWHV VREUHH[SUHVLyQGH
)DV)DV/LQKLELFLyQGHODSURWHtQDFHOXODUF)/,3>FLICE Inhibitory [email protected]>WDPELpQGHQRPLQDGD
201
Capítulo 8 / Evasión viral a la respuesta inmune del hospedador
HIV
Influenza
(-)
DRL
(+) (-)
(-)
Adenovirus
HIV
mitocondria
PI3K/
Akt
HCV
(+)
Bcl-2 / Bcl-XL
HIV
(+)
DR
EBV
(-)
(+)
(-)
HIV
Bid -t
Bax / Bak
Casp-8
Citocromo C
DIABLO
AIP
Apaf - 1
Casp - 9
Casp-3-6-7
NÚCLEO
Apoptosis
CITOPLASMA
HPV
(-)
HPV
pRB
p53
(-)
Regulación del ciclo celular
(detención / apoptosis)
Figura 8.9. Efectos de la acción viral sobre las vías regulatorias de la apoptosis. /DPLVPDSXHGHRFXUULUFRPRUHVXOWDGRGHOHVWtPXOR
GHGRVYtDVH[WUtQVHFDHLQWUtQVHFD/DYtDH[WUtQVHFDHVGLVSDUDGDDWUDYpVGHODLQWHUDFFLyQHQWUHGLYHUVRV'5 Death Receptor o receptor
GHPXHUWHWDOHVFRPRFas, o el receptor para TNF (TNFR) o TRAIL (TNF Receptor Apoptosis Inducing Ligand FRQVXVOLJDQGRV'/ Death
LigandROLJDQGRSDUDUHFHSWRUHVGHPXHUWH HVSHFt¿FRV/DDFWLYLGDGGHGLFKRVUHFHSWRUHVVHDVRFLDDODDFWLYDFLyQGHODFDVSDVD &DVS LQLFLDGRUD\FXOPLQDFRQODGHODVHIHFWRUDV\/DOLEHUDFLyQGH$,3 Apoptosis Inducing ProteinRSURWHtQDLQGXFWRUDGHapoptosis),
',$%/2 Direct IAP Binding protein with Low pI>SURWHtQDGHEDMRSXQWRLVRHOpFWULFRFRQXQLyQGLUHFWDDODV,[email protected]$&
(Second Mitochondria-derived Activator of Caspase [email protected] \HOcitocromo C desde
la PLWRFRQGULDSURPXHYH±DWUDYpVGH$SDI\ODFDVSDVD±HOGLVSDURGHODYtDDSRSWyWLFDLQWUtQVHFD
$SDI$SRSWRVLV3URWHDVH$FWLYDWLQJ)DFWRU )DFWRUDFWLYDGRUGHSURWHDVDDSRSWyWLFD La caspasa 8 cliva %LGSURGXFLHQGRXQDSURWHtQDWUXQFDGDFRQDFWLYLGDGSURDSRSWyWLFD %LGW TXHSURPXHYHODVDFFLRQHVKRPyQLPDVGH
%D[%DNHQODPLWRFRQGULD
3,.$NWYtDDQWLDSRSWyWLFDPHGLDGDSRUPhosphatidyl Inositol 3 Kinase )RVIDWLGLO,QRVLWROTXLQDVD \$NW WDPELpQGHQRPLQDGD3URWHLQ
TXLQDVD% S5% SURWHtQDGHOUHWLQREODVWRPD \SUHJXODQHOFLFORFHOXODUSURPRYLHQGRODGHWHQFLyQGHOPLVPRRLQGXFLHQGRODapoptosis, respectiYDPHQWH
2EVpUYHVHTXHLQÀXHQ]DLQKLEHODDSRSWRVLVHQFpOXODVHSLWHOLDOHVDWUDYpVGHODYtD3,.$NWDOWLHPSRTXHSXHGHSURPRYHUODHQFpOXODV
PRQRFtWLFDVLQKLELHQGRODDGHFXDGDIXQFLyQPLWRFRQGULDO
)/,&(@ R)DVLQGHSHQGLHQWHV DXPHQWRGH%D[\GLVPLQXFLyQGH
%FO DWUDYpVGHVXXQLyQDPROpFXODV&'&&5\CXCR4. La
SURWHtQD7DWDOVHUHQGRFLWDGDSXHGHSURPRYHUODapoptosis meGLDQWHVREUHH[SUHVLyQGHODFDVSDVDWDOFRPRVHREVHUYDHQ/7
CD4+ y en neuronas. Asimismo, promueve la apoptosis de /7CD4+
QRLQIHFWDGRVDODXPHQWDUODH[SUHVLyQGHODPROpFXOD75$,/ TNF
Receptor Apoptosis Inducing Ligand HQODVXSHU¿FLHGHORVPRQRFLWRV)LQDOPHQWHODVSURWHtQDV1HI\9SXSURPXHYHQODPXHUWHGH
/7CD4+ y CD4-PHGLDQWHODSURPRFLyQGHHIHFWRVWy[LFRVVREUH
la membrana celular. La miristilación de Nef le permite anclarse en
ODPHPEUDQDSODVPiWLFD\SURPRYHUODapoptosis por mecanismos
)DVLQGHSHQGLHQWHV
'DGR TXH H[LVWHQ HYHQWRV PROHFXODUHV HQ FRP~Q HQWUH ORV
procesos de proliferación celular y DSRSWRVLV FRQGHQVDFLyQGHO
núcleo, activación de FDVSDVDV HVFRPSUHQVLEOHTXHODDFWLYDción de células inmunes, esté asociada al disparo de la muerte
celular para limitar los efectos de una respuesta inmune activada.
La muerte apoptótica de células no infectadas ocurre también por
LQGXFFLyQGHVXDFWLYDFLyQSRUHMHPSORDOLQWHUDFWXDUJSFRQ
&'ORTXHODKDFHPiVVXVFHSWLEOHDODPXHUWHSRU)DV(OORVH
debe a que si dicha unión precede a la correcta interacción entre
XQDQWtJHQR\HO7&5VHLQKLEHODH[SUHVLyQGHF)/,3XQUHJXlador de la vía apoptótica mediada por )DV&DVSDVD\DXPHQWDOD
DFWLYLGDGGHGLFKDFDVSDVDDVtFRPRODVGHOD\OD$VLPLVPR
ODSURWHtQD7DWDXPHQWDODH[SUHVLyQGHODFDVSDVDODSURWHtQD
%D[\)DV/DOWLHPSRTXHLQKLEHODGH%FO(QFRQMXQWRHVWRV
efectos promueven la muerte de células no infectadas activadas. Se
ha postulado que en la apoptosis por activación, podrían participar
las tres vías de su señalización: )DV SUHGRPLQDQWH 71)\75$,/
Se desconoce si la principal contribución a la muerte de células no
infectadas es atribuible a la acción de las proteínas virales per se o
a mecanismos apoptóticos asociados a la activación celular.
/DH[SUHVLyQGHPROpFXODV&'HQ/7&'+ activados, permite su infección por HIV. Asimismo, estos linfocitos pueden ser
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
202
Efector
Mecanismo
Célula diana
gp120/160
,QDSURSLDGDDFWLYDFLyQGHVSXpVGHXQLUVHDO&'
$XPHQWRGHODVHQVLELOLGDGDFas
3URGXFFLyQGHFasL
¢0XHUWHQRDSRSWyWLFDSRU&;&5GHLT CD8+?
No infectadas
Nef
Activación
3URGXFFLyQDXPHQWDGDGHFasL
Infectadas y no
infectadas
Tat
$XPHQWRGHODVHQVLELOLGDGDFas
3URGXFFLyQDXPHQWDGDGHFasL
Infectadas y no
infectadas
Vpr
'HWHQFLyQGHOFLFORFHOXODU
Afectación de la permeabilidad mitocondrial
Infectadas y no
infectadas
Proteasa
&OLYDMHGH%FO\GHSURWHtQDVHVWUXFWXUDOHV
Infectadas
Apoptosis
asociada a la
activación
Activación asociada a +,9
$XPHQWRGHODH[SUHVLyQGH75$,/FasL o ambos
No infectadas
0XHUWHFHOXODU
DXWyORJD SRU
macrófagos,
monocitos y
LT CD8+
3URGXFFLyQDXPHQWDGDGHOLJDQGRVSDUDFpOXODV
FLWRWy[LFDVLQGXFLGDSRUFpOXODVLQIHFWDGDVSRU+,9
No infectadas
Tabla 8.14. Mecanismos de acción propuestos para la apoptosis de linfocitos asociada a HIV.
SDVLEOHVGHOHQWUHFUX]DPLHQWRHQWUHDTXHOODPROpFXOD\ODJS
promoviendo la apoptosis. Este desenlace también puede ocurrir
como resultado de la inducción de su activación por estímulos diversos, por la interacción con ligandos de muerte con células infectadas y por la estimulación antigénica crónica. Sin embargo, se ha
observado que los niveles de /7&'+QRHVWiQVLJQL¿FDWLYDPHQWH
reducidos en pacientes infectados con HIV. Ello se atribuye a que
esta población precede en su recuperación a la de los /7CD4+.
El entorno de FLWRTXLQDVWDOHVFRPR,/H,/IDYRUHFHOD
apoptosis de los linfocitos durante la infección por HIV. Por el contrario, la presencia de ,/SURPXHYHODSURGXFFLyQGH,)1ȖOD
activación de los /7&'+ y la inhibición de los eventos apoptóticos.
2WURHMHPSORSDUWLFXODUGHYLUXVTXHLQKLEHRSURPXHYHODapoptosis en un delicado balance es LQÀXHQ]D6XSURWHtQDQRHVWUXFWXUDO
16LQKLEHODDFWLYLGDG SURDSRSWyWLFD GHODPKR inducida por
el ,)1\DFWLYDPHGLDQWHVXSURSLDXQLyQDODIRVIDWLGLOLQRVLWRO
TXLQDVD 3,. ODYtD3,.$NW DQWLDSRSWyWLFD TXHLQKLEHDOD
caspasa 9, evitando la apoptosis temprana y permitiendo la replicación viral en células epiteliales. A su vez, la proteína 3%) FRGL¿FDGDHQODUHJLyQGHOD3ROLPHUDVD%iVLFDSHURHQHOPDUFRGH
OHFWXUD>[email protected] SURPXHYHODapoptosis de monocitos infectados.
(QFRQMXQWRVHIDYRUHFHODHYDVLyQDODUHVSXHVWDLQPXQHPHGLDQWH
HIHFWRVRSXHVWRV DQWLapoptosis/DSRSWRVLV HQFpOXODVHSLWHOLDOHV\
en aquellas que participan en la vigilancia inmunológica.
Recientes estudios pioneros determinaron in vitro que el +69
es capaz de promover la apoptosis de OLQIRFLWRV7DFWLYDGRVDWUDYpV
GHODVREUHH[SUHVLyQGHJDOHFWLQDXQDSURWHtQD OHFWLQD FHOXODU
que se une a carbohidratos y que es crucial en la evasión inmune
de ciertos procesos tumorales, así como en la regulación de la actividad de macrófagos y monocitos. La apoptosis de los OLQIRFLWRV7
promovida por intermedio de JDOHFWLQDFRQWULEXLUtDDODHYDVLyQ
viral a la respuesta inmune en la infección herpética.
2.6. MODIFICACIÓN DE LA ACTIVIDAD DEL SISTEMA
(TABLA 8.15)
DEL COMPLEMENTO
6HKDGHPRVWUDGRTXHFLHUWDVSURWHtQDVYLUDOHVSXHGHQH[KLELUVHcuencias aminoacídicas homólogas con las de proteínas de la cascada del complemento. Ello puede conducir a la inhibición de esa
cascada a través de la unión proteína viral símil-complemento con
factores regulatorios, o bien permitir la entrada viral a las células a
través de receptores para complemento.
La proteína gpC de +69VHH[SUHVDHQODVXSHU¿FLHGHODFpOXOD
infectada y se une a los componentes del FRPSOHPHQWR&E\&EL
La inhibición de la cascada del complemento promueve un mecanismo de escape a la neutralización viral y a la destrucción de la
FpOXODLQIHFWDGD'HPDQHUDDQiORJDHOEBV ingresa al LB –donde
SRGUiHVWDEOHFHUXQDLQIHFFLyQODWHQWH±DWUDYpVGHODKRPRORJtD
DPLQRDFtGLFDHQWUHVXSURWHtQDGHHQYROWXUDJS\&EDSURYHchando el mismo UHFHSWRU&'TXHXWLOL]DHVWD~OWLPDPROpFXOD
La proteína core de HCV se une al receptor del FRPSOHPHQWR&T5
en OLQIRFLWRV7GHHVWDPDQHUDRFXSDHOOXJDUGHOOLJDQGRQDWXUDO
inhibiendo la respuesta de estas células a la acción del sistema de
complemento.
2.7. SOBRE-EXPRESIÓN DE RECEPTORES PARA FC
Y CONSIGUIENTE UNIÓN DE IGS (TABLA 8.16)
7DQWRHOHCMV como el +69SXHGHQHVFDSDUDOUHFRQRFLPLHQWR
inmune mediado por DQWLFXHUSRV\DTXHLQGXFLHQGRODH[SUHVLyQ
Capítulo 8 / Evasión viral a la respuesta inmune del hospedador
203
‡3URWHtQDYLUDOVtPLOFRPSRQHQWHGHOcomplemento
HSV:JS&VHXQHD&EHLQKLEHODFDVFDGDGHOcomplemento
EBV:JS VtPLO&E VHXQHD&'HLQKLEHODFDVFDGDGHOcomplemento
‡3URWHtQDYLUDOTXHXQHDFRPSRQHQWHVGHOcomplemento
HCV: el coreVHXQHDOreceptor del FRPSOHPHQWR&T5HQ/7LQKLELHQGRODUHVSXHVWDGH
HVWDVFpOXODV
7DEOD0RGL¿FDFLyQGHODDFWLYLGDGGHOVLVWHPDGHOcomplemento, algunos ejemplos.
‡(VFDSHDODOLVLVPHGLDGDSRUcomplemento y a la virólisis inmune
HCMV
HSV
Tabla 8.16. Sobre-expresión de receptores para Fc y consiguiente unión de Igs.
‡,QKLELFLyQGHODH[SUHVLyQGH&'HQODVXSHU¿FLHFHOXODU
Ƈ$XPHQWRGHODHQGRFLWRVLVGH&'
HIV: 1HILQWHUDFW~DFRQ&'HQODVXSHU¿FLHFHOXODU\SURPXHYHVXHQGRFLWRVLV
Ƈ'HJUDGDFLyQGH&'
HIV:9SXLQGXFHODGHJUDGDFLyQGH&'QHRVLQWHWL]DGR
‡8QLyQGHSURWHtQDVYLUDOHVD&'
Ƈ(Qcélulas NK
HCV:(VHXQHD&'SURPRYLHQGRODLQKLELFLyQGHODcitotoxicidad mediada por NK y la
GLVPLQXFLyQHQODSURGXFFLyQGH,)1Ȗ
Ƈ(QLT citotóxicos
HCV: (VHXQHD&'SURPRYLHQGRODDFWLYDFLyQGHHVWDVFpOXODV±FRQXQSHU¿O
preponderantemente 7K±\ODLQKLELFLyQGHODH[SUHVLyQGHO7&5
Tabla 8.17. Interacción de proteínas virales con receptores celulares (moléculas CD), algunos ejemplos.
GHORVUHFHSWRUHVSDWD)FSHUPLWHQTXHODV,JVVH¿MHQDODVFpOXODV
y tengan un impedimento estérico para realizar la lisis mediada por
ODIRUPDFLyQGHOFRPSOHMRDQWtJHQRDQWLFXHUSR\complemento, o
por un mecanismo de FLWRWR[LFLGDGDWUDYpVGHO)FGHHVWDV,JV(VWH
YHUGDGHURDQFODMHGHORVanticuerpos también facilita el escape a la
virólisis inmune.
2.8. INTERACCIÓN DE PROTEÍNAS VIRALES CON RECEPTORES/
CORRECEPTORES CELULARES –MOLÉCULAS CD– (TABLA 8.17)
6HKDGRFXPHQWDGRODLQKLELFLyQGHODH[SUHVLyQGHPROpFXODVGH
&'HQODVXSHU¿FLHGHODVFpOXODVLQIHFWDGDVFRQHIV. Esto es llevado a cabo por las proteínas virales Nef y Vpu por medio de diferentes
mecanismos. El primero de ellos es la endocitosis de las moléculas de
&'TXHVHHQFXHQWUDQHQODVXSHU¿FLHFHOXODU3DUDHVWRODSURWHtQD
viral Nef interactúa con factores celulares de la maquinaria endocítica
y promueve el transporte de CD4 al lisosoma, con su consiguiente
degradación. Por otra parte, la proteína Vpu promueve la degradación
de las moléculas de CD4 neosintetizadas logrando con esto también
GLVPLQXLUODH[SUHVLyQGHODVPLVPDVHQODVXSHU¿FLHFHOXODUSRUXQD
vía alternativa a la utilizada por Nef.
/DLQWHUDFFLyQGHODSURWHtQD(GHHCV con las moléculas
&'GHODVXSHU¿FLHGHcélulas NK puede inhibir la FLWRWR[LFLGDG
GHHVWDVFpOXODVDVtFRPRODSURGXFFLyQGH,1)ȖSRUSDUWHGHODV
mismas. Esto último puede alterar el desarrollo de la respuesta
7K±IDYRUHFLHQGRDOD7K±ORTXHH[SOLFDUtDHOGLVEDODQFHHQ
la relación 7K7KREVHUYDGDHQORVSDFLHQWHVLQIHFWDGRVFRQ
este virus. La inhibición de la respuesta inmune innata durante
ODVHWDSDVWHPSUDQDVGHODLQIHFFLyQSXHGHFRQIHULUXQDYHQWDMD
de inicio al HCV, el que con posterioridad probablemente no poGUiVHUFRQWURODGRSRUODUHVSXHVWDLQPXQHDGDSWDWLYD\GHHVWH
PRGRSHUVLVWLUiHQODFpOXODKRVSHGDGRUD$VXYH]ODPLVPD
proteína viral interactuando con la misma molécula CD, pero en
una estirpe celular diferente produce efectos contrarios a los desFULWRVDQWHULRUPHQWHHVGHFLUGHDFWLYDFLyQPiVTXHLQKLELFLyQ
/DLQWHUDFFLyQDQWHVPHQFLRQDGD (&' HQODVXSHU¿FLHGH
/7SURGXFHDFWLYDFLyQGHHVWDVFpOXODVDXPHQWRHQODSURGXFFLyQ
GH,1)ȖH,/SHURFRQXQDGLVPLQXFLyQHQODH[SUHVLyQGH
PROpFXODVGHO7&5HQODVXSHU¿FLHGHORV/7(VWRVXJLHUHTXH
durante la infección por HCV se produce una activación de /7
que contribuye al daño de las células infectadas o a desórdenes
autoinmunes asociados a la infección por este agente.
3. CONCLUSIONES
Y PERSPECTIVAS
Los virus han desarrollado un sinnúmero de estrategias para evadir las defensas inherentes a la respuesta innata y adaptativa del
sistema inmune. Sólo algunas de ellas comienzan a ser dilucidadas, mientras otras aguardan su descubrimiento. En este capítulo
VHKDQGHVFULWRHMHPSORVIDVFLQDQWHVDWUDYpVGHORVFXDOHVORV
204
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
virus logran su cometido, ya sea mediante el escape a las defensas
HYDGLHQGRVXUHFRQRFLPLHQWR SRUHMHPSORPHGLDQWHODYDULDELOLdad antigénica de virus como HIV, HCV, +%9LQÀXHQ]DRRSV,
o a través de la promoción de la latencia viral con restringida,
PtQLPDRQXODH[SUHVLyQGHSpSWLGRVYLUDOHVHQHOFRQWH[WRGHPRléculas del CMH-I y/o II como lo hacen diversos miembros de la
familia Herpesviridae RPHGLDQWHHOcontraataque o subversión
viral afectando la funcionalidad de las células del sistema inmune
FRPRSRUHMHPSORORUHDOL]DQHIV, HCV, sarampión, (%9HWF 6LQHPEDUJRHOOHFWRUGHEHUiWHQHUSUHVHQWHTXHDSHVDUGHOD
GLYHUVLGDG\VR¿VWLFDFLyQGHODVHVWUDWHJLDVHVJULPLGDVSRUORV
virus, el sistema inmune del hospedador es capaz de neutralizar
la mayoría de ellas.
El conocimiento detallado de los mecanismos de evasión viral a
ODUHVSXHVWDLQPXQHFRQWULEX\HDODPHMRUFRPSUHQVLyQGHODpatogénesis molecular de las infecciones virales, a la vez que determina
algunas de las moléculas diana que podrían ser potencialmente inhibidas en futuras intervenciones terapéuticas.
Bibliografía
‡ $JQHOOLQL3:ROLQW35HKU0&DKHQ]OL-.DUUHU82[HQLXV$
,PSDLUHG1)$7QXFOHDUWUDQVORFDWLRQUHVXOWVLQVSOLWH[KDXVWLRQRI
YLUXVVSHFL¿F&'7FHOOIXQFWLRQVGXULQJFKURQLFYLUDOLQIHFWLRQ
Proc Natl Acad Sci USA
‡ %DUEHU'/:KHUU\(-0DVRSXVW'=KX%$OOLVRQ-36KDUSH$+HW
DO5HVWRULQJIXQFWLRQLQH[KDXVWHG&'7FHOOVGXULQJFKURQLFYLUDO
infection". Nature
‡ %RRPNHU -0 GH /HLM /)0+ +DXZ 7KH 7 +DUPVHQ 0& 9LUDO
chemokine-modulatory proteins: tools and targets". Cytokine Growth
Factor Rev ‡ %RQMDUGLP&$,QWHUIHURQV ,)1V DUHNH\F\WRNLQHVLQERWKLQQDWH
and adaptive antiviral immune responses-and viruses counteract ,)1
action". Microbes Infec ‡ +DOOHU2.RFKV*:HEHU)7KHLQWHUIHURQUHVSRQVHFLUFXLW,QGXFWLRQ
and suppression by pathogenic viruses". Virology ‡ +LOOHPDQ056WUDWHJLHVDQGPHFKDQLVPVIRUKRVWSDWKRJHQVXUYLval in acute and persistent viral infections". Proc Natl Acad Sci USA
‡ 0DOPJDDUG/,QGXFWLRQDQGUHJXODWLRQRI,)1VGXULQJYLUDOLQIHFtions". J Interf Cytok Res
‡ 2UDQJH-6)DVVHWW06.RRSPDQ/$%R\VRQ-(6WURPLQJHU-/9Lral evasion of natural killer cells". Nat Immunol ‡ 5DG]LHZLF]+,EHJEX&&)HUQDQGH]0/:RUNRZVNL.$2ELGHHQ
.:HKEL0HWDO$/LYHULQ¿OWUDWLQJO\PSKRF\WHVLQFKURQLFKXman KHSDWLWLV&YLUXVLQIHFWLRQGLVSOD\DQH[KDXVWHGSKHQRW\SHZLWK
high levels of 3' DQG ORZ OHYHOV RI &' H[SUHVVLRQ J Virol
‡ 6FK|O]&57DPSH7KHLQWUDFHOOXODUDQWLJHQWUDQVSRUWPDFKLQHU\7$3
in adaptive immunity and virus escape mechanisms". J Bioenerg Biomembr ‡ 6FKURGHU0$*%RZLH7/5LQDQWLYLUDOLPPXQLW\NH\SOD\HURU
E\VWDQGHU"Trends Immunol ‡ 9RVVHQ07:HVWHUKRXW(06RGHUEHUJ1DXFOHU&:LHUW](-9Lral immune evasion: a masterpiece of evolution". Immunogenetics
‡ :HEHU).RFKV*+DOOHU2,QYHUVHLQWHUIHUHQFHKRZYLUXVHV¿JKW
the interferon system". Viral Immunol 9
Diagnóstico virológico
Guadalupe Carballal, José Raúl Oubiña
1. CONCEPTOS
INTRODUCTORIOS
1.1 IMPORTANCIA DEL DIAGNÓSTICO VIROLÓGICO
¢3DUDTXpVLUYHXQGLDJQyVWLFRYLUROyJLFR"(QODDFWXDOLGDGQRVH
cuestiona la importancia del diagnóstico virológico en numerosas
situaciones clínico-epidemiológicas. El diagnóstico de certeza es
fundamental para decidir una intervención terapéutica, establecer
el pronóstico en la evolución de un paciente, monitorear la respuesta a los tratamientos DQWLYLUDOHV HVSHFt¿FRV LQGLFDU OD QHFHVLGDG
de una vacunación, y –desde un punto de vista epidemiológico–
DGRSWDUPHGLGDVGH6DOXG3~EOLFDHQXQDFRPXQLGDG 7DEOD Actualmente se dispone de numerosos procedimientos diagQyVWLFRV UiSLGRV \ H¿FDFHV GH WpFQLFDV PROHFXODUHVGH H[TXLVLWD
sensibilidad y de drogas DQWLYLUDOHVHVSHFt¿FDVTXHGHEHQVHUDGministradas tempranamente en el curso de las infecciones virales.
Por estas razones, la antigua creencia de que el diagnóstico virológico se obtiene tardíamente y resulta inútil para el paciente ha
sido eliminada.
1XPHURVDV SXEOLFDFLRQHV GHPXHVWUDQ HO FRVWREHQH¿FLR GHO
diagnóstico virológico en múltiples situaciones, inclusive en aqueOODVSDUDODVTXHQRH[LVWHXQWUDWDPLHQWRHVSHFt¿FR
En esos casos, el diagnóstico virológico permite disminuir costos innecesarios en antibióticos y en otros procedimientos diagnósticos, realizar el aislamiento en cohortes de pacientes con la misma
LQIHFFLyQSDUDHYLWDUODGLVHPLQDFLyQLQWUDKRVSLWDODULD SRUHMHPSOR
de YLUXVUHVSLUDWRULRV GHWHUPLQDUHOHVWDGRLQPXQHSDUDLQGLFDUOD
vacunación sólo a los pacientes susceptibles, y adoptar medidas epidemiológicas para evitar la diseminación de ciertos virus.
8QGUDPiWLFRHMHPSORGHODimportancia del diagnóstico virológico lo constituyen los brotes de LQÀXHQ]DDYLDULDUHJLVWUDGRVHQDYHV
D¿QHVGHOVLJOR;;\ODDSDULFLyQGHORVSULPHURVFDVRVHQKXPDQRV
1) Al diagnóstico individual
HQHVWUHFKRFRQWDFWRFRQHVRVDQLPDOHV$GHPiVHQHODxROD
emergencia de una cepa de LQÀXHQ]D$ +1 SURGXMRODSULPHU
SDQGHPLDGHOVLJOR;;,(QHVWRVFDVRVVHGHELHURQGHVDUUROODUUipidamente técnicas moleculares tanto para diagnóstico como para el
estudio del genoma de estas cepas. Así, se pudo determinar que el
virus pandémico de LQÀXHQ]D$ +1 HUDXQYLUXVFX\RJHQRPD
H[KLEtDXQDWULSOHreasociación de sus segmentos de RNA constitutivos y que había adquirido la capacidad de transmisión interhumana.
1.2 FUNDAMENTOS DE LA UTILIZACIÓN
DE MÉTODOS DIRECTOS E INDIRECTOS O SEROLÓGICOS
Para obtener las muestras adecuadas para el diagnóstico virológico
es necesario conocer la SDWRJHQLDGHFDGDHQIHUPHGDG VHREVHUYDXQ
HMHPSORHQOD)LJXUD 6LELHQH[LVWHQYDULDFLRQHVHOSHUtRGRGH
incubación de la mayoría de las infecciones virales es de alrededor
GHGtDV SRUHOFRQWUDULRDOJXQDVGLDUUHDVRFXUUHQDOFDERGH
h., mientras que la sintomatología de la rabia puede hacerse mani¿HVWDD~QOXHJRGHXQDxRGHSHUtRGRGHLQFXEDFLyQ /XHJRGHXQ
SHUtRGRSURGUyPLFRDSDUHFHQORVVtQWRPDV SHUtRGRGHHVWDGR (Q
HVWDHWDSDHOYLUXVHVWiUHSOLFDQGRDFWLYDPHQWH\SRUHVWDUD]yQSXHden emplearse para detectarlo PpWRGRVGLUHFWRV DLVODPLHQWRHQFXOtivo, detección de antígenos virales, microscopia electrónica y méWRGRVPROHFXODUHV 'XUDQWHODV~OWLPDVHWDSDVGHOSHUtRGRGHHVWDGR
y en la convalecencia temprana aparecen los DQWLFXHUSRVHVSHFt¿FRV
antivirales, siendo la IgM la primera inmunoglobulina detectable y
ODTXHSHUPLWLUiUHDOL]DUHOdiagnóstico de infección reciente. Cuando
ORVPpWRGRVGHGHWHFFLyQGH,J0QRH[LVWtDQHOdiagnóstico serolóJLFRVHUHDOL]DEDSRUVHURFRQYHUVLyQ WDPELpQGHQRPLQDGDFRQYHUVLyQVHUROyJLFD HQGRVPXHVWUDVODSULPHUDREWHQLGDHQSHUtRGRGH
HVWDGR\ODVHJXQGDDORVGtDV(VWRSHUPLWHXQdiagnóstico de
FHUWH]DSHURWDUGtR UHWURVSHFWLYR Enfermedad o virus
'H¿QHXQDLQWHUYHQFLyQWHUDSpXWLFD
(QFHIDOLWLVRTXHUDWLWLVKHUSpWLFDKHUSHVJHQLWDO
Rabia
)LHEUHKHPRUUiJLFDDUJHQWLQD
&LWRPHJDORYLUXVKXPDQRHQLQPXQRGHSULPLGRV
+,9
+HSDWLWLV%KHSDWLWLV&
,QÀXHQ]D
Orienta un pronóstico
Infecciones congénitas (por UXEpRODRSDUYRYLUXVKXPDQR% FLWRPHJDORYLUXVKXPDQR
Monitorea la respuesta a la terapéutica
+,9KHSDWLWLV%KHSDWLWLV&FLWRPHJDORYLUXVKXPDQR
2) A la vigilancia epidemiológica
Tabla 9.1. Contribuciones del diagnóstico virológico.
Incidencia de la infección por +,9
+HSDWLWLVYLUDOHV
9LURVLVHPHUJHQWHV\UHHPHUJHQWHV
$UERYLUXV
+DQWDYLUXV
,QÀXHQ]D
,QÀXHQ]DSDQGpPLFD$ +1 ,QÀXHQ]DDYLDU
1XHYRVYLUXVUHVSLUDWRULRV
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
206
Métodos directos
Métodos indirectos
Título
de anticuerpos
7
t
W
X
O
R
Y
L
U
D
O
//
//
Meses / años p.i.
Días post-infección (p.i.)
-7
-3
Incubación
0
3
7
10
Enfermedad
14
21
28
Convalecencia
temprana
Convalecencia
tardía
Figura 9.1. Infección viral aguda: métodos directos e indirectos de diagnóstico. El día 0 indica el comienzo de los síntomas.
(VWDVVRQRULHQWDFLRQHVJHQHUDOHVODVP~OWLSOHVSRVLELOLGDGHV
de GLDJQyVWLFRVHUiQDQDOL]DGDVHQORVFDStWXORVUHVSHFWLYRV
La elección de las muestras y el momento de su obtención deSHQGHUiQGHODpatogenia de cada infección viral y de la cinética de
la producción de DQWLFXHUSRV3RUHMHPSORORVvirus respiratorios
se eliminan en altos títulos en secreciones respiratorias por lo que
se pueden detectar en muestras respiratorias obtenidas durante los
primeros días de enfermedad, ya que subsiguientemente, el títuOR GH YLUXV HQ GLFKDV VHFUHFLRQHV GLVPLQX\H GL¿FXOWDQGR DVt VX
diagnóstico. Por el contrario, en la hepatitis B crónica el antígeno
GHVXSHU¿FLH +%V$J VHUiGHWHFWDEOHHQHOVXHURSRUPiVGHVHLV
meses, y aún durante años.
Otros aspectos a considerar para un diagnóstico adecuado son
los siguientes: las FDUDFWHUtVWLFDV GHO YLUXV \ GHO SDFLHQWH LQPXQRFRPSHWHQWHRLQPXQRFRPSURPHWLGR ODHGDGHOtipo y estadio
de la infección, la factibilidad de realizar técnicas diagnósticas, y
ODFRPSOHMLGDGGHOODERUDWRULRGLVSRQLEOHLQFOX\HQGRORVUHFXUVRV
humanos y económicos. El diagnóstico de las infecciones virales se
apoya en un trípode GLDJQyVWLFR )LJXUD 1.3. CONCEPTO DE MÉTODOS DIRECTOS E INDIRECTOS (TABLA 9.2)
(Q HVWH WH[WR VH XWLOL]DUi ±FRQ ¿QHV H[FOXVLYDPHQWH GLGiFWLFRV±
HO WpUPLQR PpWRGR SDUD UHIHULUVH DO REMHWLYR diagnóstico: el
agente etiológico será detectado mediante métodos directos y
la respuesta inmune humoral mediante metodología indirecta 6H PHQFLRQDUiQ GLYHUVDV WpFQLFDV SDUD DOFDQ]DU HO REMHWLYR
GLDJQyVWLFR(QFRQWUDSRVLFLyQFRQORVSURFHGLPLHQWRVFOiVLFRVGH
diagnóstico virológico que requerían tiempos prolongados para esWDEOHFHUORGHVGHODGpFDGDGHVHKDD¿DQ]DGRHOYDORUFOtQLFR
GHSURFHGLPLHQWRVUiSLGRVSDUDORJUDUOR6LQHPEDUJRHOOHFWRUREVHUYDUiTXHPXFKDVYHFHVSXEOLFDFLRQHVGLYHUVDVXWLOL]DQLQGLVWLQtamente los términos "método", "técnica" y "procedimiento". Así
SRUHMHPSORHQHOOHQJXDMHGHHVWHWH[WRXQDPLVPDWpFQLFD SRU
HMHPSOR XQ (/,6$ SXHGH VHU XWLOL]DGD SDUD métodos directos o
indirectos, y en el caso de la pesquisa de IgM corresponder también
DXQSURFHGLPLHQWRUiSLGRGHdiagnóstico.
1.3.1. Métodos directos
Se denominan métodos directos de diagnóstico virológico a
DTXHOORVTXHGHWHFWDQODSUHVHQFLDGHOYLUXV RDOJXQRGHVXV
Diagnóstico de certeza:
Estudio virológico
Clínica
Signos
Síntomas
Epidemiología
Tiempo
Lugar
Persona
Figura 9.2. Trípode de diagnóstico en las infecciones virales.
componentes) en muestras clínicas, lo que puede realizarse a
través de diversas técnicas que investigan la presencia de:
DJHQWHVLQIHFFLRVRV PHGLDQWHODREVHUYDFLyQGHVXUHSOLFDFLyQ
en FXOWLYRVFHOXODUHV>[email protected]
SDUWtFXODVYLUDOHV PLFURVFRSLDHOHFWUyQLFD
DQWtJHQRVYLUDOHVSRUWpFQLFDVGHLQPXQRPDUFDFLyQ ,)(/,6$,3 JHQRPDV YLUDOHV SRU WpFQLFDV PROHFXODUHV hibridación, PCR,
573&5HWF (ODLVODPLHQWRYLUDOHVODWpFQLFDFOiVLFD\IXHXQDGHORVSULPHUDV
utilizadas en Virología. Para muchos virus, el aislamiento es la técnica
GHUHIHUHQFLDRHVWiQGDUGHRUR HQLQJOpVgold standard GHOdiagnóstico, ya que permite la obtención de la cepa viral, lo que presenta gran
importancia no sólo para el diagnóstico de un caso individual sino para
HVWXGLRVHSLGHPLROyJLFRV6XVGHVYHQWDMDVVRQHOWLHPSRGHHVSHUDGH
UHVXOWDGRV GtDVRVHPDQDV VXDOWRFRVWR\UHDOL]DFLyQFRPSOHMD\D
TXHUHTXLHUHQSHUVRQDOHQWUHQDGRLQIUDHVWUXFWXUDFRVWRVDSDUDWUDEDMR
en condiciones de esterilidad y bioseguridad en cultivos celulares y/o
SDUDPDQWHQLPLHQWRGHDQLPDOHV ELRWHULRV $GHPiVQRWRGRVORVYLrus que causan patología en humanos son cultivables.
Actualmente, se dispone de procedimientos rápidos de diagQyVWLFRYLUROyJLFRTXHSHUPLWHQREWHQHUXQUHVXOWDGRDSRFDV
horas de obtenida la muestra, lo que resulta de gran valor clínico.
207
Capítulo 9 / Diagnóstico virológico
(VWRVSURFHGLPLHQWRVVRQGHPiVIiFLOHMHFXFLyQ\GHPHQRUFRVWR
ya que no requieren infraestructura para aislamiento del virus en
FXOWLYRVFHOXODUHV 7DEOD /RVSURFHGLPLHQWRVUiSLGRVSXHGHQ
corresponder a métodos directos o indirectos, por lo que pueden
detectar:
SDUWtFXODVYLUDOHVSRUPLFURVFRSLDHOHFWUyQLFD
DQWtJHQRVYLUDOHVSRUPpWRGRVGHLQPXQRPDUFDFLyQ
JHQRPDVYLUDOHVSRUSURFHGLPLHQWRVPROHFXODUHV
,J0 HVSHFt¿FD HQ XQD ~QLFD PXHVWUD GH VXHUR éste es un
método indirecto PHGLDQWHLQPXQRHQVD\R
1.3.2. Métodos indirectos
Se denominan PpWRGRVLQGLUHFWRVRVHUROyJLFRVDDTXHOORVTXHLQvestigan la respuesta inmune humoral mediada por anticuerpos
HVSHFt¿FRVantivirales en el suero o plasma del paciente. Por ende,
no detectan la presencia del agente etiológico. Para realizar un diagnóstico virológico sustentado en la serología es necesario determinar
la conversión serológica VHURFRQYHUVLyQ RELHQODSUHVHQFLDGH IgM
HVSHFt¿FDDQWLYLUDO
6HGH¿QHDODFRQYHUVLyQVHUROyJLFDFRPRODDSDULFLyQRel
aumento de 4 o más veces del título de anticuerpos entre dos
muestras pareadas de suero, la primera obtenida en período
agudo y la segunda en la convalecencia (14-21 días después del
comienzo de los síntomas) y procesadas simultáneamente )LJXUD /DGHPRVWUDFLyQGHFRQYHUVLyQVHUROyJLFDHVXQPpWRGR
FOiVLFR\H¿FD]GHGLDJQyVWLFRSHURHVUHWURVSHFWLYRHVGHFLUHO
UHVXOWDGRVHREWLHQHJHQHUDOPHQWHFXDQGRHOSDFLHQWHVHKDFXUDGR
SRU HOOR VyOR VH OD XWLOL]D SDUD FRQ¿UPDFLyQ GH FDVRV R SDUD esWXGLRVHSLGHPLROyJLFRVHQORVTXHUHVXOWDGHH[WUDRUGLQDULRYDORU
La detección de ,J0 HVSHFt¿FD DQWLYLUDO HQ XQD ~QLFD
muestra de suero obtenida en el período agudo o en la convalecencia temprana, permite realizar un diagnóstico de certeza en
muchas infecciones viralesFRQODHQRUPHYHQWDMDVREUHHOSURFHGLPLHQWRDQWHULRUGHTXHHOUHVXOWDGRHVWDUiGLVSRQLEOHHQWLHPSRV
FOtQLFDPHQWHUHOHYDQWHV SURFHGLPLHQWRUiSLGR 2. MUESTRAS
ticas del virus y el estadio de la enfermedad. Las muestras pueden
REWHQHUVHPHGLDQWHKLVRSDGRVGHVHFUHFLRQHVFRQMXQWLYDOHVJHQLWDOHVUHFWDOHVQDVDOHVIDUtQJHDVRGHOHVLRQHVFXWiQHDVSRUDVSLUDGRVQDVRIDUtQJHRVRWUDTXHDOHVRODYDGREURQTXLRDOYHRODU7DPELpQ
pueden utilizarse muestras de sangre, suero, plasma, orina, líquido
FHIDORUUDTXtGHR /&5 OtTXLGRDPPLyWLFRPDWHULDIHFDO\XyUJDnos obtenidos mediante biopsia o autopsia.
Para la obtención de las muestras deben usarse guantes y es necesario observar las normas de bioseguridad. Las muestras deben
colocarse en recipientes estériles y con tapa hermética para evitar
riesgos de derrame.
(QWRGRVORVFDVRVMXQWRFRQODPXHVWUDGHELGDPHQWHURWXODGDHVLPSUHVFLQGLEOHUHPLWLUDOODERUDWRULRXQDRUGHQPpGLFDTXHFRQWHQJDD QRPEUHGHOSDFLHQWHE HVWXGLRVROLFLWDGRF WLSRGHPXHVWUDHQYLDGDG EUHYH
resumen de historia FOtQLFDH IHFKDGHFRPLHQ]RGHODHQIHUPHGDGDFWXDOI IHFKDGHH[WUDFFLyQGHODPXHVWUD\J GDWRVGHOPpGLFRUHPLWHQWH
2.2. OBTENCIÓN DE MUESTRAS PARA AISLAMIENTO VIRAL
Estas muestras deben colocarse en tubos con un medio de transSRUWHSDUDYLUXV8QRGHORVPiVXVDGRVHVHOPHGLRGH+DQN¶VFRQ
GHDOE~PLQDERYLQDRVXHURIHWDOERYLQRDQWLELyWLFRV\DQtimicóticos. Las proteínas se añaden para preservar la infectividad
YLUDO\ORVDQWLPLFURELDQRVSDUDLQKLELUOD SRWHQFLDO ÀRUDFRQWDminante. Para aislamiento, es fundamental la obtención temprana
GHODVPXHVWUDV\DTXHODVSRVLELOLGDGHVGHp[LWRVRQPD\RUHVHQ
HWDSDVLQLFLDOHVGHODHQIHUPHGDG$GHPiVHVPX\LPSRUWDQWHOD
FRUUHFWDFRQVHUYDFLyQ\HOHQYtRUiSLGRGHODPXHVWUDGHELGDPHQWH
refrigerada para evitar la inactivación térmica del virus.
([LVWHQHTXLSRVFRPHUFLDOHVSDUDREWHQFLyQ\HQYtRGHPXHVWUDV
que contienen hisopos de materiales sintéticos y una ampolla con
PHGLRGHWUDQVSRUWH Culturet, Virocult,HWF 'DGRVXDOWRFRVWRHQ
nuestro medio son habitualmente reemplazados por los tubos con
medio de transporte preparados en cada laboratorio, los que deben
VHUFRQVHUYDGRVDž&\XWLOL]DGRVDQWHVGHODIHFKDGHYHQFLPLHQWR
2.3 OBTENCIÓN DE MUESTRAS PARA
DIVERSOS PROCEDIMIENTOS DIAGNÓSTICOS
2.1. OBTENCIÓN (TABLA 9.4 Y 9.5)
Para obtener la muestra adecuada en el momento oportuno es necesario conocer la patogenia de cada infección viral, las caracterís-
Métodos
Directos
Muestras para virus respiratorios
/DVPXHVWUDVGHEHQREWHQHUVHWHPSUDQDPHQWH GtDVGHOLQLFLRGH
ODHQIHUPHGDG 3XHGHQVHUDVSLUDGRVQDVRIDUtQJHRV $1) KLVRSD-
Procedimiento / Técnica
$LVODPLHQWRHQ
+XHYRVHPEULRQDGRVDQLPDOHVR
FXOWLYRVFHOXODUHV
Detección de:
/HVLRQHV\RPXHUWH
Acción citopática (ACP)
,GHQWL¿FDFLyQGHOYLUXV DLVODGRR
no) mediante:
Antígenos virales
,QPXQRPDUFDFLyQ IF, IP, ELISA),
QHXWUDOL]DFLyQ)&,+$HWF
3DUWtFXODVYLUDOHV
Microscopia electrónica
Genomas virales
+LEULGDFLyQPCR, PCR en
tiempo real, RFLP, VHFXHQFLDFLyQ
QXFOHRWtGLFD
Indirectos o serológicos
1HXWUDOL]DFLyQ
(/,6$,),)&,+$HWF
ELISA, IFI
$QWLFXHUSRVHVSHFt¿FRV
- Conversión serológica en dos
PXHVWUDVSDUHDGDV
- ,J0HVSHFt¿FDHQPXHVWUD~QLFD
GHSHUtRGRDJXGRRFRQYDOHFHQFLD
temprana
Tabla 9.2. &ODVL¿FDFLyQGHORVPpWRGRVGHdiagnóstico virológico de acuerdo a la forma en que detectan la infección. ,)LQPXQRÀXRUHVFHQFLD,3LQPXQRSHUR[LGDVD(/,6$HQ]LPRLQPXQRHQVD\R3&5Polymerase chain reaction 5HDFFLyQHQFDGHQDGHODSROLPHUDVD
)&)LMDFLyQGHOFRPSOHPHQWR5)/3Restriction fragment length polymorphism SROLPRU¿VPRGHODORQJLWXGGHIUDJPHQWRVGHUHVWULFFLyQ,),
LQPXQRÀXRUHVFHQFLDLQGLUHFWD,+$,QKLELFLyQGHODKHPDJOXWLQDFLyQ
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
208
Detección del virus (o alguno de sus componentes)
en muestras clínicas en la forma de:
Técnica
3DUWtFXODYLUDO
Microscopia electrónica
,QPXQRPLFURVFRSLDHOHFWUyQLFD
Antígeno viral
7pFQLFDVGHLQPXQRPDUFDFLyQ
,QPXQRÀXRUHVFHQFLDGLUHFWD IF)
,QPXQRÀXRUHVFHQFLDLQGLUHFWD ,),
- ,QPXQRSHUR[LGDVD ,3
(Q]LPRLQPXQRHQVD\R (/,6$
&RQWUDLQPXQRHOHFWURIRUHVLV &,(
Genoma viral
6LQDPSOL¿FDFLyQKLEULGDFLyQin situRHQVROXFLyQ
&RQDPSOL¿FDFLyQPCR, RT-PCR, PCR en tiempo real,
branched'1$ '1$UDPL¿FDGR HWF
1$6%$70$ DPSOL¿FDFLyQPHGLDQWHWUDQVFULSFLyQ
Detección de DQWLFXHUSRVHVSHFt¿FRV
,J0HVSHFt¿FD ,),(/,6$GHFDSWXUD
Tabla 9.3. Procedimientos de diagnóstico virológico rápido.
GRVQDVDOHV +1 \IDUtQJHRV +) FRPELQDGRV +1+) KLVRSDGRV
QDVRIDUtQJHRV +1) ODYDGRVQDVDOHVDVSLUDGRVHQGRWUDTXHDOHVODYDGRVEURQTXLRDOYHRODUHV /%$ RWHMLGRSXOPRQDUREWHQLGRHQELRSVLDV
WUDQVWUDTXHDOHVRWUDQVEURQTXLDOHVDFLHORDELHUWR yHQDXWRSVLDV
Para diagnóstico de virus respiratorios en pacientes internados el
$1)HVODPXHVWUDGHHOHFFLyQ/RVKLVRSDGRVQDVDO\IDUtQJHRFRPELQDGRV +1+) DVtFRPRWDPELpQORVKLVRSDGRVQDVRIDUtQJHRV
+1) REWHQLGRV FRQ KLVRSRV ÀH[LEOHV VRQ GH IiFLO UHDOL]DFLyQ \
HVWiQLQGLFDGRVSDUDSDFLHQWHVDPEXODWRULRV(OHVSXWRQRHVDGHFXDdo debido a su contaminación con agentes presentes en fauces. Las
ELRSVLDV FRQVWLWX\HQ H[FHOHQWHV PXHVWUDV SHUR GHELGR D VX REWHQFLyQFUXHQWDVyORVHXWLOL]DQFXDQGRODJUDYHGDGGHOFDVRORMXVWL¿FD
Los LBA son útiles para el diagnóstico de citomegalovirus huPDQR +&09 \KHUSHVVLPSOH[ +69 –entre otros– en inmunocomprometidos, ya que pueden replicar en macrófagos alveolares.
Los procedimientos de obtención de las muestras respiratorias
así como las medidas de bioseguridad que debe observar el operaGRUVHGHWDOODQHQORV&DStWXORV\
Si se solicita un diagnóstico mediante aislamiento viral, los
hisopos con la muestra deben colocarse en un tubo con medio de
transporte para virus. Si se solicita sólo detección de antígenos o
PpWRGRVPROHFXODUHVORVKLVRSRVVHFRORFDQHQVROXFLyQ¿VLROyJLFDHVWpULO&XDQGRH[LVWHGLVSRQLELOLGDGHVUHFRPHQGDEOHHPSOHDU
ambos procedimientos.
Lesiones cutáneas y mucosas
/DV PXHVWUDV GH OHVLRQHV FXWiQHDV R PXFRVDV KHUSHV varicela o
]yVWHU RJHQLWDOHV KHUSHV VHREWLHQHQSRUKLVRSDGRGHODEDVHGH
ODVYHVtFXODVySRUREWHQFLyQGHOÀXLGRGHODVYHVtFXODVFRQDJXMD
\MHULQJD/DHOHFFLyQGHODVYHVtFXODVHVLPSRUWDQWHpVWDVGHEHQ
ser frescas, no costrosas o contaminadas, debiéndose seleccionar
varias. Es de destacar que si la obtención de la muestra no es adeFXDGDODUHFXSHUDFLyQGHYLUXVVHUiGLItFLORLPSRVLEOH
Si se solicita detección de antígenos, los hisopos con la muestra
GHEHQFRORFDUVHHQVROXFLyQ¿VLROyJLFD6LWDPELpQVHVROLFLWDDLVODmiento en cultivo, otros hisopos deben colocarse en medio de transporte para virus. En algunos laboratorios se utilizan habitualmente
DPEDVWpFQLFDVSDUDGHWHFFLyQGHORVYLUXVKHUSHVVLPSOH[\YDULFHOD
zóster ya que así se aumenta la sensibilidad, por lo cual se reciben dos
WXERVFRQPXHVWUDV HQPHGLRGHWUDQVSRUWH\HQVROXFLyQ¿VLROyJLFD Sangre y Suero
La sangre debe obtenerse mediante una venopuntura realizada en
XQDVXSHU¿FLHFXWiQHDOXHJRGHHIHFWXDGDODDVHSVLDGHOD]RQDXWLOL]DQGRDJXMD\MHULQJDHVWHULOL]DGRV/DPXHVWUDGHEHFRORFDUVHHQ
tubos esterilizados con tapa hermética. Es importante el descarte de
los elementos utilizados en recipientes rígidos para evitar posibles
DFFLGHQWHVSRUSXQFLyQSHUFXWiQHD
/D VDQJUH VH FRORFDUi HQ WXERV FRQ R VLQ DQWLFRDJXODQWH GHpendiendo del virus que se intente aislar y de que circule libre en el
plasma o asociado a células.
(QODVDQJUHSXHGHQGHWHFWDUVHD YLUXVLQIHFFLRVR YLUHPLD SRU
aislamiento en FXOWLYRVFHOXODUHVE DQWtJHQRVYLUDOHVSUHYLDVHSDUDFLyQ
GHOVXHUR SRUHMHPSORHBs Ag del virus de KHSDWLWLV%F DQWtJHQRVHQ
el núcleo de SROLPRUIRQXFOHDUHV DQWLJHQHPLDSSSDUDcitomegaloviUXVKXPDQRRDQWLJHQHPLDSDUDYLUXVKHUSHVKXPDQR G JHQRPDV
virales por técnicas moleculares en sangre entera, en células ó en suero
SODVPD PCR para citomegalovirus humano, virus Epstein-Barr, virus
KHUSHVKXPDQRvirus hepatitis B, virus hepatitis C, +,9HWF El aislamiento de un virus a partir de una muestra de sangre
YLUHPLD HYLGHQFLD FRQ FHUWH]D XQD LQIHFFLyQ DJXGD R ELHQ XQD
UHDFWLYDFLyQ FLWRPHJDORYLUXV KXPDQR /D GHWHFFLyQ GH YLUHPLD
se emplea en las infecciones que producen viremias de alto título y
SURORQJDGDV ¿HEUHKHPRUUiJLFDDUJHQWLQD¿HEUHDPDULOODFLWRPHJDORYLURVLVKXPDQDHQHOLQPXQRFRPSURPHWLGRHWF /D VHSDUDFLyQ GH FpOXODV OLQIRPRQRQXFOHDUHV buffy coat) de
VDQJUHVXHOHGDUPHMRUHVUHVXOWDGRVSDUDDLVODPLHQWRTXHODVDQJUH
entera en caso de citomegalovirus humano o varicela-zóster.
La detección del HBs Ag es utilizada de rutina en los bancos de
sangre para el estudio de la sangre a transfundir y en el diagnóstico de infección por virus hepatitis B. Recientemente, se han desarrollado métodos para la detección del antígeno del core del virus
KHSDWLWLV&/DDQWLJHQHPLDSSSDUDFLWRPHJDORYLUXVKXPDQRHV
empleada habitualmente en el monitoreo de pacientes inmunosuprimidos luego del trasplante de órganos.
/DVWpFQLFDVPROHFXODUHV PCR, 57PCR y 3&5HQWLHPSRUHDO se usan en numerosas situaciones diagnósticas, pudiéndose emplear
sangre entera o suero / plasma, de acuerdo a cada virus en particular.
Suero para serología
El suero puede emplearse para:
D 'HWHUPLQDUHOHVWDGRLQPXQH SUHVHQFLDGHanticuerpos proGXFWRGHXQDLQIHFFLyQSUHYLD SDUDORFXDOHVVX¿FLHQWHFRQXQD
~QLFDPXHVWUDGHVXHUR SRUHMHPSORGHWHUPLQDUHOHVWDGRLQPXQH
antes de indicar una vacunación para rubéola o KHSDWLWLV% E Diagnóstico de infección reciente. Puede realizarse por:
EGHWHFFLyQGHFRQYHUVLyQVHUROyJLFD VHURFRQYHUVLyQ HQ
dos muestras pareadas de suero: la primera obtenida en período
DJXGR\ODVHJXQGDHQODFRQYDOHFHQFLDDORVGtDV
EGHWHFFLyQGH,J0HVSHFt¿FDHQXQDPXHVWUD~QLFDGH
suero obtenida durante al período agudo o en la convalecencia temprana (véase Diagnóstico serológico).
Materia fecal e hisopados rectales
El diagnóstico de rotavirus y adenovirus entéricos se puede reali]DUHQIRUPDUiSLGDSRU(/,6$RLQPXQRFURPDWRJUDItDHQPDWHULD
Capítulo 9 / Diagnóstico virológico
Paciente ,QIRUPDUHOHVWXGLRDUHDOL]DU
(QDOJXQRVFDVRVVHUHTXLHUH
consentimiento informado
0XHVWUD %LRVHJXULGDGUHFLSLHQWHUtJLGRWDSD
KHUPpWLFDEROVDSOiVWLFD
5RWXODFLyQQRPEUHFRPSOHWRIHFKD
2UGHQ Nombre completo del paciente
)HFKD\KRUDGHREWHQFLyQ
(VWXGLRVTXHVHVROLFLWDQ
7LSRGHPXHVWUDHQYLDGD
1RPEUHWHOpIRQR\¿UPDGHOPpGLFR
Transporte Rápido
%LRVHJXULGDG
Refrigeración
Laboratorio 5HFHSFLyQDVLJQDUFyGLJRGHEDUUDV
Procesamiento
5HVXOWDGR
Informe
Tabla 9.4. Requisitos para el envío de muestras para diagnóstico.
IHFDO7DPELpQ SXHGHQ DLVODUVH HQ FXOWLYRQXPHURVRVenterovirus
(véase el Capítulo 20).
Es necesario tener en cuenta que muchos virus entéricos resSRQVDEOHVGHJDVWURHQWHULWLVQRVRQFXOWLYDEOHV URWDYLUXVQRURYLUXV>[email protected] SRUORTXHGHEHQ
emplearse otras técnicas diagnósticas.
Orina
0XFKRVYLUXVVHH[FUHWDQSRURULQDGXUDQWHHOSHUtRGRGHLQFXEDFLyQ\
enfermedad por períodos prolongados. El diagnóstico puede realizarVHSRUDLVODPLHQWRHQFXOWLYR citomegalovirus humano, adenovirus,
UXEpROD RSRUGHWHFFLyQGHDQWtJHQRVYLUDOHVHQFpOXODVGHVFDPDGDV
FLWRPHJDORYLUXVKXPDQR yiFLGRVQXFOHLFRVPHGLDQWHWpFQLFDVPROHFXODUHV FLWRPHJDORYLUXVKXPDQRDGHQRYLUXV\YLUXV%. Muestras genitales
3DUDSDSLORPDYLUXVVHXWLOL]DQELRSVLDVFXWiQHDVRGHHQGRFpUYL[
véase el Capítulo 29, 3DSLORPDYLUXVKXPDQR $SDUWLUGHKLVRSDGRVGHFpUYL[SXHGHUHFXSHUDUVHFLWRPHJDORYLUXVKXPDQR\KHUSHV
VLPSOH[HVSHFLDOPHQWHHQHPEDUD]DGDV
/tTXLGRFHIDORUUDTXtGHR /&5
El LCR debe obtenerse en forma estéril y en él pueden detectarse
YLUXVSRUD DLVODPLHQWRE SHVTXLVDGHDQWtJHQRV\F WpFQLFDVPROHFXODUHVVLHQGRpVWDV~OWLPDVODVPiVHPSOHDGDVHQODDFWXDOLGDG
A partir de LCR pueden aislarse enterovirus no-polio y parotiditis. Los herpesvirus –causa importante de infección del SNC–
UDUDYH]VHDtVODQGHO/&5FRQODH[FHSFLyQGHODVmeningitis debiGDVDKHUSHVVLPSOH[WLSR(QLQPXQRVXSULPLGRVSXHGHDLVODUVH
citomegalovirus humano, varicela-zóster y adenovirus. Los togavirus pueden estar también presentes en el LCR.
/DDSOLFDFLyQGHWpFQLFDVPROHFXODUHV SRUHMHPSORODPCR o la
573&5 VRQGHHOHFFLyQSDUDHOdiagnóstico de las infecciones del
61&SHUPLWHGHWHFWDUUiSLGD\FHUWHUDPHQWHQXPHURVRVYLUXVWDOHV
FRPRKHUSHVVLPSOH[, varicela-zóster, parotiditis, West Nile, alfaviUXV HQFHIDOLWLV HTXLQDV ÀDYLYLUXV HQFHIDOLWLV GH 6DQ /RXLV HWF
Por lo tanto, son los procedimientos de elección para esta muestra.
Muestras oculares
Los virus que se detectan con mayor frecuencia son los herpesvirus
\ ORV DGHQRYLUXV 7DPELpQ VH GHWHFWDQ enterovirus
SURGXFWRUHVGHFRQMXQWLYLWLVKHPRUUiJLFD HQWHURYLUXV \PX\
raramente, virus vaccinia, como consecuencia de infección ocular
OXHJRGHXQDYDFXQDFLyQ DFWXDOPHQWHQRXWLOL]DGDHQODSREODFLyQ
JHQHUDO 209
/DVPXHVWUDVVHREWLHQHQSRUKLVRSDGRFRQMXQWLYDORFRUQHDO\
las técnicas utilizadas propugnan la detección de antígenos, el aislamiento viral o la detección del genoma viral. En el humor acuoso
de pacientes infectados con HIV y con retitinis por citomegalovirus
humano puede detectarse este virus por PCR.
Tejidos
/RV WHMLGRV REWHQLGRV HQ ELRSVLDV R DXWRSVLDV VRQ H[FHOHQWHV
muestras para aislamiento, detección de antígenos o de genomas
YLUDOHVDGHPiVGHVXXWLOLGDGSDUDHVWXGLRVKLVWRSDWROyJLFRV3RU
HMHPSORHQSXOPyQSXHGHQDLVODUVHFLWRPHJDORYLUXVKXPDQRKHUpesvirus, adenovirus, virus respiratorios, etc. Ocasionalmente, a
partir de hígado o bazo pueden aislarse citomegalovirus humano o
herpes. El virus -XQtQ DJHQWHGHOD¿HEUHKHPRUUiJLFDDUJHQWLQD SXHGHDLVODUVHGHVDQJUH\yUJDQRV ED]RSXOPyQHKtJDGRREWHQLGRVHQQHFURSVLDV 3DUDODGHWHFFLyQGHDQWtJHQRVSRUSURFHGLPLHQWRVUiSLGRVVH
UHDOL]DQ LPSURQWDV GH WHMLGRV R ELHQ FRUWHV SRU FULyVWDWR ORVTXH
OXHJRGHOD¿MDFLyQHQDFHWRQDXRWURV¿MDGRUHVVHSURFHVDQPHGLDQWHWpFQLFDVLQPXQRKLVWRTXtPLFDV ,),3 yPROHFXODUHV hibridación in situ, ó 3&5 .7DPELpQSXHGHHPSOHDUVHODmicroscopia
HOHFWUyQLFDVREUHFRUWHVXOWUD¿QRVGHORVWHMLGRV
2.4 CONSERVACIÓN Y TRANSPORTE AL LABORATORIO
Es importante considerar que si la muestra ha sido obtenida adecuadamente pero es conservada y/o transportada en condiciones
inadecuadas, la posibilidad de obtener el diagnóstico etiológico
puede perderse.
El envío al laboratorio debe realizarse siempre en condiciones de bioseguridad. Esto implica el uso de tubos tapados
herméticamente y el transporte en gradillas o recipientes rígidos.
Cada muestra debe enviarse debidamente rotulada con los datos
GHOSDFLHQWHGHQWURGHXQDEROVDSOiVWLFDKHUPpWLFDPHQWHFHUUDGD
3RUIXHUDGHEHDGMXQWDUVHXQDRUGHQTXHLQGLTXHHOHVWXGLRTXHVH
solicita, el tipo de muestra enviada, un breve resumen de historia
clínica, la fecha de comienzo de la enfermedad y los datos del médico remitente. Esto es importante dado que en muchas situaciones
HVQHFHVDULDXQDFRPXQLFDFLyQGLUHFWDFRQHOPpGLFR 7DEOD Muestras para aislamiento
/DPD\RUtDGHORVYLUXVVHLQDFWLYDQUiSLGDPHQWHXQDYH]VHSDUDGRVGHORVWHMLGRVGHOKRVSHGDGRUSRUHVWDUD]yQODVPXHVWUDVSDUD
aislamiento deben ser enviadas inmediatamente al laboratorio en
PHGLRGHWUDQVSRUWHSDUDYLUXV\UHIULJHUDGDVDž&6LODPXHVWUD
debe esperar algunas horas antes del envío, su conservación debe
UHDOL]DUVHHQKHODGHUDDž&/DVPXHVWUDVGHVDQJUHPDWHULDIHFDO
LCR y órganos se colocan en recipientes estériles y herméticos sin
DJUHJDGRDOJXQR/DVPXHVWUDVGHVHFUHFLRQHVFXWiQHRPXFRVDVVH
conservan en medio de transporte para virus.
El envío debe realizarse en recipientes herméticos de "telgoSRURSOiVWLFRFRQHQIULDGRUHVGHXVRGRPpVWLFRRKLHOR(QHVWH
último caso el agregado de sal otorga una mayor duración al hielo,
debido al descenso del punto crioscópico. En muchos laboratorios,
las muestras para aislamiento con un tiempo de transporte mayor
D K VRQ UHFKD]DGDV H[FHSWR HQ FDVRV GH YLUXV PX\ HVWDEOHV
DGHQRYLUXV R HQ DTXHOODV VLWXDFLRQHV HQ TXH OD UHSHWLFLyQ GH OD
PXHVWUDVHDGL¿FXOWRVDRLPSRVLEOH/DVPXHVWUDVSDUDDLVODPLHQWR
QRGHEHQFRQJHODUVHH[FHSWRHQHOFDVRTXHHOWUDVODGRLPSOLTXH
JUDQGHVGLVWDQFLDV SRUHMHPSORDODERUDWRULRVGHUHIHUHQFLD (Q
HVWRVFDVRVVHXVDUiKLHORVHFR
Es imprescindible enviar un breve resumen de historia clínica, la
IHFKDGHFRPLHQ]RGHODHQIHUPHGDGDVtFRPRODIHFKD\KRUDGHH[tracción de la muestra para poder calcular así el tiempo de transporte.
3DUD DOJXQRV YLUXV PX\ OiELOHV VLQFLFLDO UHVSLUDWRULR FLWRPHJDORYLUXVKXPDQR VHUHFRPLHQGDHQYLDUODVPXHVWUDVLQPHGLDWDPHQWH
para su inoculación en cultivos en cuanto llegan al laboratorio para
HYLWDUODLQDFWLYDFLyQYLUDO\HOUHVXOWDGRIDOVDPHQWHQHJDWLYR([LVWHQH[FHSFLRQHVTXHGHEHUiQFRQVXOWDUVHFRQHOYLUyORJR
VIROLOGÍA MÉDICA / Guadalupe Carballal - José Oubiña
210
Síndrome /
enfermedad
Meningitis
Encefalitis
Virus
Técnica o procedimiento
Usuales
(QWHURYLUXV
(&+2Coxsackie
LCR
RT-3&5FXOWLYR
Inusuales
+HUSHV simplex
+,9
(SVWHLQ%DUU
Varicela-zóster
Parotiditis
Coriomeningitis linfocitaria
West Nile 9LUXVGHO1LOR
2FFLGHQWDO
LCR
Plasma
6XHUR/&5
LCR
LCR
6XHUR/&5
6DQJUHVXHUR/&5
PCR
RT-PCR
Serología, PCR
PCR
&XOWLYRRT-PCR
6HURORJtD,J0FXOWLYRRT-PCR
6HURORJtD,J0RT-PCR
LCR
LCR
/&5VXHUR
PCR
RT-PCR
6HURORJtD,J0
LCR
PCR
LCR
LCR
LCR
LCR, saliva
LCR, saliva, piel
6DQJUHVXHUR/&5
PCR
PCR
PCR
&XOWLYRRT-PCR
&XOWLYRRT-PCR
6HURORJtD,J0RT-PCR
Usuales (no asociados a +,9
+HUSHVVLPSOH[
(QWHURYLUXVKXPDQR
$UERYLUXV
Usuales (asociados a +,9
&LWRPHJDORYLUXVKXPDQR
(SVWHLQ%DUUvaricelazóster, JC
Inusuales
Varicela-zóster
(SVWHLQ%DUU
+HUSHVYLUXVKXPDQR
Parotiditis
Rabia
West Nile
Infección
respiratoria
Muestras
En inmunocompetentes
,QÀXHQ]D
Sincicial respiratorio
3DUDLQÀXHQ]D
$GHQRYLUXV
0HWDSQHXPRYLUXVKXPDQR
5KLQRYLUXVKXPDQR
%RFDYLUXVKXPDQR
$SOLFDEOHDWRGRVORVYLUXV
Aspirado nasofaríngeo,
+LVRSDGRQDVDOIDUtQJHR
+LVRSDGR1DVR