Subido por Hugo Cardozo

LIBRO Administracion Hospitalaria y de O

Anuncio
ADMINISTRACIÓN
HOSPITALARIA
y de organizaciones de Atención de la Salud
ADMINISTRACIÓN
HOSPITALARIA
y de organizaciones de Atención de la Salud
Jorge D. Lemus, Valentín Aragües y Oroz,
María Carmen Lucioni y colaboradores
ERRNVPHGLFRVRUJ
www.corpuslibros.com
La presente es una publicación de:
www.corpuslibros.com
Jorge Daniel Lemus
Administración hospitalaria y de organizaciones de Atención de la Salud
Jorge Daniel Lemus; Valentín Aragües y Oroz; María Carmen Lucioni
DHG5RVDULR&RUSXV/LEURV0pGLFRV\&LHQWt¿FRV
S[FP
ISBN 978-950-9030-79-4
6DOXG3~EOLFD,$UDJHV\2UR]9DOHQWtQ,,/XFLRQL0DUtD&DUPHQ,,,7tWXOR
CDD 614
DERECHOS RESERVADOS
‹&RUSXV(GLWRULDO\'LVWULEXLGRUD
editorial@corpuslibros.com
jlemus@corpuslibros.com
www.corpuslibros.com
6XLSDFKD7HO)D[ 6/5. 5RVDULR$UJHQWLQD
)RWRGHWDSD$FWLYLGDGHVSULPLWLYDVGHDGPLQLVWUDFLyQHQOD$VLVWHQFLD3~EOLFDFLUFD
ISBN: 978-950-9030-79-4
Editores: Esteban Oscar Mestre
7LUDGDHMHPSODUHV
6HWHUPLQyGHLPSULPLUHQVHSWLHPEUHGH
Rosario - Argentina
No está permitida la reproducción total o parcial de esta
REUDQLVXWUDWDPLHQWRRWUDQVPLVLyQSRUFXDOTXLHUPHGLR
RPpWRGRVLQDXWRUL]DFLyQHVFULWDGHOD(GLWRULDO
NOTA
/D 0HGLFLQD HV XQD FLHQFLD HQ FRQVWDQWH GHVDUUROOR &RQIRUPH VXUMDQ QXHYRV FRQRFLPLHQWRV VH UHTXHULUiQ
FDPELRVGHODWHUDSpXWLFD/RVDXWRUHV\ORVHGLWRUHVVHKDQHVIRU]DGRSDUDTXHORVFXDGURVGHGRVL¿FDFLyQ
PHGLFDPHQWRVDVHDQSUHFLVRV\DFRUGHVFRQORVHVWDEOHFLGRVHQODIHFKDGHSXEOLFDFLyQ6LQHPEDUJRDQWHORV
SRVLEOHVHUURUHVKXPDQRV\FDPELRVHQODPHGLFLQDQLORVHGLWRUHVQLFXDOTXLHURWUDSHUVRQDTXHKD\DSDUWLFLSDGR
HQODSUHSDUDFLyQGHODREUDJDUDQWL]DQTXHODLQIRUPDFLyQFRQWHQLGDHQHOODVHDSUHFLVDRFRPSOHWD
&RQYHQGUtD UHFXUULU D RWUDV IXHQWHV GH GDWRV SRU HMHPSOR \ GH PDQHUD SDUWLFXODU KDEUi TXH FRQVXOWDU OD
KRMDGHLQIRUPDFLyQTXHVHDGMXQWDFRQFDGDPHGLFDPHQWRSDUDWHQHUFHUWH]DGHTXHODLQIRUPDFLyQGHHVWD
obra es precisa y no se han introducido cambios en la dosis recomendada o en las contraindicaciones para su
DGPLQLVWUDFLyQ(VWRHVGHSDUWLFXODULPSRUWDQFLDFRQUHVSHFWRDIiUPDFRVQXHYRVRGHXVRQRIUHFXHQWH7DPELpQ
deberá consultarse a los organismos de control de medicamentos de cada país para obtener información sobre
ORVYDORUHVQRUPDOHV\PHGLFDPHQWRVSHUPLWLGRVRUHFRPHQGDGRV
AUTORES
PROF. DR. JORGE DANIEL LEMUS
0pGLFR'RFWRUHQ0HGLFLQD\HQ6DOXG3~EOLFD
3RVGRFWRUDGRHQHO4XHHQV0HGLFDO&HQWHU7KH8QLYHUVLW\RI1RWWLQJKDP)HOORZVKLS
%ULWLVK&RXQFLO,QJODWHUUD
3URIHVRU7LWXODUGH(SLGHPLRORJtD)DFXOWDGGH0HGLFLQD86$/
3URIHVRU5HJXODU7LWXODUGH6DOXG3~EOLFD)DFXOWDGGH0HGLFLQD8%$
3URIHVRU7LWXODUGH6DOXG3~EOLFD'LUHFWRUGHO'HSDUWDPHQWRGH6DOXG&RPXQLWDULD
\GHOD'LSORPDWXUDHQ(SLGHPLRORJtD)DFXOWDGGH&LHQFLDVGHOD6DOXG8&(6
'LUHFWRUGHOD0DHVWUtDHQ$GPLQLVWUDFLyQGH6HUYLFLRVGH6DOXG8&(6
6HKDGHVHPSHxDGRFRPR'LUHFWRU*HQHUDO$GMXQWRGHÈUHDV3URJUDPiWLFDV 0&%$
\6XEVHFUHWDULRGH(VWDGRGH3URJUDPDV3ULRULWDULRV 06$6
,QYHVWLJDGRUGHO&21,&(7
'LUHFWRUGHO'HSDUWDPHQWRGH6DOXG3~EOLFD)DFXOWDGGH0HGLFLQD8%$
Presidente de la Sociedad Argentina de Administración de Organizaciones de Atención
GHOD6DOXG\6DOXG3~EOLFD$0$
Director del Hospital General de Agudos Juan A. Fernández*&$%$
En la actualidad Ministro de Salud del Gobierno de la Ciudad Autónoma de Buenos Aires
PROF. DR. VALENTÍN ARAGÜES Y OROZ
0pGLFR'LSORPDGRHQ(SLGHPLRORJtD\HQ6DOXG3~EOLFD
(VSHFLDOLVWDHQ&DUGLRORJtD(O6DOYDGRU\0HGLFLQD6DQLWDULD$0$
0DJtVWHUHQ$GPLQLVWUDFLyQGH6HUYLFLRVGH6DOXG8&(6
'LSORPDGRHQ'LUHFFLyQGH(PSUHVDVGH6DOXG 3URJUDPD',5(6 8QLYHUVLGDG$XVWUDO
3URIHVRU7LWXODUGHOD0DHVWUtDHQ$GPLQLVWUDFLyQGH6HUYLFLRVGH6DOXG8&(6
3URIHVRUGHOD&iWHGUDGH(SLGHPLRORJtD)DFXOWDGGH0HGLFLQD86$/
'RFHQWH$XWRUL]DGRGH6DOXG3~EOLFD3URIHVRUGHO'HSDUWDPHQWRGH6DOXG3~EOLFD)DFXOWDGGH0HGLFLQD8%$
0LHPEURGHOD&RPLVLyQ'LUHFWLYD6RFLHGDG$UJHQWLQDGH$GPLQLVWUDFLyQGH2UJDQL]DFLRQHV
GH$WHQFLyQGHOD6DOXG\6DOXG3~EOLFD&DStWXORGH(SLGHPLRORJtD$0$
0pGLFRGHOÈUHD3URJUDPiWLFD+RVSLWDO*HQHUDOGH$JXGRVJuan A. Fernández*&$%$
6HFUHWDULRGHO*UXSRGH7UDEDMRHQ(SLGHPLRORJtD\&RQWUROGH,QIHFFLRQHV
'LYLVLyQÈUHD3URJUDPiWLFD+RVSLWDO*HQHUDOGH$JXGRVJuan A. Fernández*&$%$
En la actualidad Director de Programas Centrales del Ministerio de Salud del Gobierno
de la Ciudad Autónoma de Buenos Aires
PROF. DRA. MARÍA CARMEN LUCIONI
0pGLFD'LSORPDGDHQ$GPLQLVWUDFLyQ+RVSLWDODULD\6LVWHPDVGH6DOXG\'RFWRUDHQ6DOXG3~EOLFD
3RVGRFWRUDGRHQHO4XHHQV0HGLFDO&HQWHU7KH8QLYHUVLW\RI1RWWLQJKDP,QJODWHUUD
3URIHVRUD$GMXQWDGH(SLGHPLRORJtD)DFXOWDGGH0HGLFLQD86$/
3URIHVRUD$GMXQWDGH6DOXG3~EOLFD'LUHFWRUDGHOD'LSORPDWXUDHQ6DOXG3~EOLFD\'LUHFWRUDGHO3RVJUDGR
HQ6DOXG6RFLDO\&RPXQLWDULD)DFXOWDGGH&LHQFLDVGHOD6DOXG8&(6
'RFHQWH$XWRUL]DGDGH6DOXG3~EOLFD)DFXOWDGGH0HGLFLQD8%$
Miembro de la Sociedad Argentina de Administración de Organizaciones de Atención de la Salud
\6DOXG3~EOLFD$0$
-HIDGH'LYLVLyQÈUHD3URJUDPiWLFD+RVSLWDO*HQHUDOGH$JXGRVJuan A. Fernández*&$%$
-HIDGHO'HSDUWDPHQWR7pFQLFR+RVSLWDO*HQHUDOGH$JXGRVJuan A. Fernández*&$%$
COLABORADORES
NÉLIDA COSATTINI
&31\/LFHQFLDGDHQ$GPLQLVWUDFLyQ8%$
3URIHVRUDWLWXODUGH,QWURGXFFLyQDOD$GPLQLVWUDFLyQ6DQLWDULDGHOD0DHVWUtDHQ$GPLQLVWUDFLyQ
GH6HUYLFLRVGH6DOXG8&(6
3URIHVRUD7LWXODU'LUHFFLyQ(VWUDWpJLFD,\,,GHOD/LFHQFLDWXUDHQ6HUYLFLRVGH6DOXG8&(6
3URIHVRUD7LWXODUGHOD)DFXOWDGGH&LHQFLDV(FRQyPLFDV8&(6\8QLYHUVLGDGGH%HOJUDQR8%
(YDOXDGRUDGHO3UHPLRDOD*HVWLyQGH&DOLGDGHQ6DOXGGHO*RELHUQRGHOD&LXGDGGH%XHQRV$LUHV
JAIME A. DE LA PARRA
Médico Neurocirujano
Médico Legista
3URIHVRU$GMXQWR6DOXG3~EOLFD,\,,8QLYHUVLGDG)DYDORUR
(['RFHQWHGH0HGLFLQD/HJDO\'HRQWRORJtD0pGLFD
*HUHQWH3UHVWDFLRQHV0pGLFDV3$0,
CARLOS DI PIETRANTONIO
Médico Especialista en Obstetricia y Ginecología
0DVWHUHQ6DOXG3~EOLFD'LSORPDGRHQ$GPLQLVWUDFLyQGH6HUYLFLRVGH6DOXG\*HVWLyQGHOD$36
7pFQLFRHQ(FRORJtD0pGLFD\6DOXG$PELHQWDO3URIHVRUGHOD8&(6
(['LUHFWRUJHQHUDOGH6DOXG0XQLFLSDOLGDGGH6DQ,VLGUR
Director general de Desarrollo y Capacitación de Personal de Salud GCABA
RICARDO DURLACH
Médico infectólogo. Doctor en Medicina
Director médico del Hospital Alemán
3URIHVRU3URWLWXODU\'LUHFWRUGHOD&DUUHUDGH(VSHFLDOLVWDGH(QIHUPHGDGHV,QIHFFLRVDVGHOD8QLYHUVLGDG
Católica Argentina
3UHVLGHQWHGHOD&RPLVLyQ'LUHFWLYDGHO,7$(6
MARIO GONZÁLEZ GONZÁLEZ
/LFHQFLDGRHQ0HGLFLQDH,QVSHFWRUGH,16$/8'
-HIHGHOD8QLGDG&RQWUDWDFLyQGH6HUYLFLRV6DQLWDULRVGHOD&RQVHMHUtD
$FWXDO*HUHQWHGHO+RVSLWDO8QLYHUVLWDULR&HQWUDOGH$VWXULDV
6HUYLFLRGH6DOXGGHO3ULQFLSDGRGH$VWXULDV
FERNANDO AXEL LEMUS
'LSORPDGRHQ6DOXG3~EOLFD)DFXOWDGGH&LHQFLDVGHOD6DOXG8&(6
Médico del Hospital General de Agudos Juan A. Fernández, GCBA
'RFHQWHGHO,QWHUQDGR5RWDWRULRHQ$36)DFXOWDGGH0HGLFLQD8%$
'RFHQWHGHOD&iWHGUDGH(SLGHPLRORJtD)DFXOWDGGH0HGLFLQD86$/
Docente del Departamento de Atención Primaria de Salud
)DFXOWDGGH0HGLFLQD,QVWLWXWR8QLYHUVLWDULR%DUFHOy
'RFHQWHGHOD&iWHGUDGH6DOXG3~EOLFD)DFXOWDGGH&LHQFLDVGHOD6DOXG8&(6
Miembro de la Sociedad Argentina de Administración de
2UJDQL]DFLRQHVGH$WHQFLyQGHOD6DOXG\6DOXG3~EOLFD$VRFLDFLyQ0pGLFD$UJHQWLQD
LORENA MARIEL MIRABILE
/LFHQFLDGDHQ&LHQFLDVGHOD&RPXQLFDFLyQ2ULHQWDFLyQ2SLQLyQS~EOLFD\'LVFXUVRSXEOLFLWDULR
)DFXOWDGGH&LHQFLDV6RFLDOHV8%$
'RFWRUDQGRÈUHDGH6DOXG3~EOLFD\&RPXQLFDFLyQHQ6DOXG)DFXOWDGGH0HGLFLQD8%$
3URIHVRUD$GMXQWD DF 6HPLQDULRGH&RPXQLFDFLyQ6RFLDO0HGLFLQD8&(6
3URIHVRUD$GVFULSWDDO'HSDUWDPHQWRGH+XPDQLGDGHV0pGLFDV)DFXOWDGGH0HGLFLQD8%$
-HIDGH7UDEDMRV3UiFWLFRV%LRpWLFD)DFXOWDGGH0HGLFLQD8%$
JUAN ORTIZ FUENTE
Médico Ginecólogo
([JHUHQWHGHO+RVSLWDO9DOOHGHO1DOyQ\'LUHFWRUGHO6HUYLFLRGH6DOXGGHO3ULQFLSDGRGH$VWXULDV
$FWXDO6XEGLUHFWRU*HUHQWHGHO+RVSLWDO8QLYHUVLWDULR&HQWUDOGH$VWXULDV
6HUYLFLRGH6DOXGGHO3ULQFLSDGRGH$VWXULDV
DELIA OUTOMURO
0pGLFD,QWHUQLVWD'RFWRUDHQ0HGLFLQD8%$
/LFHQ)LORVRItD8%$
3URIHVRUDUHJXODUDGMXQWDGH0HGLFLQD,QWHUQD)DFXOWDGGH0HGLFLQD8%$
&RRUGLQDGRUDGHOD8QLGDG$FDGpPLFDGH%LRpWLFD\
'LUHFWRUDGHO'HSDUWDPHQWRGH+XPDQLGDGHV0pGLFDV)DFXOWDGGH0HGLFLQD8%$
-HIDGH'HSDUWDPHQWRGH&RQVXOWRULRV([WHUQRVGHO+RVSLWDOPiñero, GCABA
GABRIELA TALONE
Médica Clínica
0pGLFD1HXUyORJD8QLYHUVLWDULD
0pGLFDGH3ODQWD6HUYLFLRGH1HXURORJtD+RVSLWDOSantojanni
'RFHQWH$GVFULSWD1HXURORJtD±8%$
-HIDGH7UDEDMRV3UiFWLFRV1HXURORJtD8&(6+RVSLWDO6DQWRMDQQL
ÍNDICE GENERAL
CAPÍTULO 1
Sistemas de servicios
y organizaciones de la Salud Pública / 21
Salud Pública Basada en la Evidencia / 22
Función / 22
Esencial / 22
Funciones esenciales de la Salud Pública / 22
Campo de la Salud / 23
Investigación en sistemas y servicios de Salud / 23
Modelos de atención / 26
Función de conducción / 28
Función de programación / 28
Función de gerencia / 29
Crecimiento de la inversión en Salud / 30
Supresión de prácticas ineficaces / 30
Gestión hospitalaria / 31
Recursos humanos / 31
Aspectos clave / 31
Áreas clínicas / 32
Organización, gestión y proceso de cambio / 35
Revisión del papel del Estado / 35
Homologación progresiva de la oferta
asistencial / 35
Tecnología de la información / 35
Ciudadanos más autónomos / 35
Fuertes presiones sobre las prácticas clínicas / 36
Aceleración del desarrollo tecnológico / 36
Mejora de la calidad de vida / 36
Evolución en la gestión de las instituciones de
Salud / 36
Gestión de pacientes y enfermedades / 37
Nueva arquitectura de los servicios / 37
Control social sobre los servicios públicos / 37
CAPÍTULO 2
Historia de la administración general
y sanitaria / 39
Introducción / 39
Escuela de la Administración científica / 39
Escuela de la Administración Industrial y general / 42
Escuela de las Relaciones Humanas / 44
Escuela neoclásica / 45
Escuela estructuralista o burocrática / 46
Escuela del comportamiento o de la Teoría
de la organización / 49
Escuela de la Teoría del
desarrollo organizacional / 55
Escuela del enfoque sistémico
de la administración / 56
CAPÍTULO 3
Principios de administración general / 61
¿Qué es la administración? / 61
Las organizaciones / 62
1. El planeamiento / 62
Tipos de planes / 63
Etapas de la planeación / 64
Horizonte de planeamiento / 65
Establecimiento de premisas / 65
2. La organización / 65
La división del trabajo / 65
Ventajas de la especialización en el trabajo / 65
Preocupaciones acerca de la
especialización / 65
Diseño del trabajo y del puesto / 65
Agrandamiento y enriquecimiento
del trabajo / 66
Organización y estructura organizacional / 66
El organigrama / 66
Estructura formal e informal
de la organización / 66
Coordinación / 68
Tramo de gerencia / 68
Diseño organizacional, ambiente externo
y estructura / 69
Ciclo de vida de las organizaciones / 69
Influencia, poder y autoridad / 70
Autoridad de línea y de staff / 70
Delegación / 71
Barreras para una efectiva delegación / 71
Centralización y descentralización / 71
El proceso de formación de la
dotación de personal / 72
Las organizaciones y el cambio / 72
Cultura de la organización / 73
El conflicto organizacional / 73
La creatividad organizacional / 74
3. La dirección / 74
Motivación / 74
Liderazgo / 74
Factores en la eficacia del liderazgo / 75
Grupos y comités / 75
Grupos formales / 75
Grupos informales / 75
Tipos de grupos formales de trabajo / 75
Importancia de la comunicación / 75
Comunicación interpersonal / 76
Barreras para una efectiva comunicación / 76
Clasificación de las comunicaciones / 76
4. El control / 77
Pasos del proceso de control / 77
Factores organizacionales que crean la
necesidad del control / 77
Tipos de métodos de control / 77
Puntos estratégicos de control / 78
Características de los sistemas
eficaces de control / 78
Controles financieros / 78
Información y control / 78
CAPÍTULO 4
Fundamentos de estructura
y diseño organizacionales / 79
Trasfondo: un océano de organizaciones / 79
Contrato psicológico / 80
Postulados de la teoría X / 81
Postulados de la teoría Y / 81
Organizaciones sistémicas / 83
Metáforas de la organización / 85
Toma de decisiones y sistemas de
racionalidad limitada / 88
Rutinas de defensa organizacional / 91
Ontogénesis organizacional y anatomía
estructural de la organización / 93
Mecanismos de coordinación / 97
Diseño organizativo / 99
Estructura, contexto y sistema técnico / 103
El hospital, ¿burocracia profesional
o meritocracia? / 104
Cuándo se desarrolla la organización
profesional / 107
Organizaciones supercomplejas / 107
Debilidades del organigrama: cortocircuitos,
atajos, incrustaciones / 108
El hiato entre el saber y el hacer / 111
Escenarios futuros en la arena hospitalaria / 115
CAPÍTULO 5
Gestión de objetivos
y poder en la organización / 117
Objetivos organizacionales / 117
1. Supervivencia / 117
2. Eficiencia / 119
3. Control / 120
4. Crecimiento / 120
5. La misión como objetivo de la organización / 121
6. Objetivos a la luz de la teoría de la dirección / 122
Un agente, un objetivo / 122
Un agente, varios objetivos / 122
Varios agentes, varios objetivos / 123
Varios agentes, ausencia de objetivos / 123
Política / 124
Poder / 125
Fuentes de poder / 131
¿De qué forma se ejerce el poder? / 131
Tipología del poder de French y Raven / 131
Poder racional o legal / 132
Poder de recompensa / 132
Poder coercitivo / 132
Poder referente / 132
Poder carismático / 132
Poder experto / 133
Estrategias femeninas / 133
Estrategias masculinas / 133
Juegos de poder / 133
Poder en el hospital / 138
¿Cuáles son los actores poderosos en el
ámbito del hospital? / 138
CAPÍTULO 6
Variables clave en la administración
de los sistemas de servicios y de las
organizaciones de atención de la salud / 141
La financiación / 141
Aspectos actuales del financiamiento de los
sistemas de salud / 141
El escenario de los cambios en la financiación / 141
Cambios en las fuentes de financiación / 142
Papel del estado en los cambios en el
financiamiento en los sistemas de salud / 143
Papel de los gobiernos en la coordinación y
regulación. Grupo de estudio de la OMS, 1993 / 143
Mecanismos de pago al proveedor / 143
Cambios en los mecanismos de pago / 144
Organización / 145
Reglamentación / 146
Comunicación Social / 146
CAPÍTULO 7
Gestión clínica: una nueva forma
de entender la gestión sanitaria / 147
Introducción / 147
La gestión compartida entre profesionales
sanitarios y gestores / 147
Gestión clínica y libertad clínica / 148
Definición de la gestión clínica / 151
Puntos básicos que hay que considerar ante
la gestión clínica / 151
La gestión por procesos / 152
Gestión del cambio / 154
Aspectos importantes a considerar en la
regulación legal de la gestión clínica / 155
Definiciones / 155
Funciones / 155
Sistemas de información / 156
Relación contractual / 156
Órganos de gobierno y gestión de las Áreas
o Unidades clínicas de gestión / 156
Funciones de los responsables / 157
Provisión del cargo de Director o Coordinador / 157
La Comisión de Dirección / 158
CAPÍTULO 8
Gestión presupuestaria y gestión
de costes en la organización / 159
Introducción / 159
Gestión del presupuesto / 161
Presupuesto maestro / 164
Presupuesto base cero / 164
Presupuesto por programas / 165
Ejecución del presupuesto / 166
Ejecución de ingresos / 166
Ejecución de gastos / 166
Principios de contabilidad analítica y costos
institucionales. Producto hospitalario / 167
Sobre los costes / 168
Clasificación de costos / 169
1. Con relación a los elementos que lo
forman / 169
2. Con relación al momento del cálculo / 169
3. Con relación a su posible asignación
mediata o inmediata / 169
4. Con relación a la variación del nivel de
actividad / 169
5. Con relación a la toma de decisiones / 170
Centros de costes / 171
Empresas profit y non profit / 171
Costes hospitalarios / 173
Coste marginal / 173
Margen de contribución / 174
Metodología de costeo institucional. Análisis
convencional. Costes directos e indirectos / 175
Etapas para el control de gestión / 177
Analítica metodológica / 177
Producto hospitalario / 180
Sistema de clasificación de pacientes / 184
Técnicas de medición del case mix / 185
1. Sistemas de case mix basados en la CIE / 185
2. Sistemas de case mix basados en criterios
de utilización / 186
3. Sistemas de case mix que evalúan la
gravedad / 186
4. Sistemas de case mix que cuantifican el
consumo de recursos / 186
Importancia de los GRD / 186
Lecciones de Cataluña: parámetros de
contratación y sistema de pago por línea de
producto / 189
Nuevas tendencias en la
contratación de servicios / 190
ANEXO 1
Minuta sobre elaboración de presupuesto.
Ministerio de Salud. Gobierno de la Ciudad
de Buenos Aires / 193
ANEXO 2
Clasificador por objeto del gasto / 197
CAPÍTULO 9
Gestión jurídico legal en organizaciones
de atención de la salud / 223
Introducción. Generalidades de los
aspectos legales en instituciones de Salud.
Los imperativos éticos / 223
Responsabilidad médica / 227
La responsabilidad del hombre:
ser racional y responsable / 227
Aspectos históricos de la
responsabilidad médica / 228
La responsabilidad profesional / 229
La llamada responsabilidad médica. Concepto
de culpa. Formas / 229
Impericia / 230
Imprudencia / 230
Negligencia / 230
Inobservancia de obligaciones
y deberes a su cargo / 230
Otros tipos de responsabilidad / 231
Responsabilidad prestacional y legal de la
Auditoría médica dentro de las instituciones
de Salud / 231
Obligación jurídica de obrar / 233
El contrato médico / 235
Efectos o implicancias de la obligación asumida / 236
La reparación por la responsabilidad médica / 237
La carga de la prueba / 238
Presunciones de culpa / 238
Eximentes de la culpabilidad / 239
Responsabilidad compartida / 239
El seguro médico / 240
Consentimiento informado / 241
Aspectos instrumentales / 241
La historia clínica. Importancia médico legal / 241
Historia clínica informatizada. El futuro / 242
Certificados / 243
Defunción / 243
Nacimiento / 243
Prenupcial / 243
Alienación mental / 243
Certificado de cremación / 243
Certificado de atención / 243
Vacunas / 243
Traslado al exterior de incapaces / 243
Certificados de demencia / 244
Los comités de Bioética / 244
Breve sinopsis de aspectos institucionales básicos
obligatorios en instituciones médicas / 245
Derecho a las prestaciones de salud / 245
Las empresas o instituciones de salud / 245
Obligaciones básicas y comunes de las
empresas de salud. Ley 17.132 / 246
Espectro de las responsabilidades de las
instituciones de salud / 247
Autorizaciones para prácticas o ingresos a
internación / 248
Admisión. Penalidades derivadas
por mal accionar / 249
Área o Departamento de Urgencia / 250
Pautas o criterios básicos que deben
cumplirse / 250
Ley de Protección contra violencia familiar / 253
Egresos / 253
Servicio de Hemoterapia / 254
Maternidad / 254
Ley 24540 (mod. 24884). Régimen
identificación recién nacido / 254
Morgue / 254
Ley de SIDA Nº 23798 / 255
Decreto reglamentario / 255
Conflictos ético legales al fin de la vida / 255
Eutanasia / 255
Decisión de mantener o finalizar un tratamiento
en pacientes con enfermedades neurológicas
irreversibles. Implicancias legales / 258
Estado vegetativo persistente / 260
Demencia / 262
Ética y costes frente a la muerte / 263
Colofón / 264
CAPÍTULO 10
Gestión de recursos humanos e incentivos
en la organización de Salud / 265
Introducción / 265
El recurso humano en los procesos
de reforma del sector / 266
Tendencias en el mercado de trabajo / 267
El particular escenario hospitalario / 269
Perfiles profesionales / 271
Gestión del desempeño / 272
Motivación / 273
Formas de compensación e incentivos / 274
Qué son, cómo funcionan y cómo no
funcionan los incentivos / 275
ANEXO 1
Comentarios sobre el estudio Hawthorne:
la sociología organizacional en la liza / 281
CAPÍTULO 11
El Centro de Salud y
el Hospital en la APS / 285
Aspectos generales / 285
Instituciones de Salud / 288
El Hospital / 288
Funciones clínicas / 289
Funciones de los servicios de
asistencia a los clínicos / 289
Funciones de los departamentos
de apoyo / 290
Hospital de alta resolución / 291
El Centro de Salud / 291
El equipo interdisciplinario de Salud / 293
Estrategias de extensión de la cobertura / 295
1. El criterio multisectorial / 299
2. Participación comunitaria / 300
3. Tecnología apropiada para la salud / 300
Son elementos principales que
caracterizan a la Atención Primaria
de la Salud / 301
CAPÍTULO 12
Gestión de los Sistemas de información
en la organización de Salud / 305
Bosquejo introductorio / 305
El continuo hechos - datos - información
y los dispositivos organizacionales
para generar información / 306
Obstáculos para adquirir información / 309
Sistemas de información en los SILOS
y las regiones sanitarias / 310
SILOS / 314
APS / 315
Información en el ámbito hospitalario / 316
Rol estratégico de la información / 317
Adquisición y administración del conocimiento
sumergido en inmensas bases de datos:
minería de datos / 321
Pasos en el análisis KDD / 325
Técnicas de KDD / 327
1. Análisis de carro de supermercado o de
asociación (Market basket analysis) / 327
2. Razonamiento basado en la memoria
(memory based reasoning) / 330
3. Análisis cluster (cluster analysis) / 330
4. Análisis de vínculos (link analysis) / 332
5. Árboles de decisión (decition trees) / 332
Data mining en salud / 334
CAPÍTULO 13
Sistemas de información
georreferencial / 345
Espacialidad y cartografía / 345
Escala / 349
Distancia / 349
Altura / 349
Orientación / 350
Localización / 350
¿Qué es precisamente un Sistema de
Información Geográfica (SIG)? / 350
Aplicaciones potenciales de los SIG en Salud,
Epidemiología y gestión del conocimiento
en organizaciones de salud / 351
Soft disponible para análisis SIG / 356
ANEXO 1
Expresión georreferenciada de diversos
problemas y eventos de salud / enfermedad / 361
ANEXO 2
Sistemas de Información Georreferencial y su
utilidad en el análisis de la regionalización sanitaria
de la Ciudad Autónoma de Buenos Aires / 365
CAPÍTULO 14
Medidas del rendimiento institucional.
Indicadores y benchmarking / 377
Definición y utilidad de los indicadores / 377
Validez / 378
Fiabilidad / 378
Confección de indicadores según la JCAHO / 378
Tipos de indicadores / 382
Indicadores negativos de calidad / 382
Evento centinela / 382
¿Qué se espera de la entidad
en caso de un EC? / 383
Indicador tipo número absoluto / 384
Indicadores tipo proporción, porcentaje y tasa / 384
Indicadores tipo media / 384
Indicadores tipo ratio o razón / 384
Indicadores compuestos / 385
Indicadores compuestos simples / 386
Indicadores compuestos complejos / 388
Benchmarking (referenciamiento) / 390
Los reportes de Bristol y Matillon / 390
Metodologías / 391
Fase de Planificación / 391
Fase de Análisis / 392
Benchmarking en salud / 393
Nivel de comparación / 394
Nivel de evaluación / 394
Foco de la medición / 394
Uso de los datos de benchmarking / 395
Limitaciones de los datos existentes / 395
Sobre los indicadores compuestos / 396
La necesidad de buenos sistemas
de información de salud / 397
Bajando a la práctica. Benchmarking
internacional / 397
La OMS / 398
El Fondo Commonwealth / 399
Sistemas nacionales de Benchmarking / 399
Reino Unido / 399
Canadá / 399
Francia / 399
ANEXO 1
Indicadores utilizados con mayor frecuencia
en la evaluación epidemiológica de programas
y actividades hospitalarias / 401
ANEXO 2
Indicadores básicos de estandarización.
Hospitales Públicos de Autogestión / 413
CAPÍTULO 15
Tablero de Comando en Salud / 417
Introducción / 417
Gestión de la información / 417
Cubos OLAP (On-Line Analytic Processing) / 418
El origen del Tablero de Comando / 419
¿Para qué sirve un Tablero de Comando? / 420
Componentes de un Tablero de Comando / 421
Las perspectivas del Tablero de Comando / 421
El Tablero de Comando en la gestión de Salud / 421
El Mapa estratégico / 423
Los Indicadores / 423
Clasificación genérica de los indicadores / 424
Las Metas / 426
Las Acciones / 426
Cómo implantar un Tablero de Comando / 427
Comentario final / 428
CAPÍTULO 16
Marketing y Comunicación
en organizaciones sanitarias / 429
Introducción / 429
¿De qué hablamos cuando hablamos de
Comunicación Social? / 429
Una aproximación al concepto
de comunicación / 429
Áreas de la Comunicación Social / 430
1. Políticas y planificación
de la comunicación / 430
2. Periodismo / 430
3. Comunicación y Educación / 430
4. Opinión Pública y Publicidad / 430
5. Comunicación comunitaria / 431
¿Cómo se insertan las Ciencias de la
Comunicación en la Salud Pública? / 431
Comunicación en Salud:
de lo teórico a lo práctico / 431
Promoción de la Salud / 432
¿Cómo nace la Promoción de la Salud? / 433
¿Qué son los Programas de Promoción
de la Salud y los Programas de
Comunicación en Salud? / 435
Una ayuda de Von Clausewitz:
los conceptos de táctica y estrategia / 435
Elementos de la estrategia / 435
¿Qué determina una buena estrategia? / 436
Programas de Salud Pública / 437
¿Qué es un Programa de
Promoción de la Salud? / 437
¿Qué es un Programa de Promoción
de la Salud según Von Clausewitz? / 437
¿Qué es un Programa de
Comunicación en Salud? / 439
Ejemplo paradigmático de PPS:
El caso Karelia del Norte / 439
Breve resumen / 439
El caso Karelia del Norte, paso a paso / 440
La batalla contra el colesterol elevado / 442
La batalla contra la presión alta / 443
La batalla contra el tabaquismo / 444
Unas pocas líneas para finalizar / 445
CAPÍTULO 17
Control organizacional de la calidad.
Auditoría médica / 447
La naturaleza polisémica de la calidad / 447
Fases en el control de calidad de las empresas / 449
1. La calidad como sinónimo de
excelencia de los protagonistas / 450
2. Desarrollo de la calidad a través de la
inspección (siglo XIX) / 450
3. Control estadístico del proceso (circa 1930) / 450
4. Aseguramiento de la calidad (circa 1950) / 451
5. Gestión de la Calidad Total (circa 1990) / 451
Calidad en atención de la salud / 452
Objetos del control de calidad en salud / 453
1. Hacer lo correcto / 454
2. Hacer lo correcto correctamente / 454
Aseguramiento de la calidad
y mejora de la calidad / 455
La inflexión de Avedis Donabedian / 456
Auditoría médica como paradigma
de control de calidad en salud / 462
Terrenos comunes de las definiciones / 463
Topología y naturaleza de la auditoría médica / 463
Bosquejo histórico del desarrollo de la
garantía de calidad y la auditoría médica / 465
Comienzos y sesgos en Argentina / 466
Pasos en el diseño de una auditoría / 467
Selección de un tópico para auditar / 467
Identificación de objetivos específicos / 469
Especificación de criterios y estándares / 469
¿Para qué se necesita un estándar? / 470
Recogida de datos / 471
Análisis de datos y comparación
con criterios y estándares / 471
Acuerdo e implementación del cambio / 471
¿Cómo puede superarse la resistencia
al cambio? / 472
Estrategias para implementar
el cambio-devoluciones / 473
CAPÍTULO 18
Infecciones asociadas al
cuidado de la salud / 479
Fundamentos / 480
Definiciones (NHSN, 2005) / 480
Objetivos de un programa hospitalario
de vigilancia y control de las infecciones / 481
Tipos de vigilancia / 482
Indicadores / 483
Sistemas de Vigilancia de las IACS / 484
Control del consumo de antibióticos / 484
Cálculo del consumo en DDD / 485
Vigilancia de los microorganismos / 485
Comité de control de infecciones (CCI) / 485
Higiene de las manos / 486
Personal de la salud / 487
Prácticas inefectivas en IACS / 487
El costo de la infección asociada
al cuidado de la salud / 487
Los costos específicos de la
infección hospitalaria / 488
Metodología para el abordaje del estudio / 489
Costos derivados de la infección hospitalaria / 490
Estándares de seguridad institucional
dirigidos a la vigilancia, prevención y control
de las infecciones / 491
CAPÍTULO 19
El raciocinio epidemiológico
en la organización de salud / 493
Epidemiología en SILOS, regiones sanitarias,
hospitales y centros de salud / 494
Grandes campos de aplicación de la Epidemiología
en los servicios organizacionales / 495
1. Estudios de situación de salud
en diferentes grupos de población,
determinantes y tendencias / 496
2. Vigilancia epidemiológica de enfermedades
y otros problemas en salud / 496
3. Investigación causal y explicativa sobre
problemas prioritarios de salud. Evaluación
del impacto de salud de los servicios y otras
acciones sobre las personas, medio ambiente
y condiciones de salud / 497
4. Evaluación del impacto en salud de los
servicios y otras acciones sobre las personas,
medio ambiente y condiciones de vida, y la
evaluación de tecnología en función de su
seguridad e impacto / 498
Barreras a la introducción de la inteligencia
epidemiológica en los servicios / 498
Actividades epidemiológicas y función del
epidemiólogo en el hospital / 500
Actividades del epidemiólogo
en el hospital base / 501
1. Análisis de la situación de salud / 501
2. Intervención en las acciones
del área programática / 502
3. Producción de conocimiento básico
para actividades y programas / 502
4. Apoyo a la organización de los servicios
y a la gestión administrativa / 502
5. Control de las patologías
infectocontagiosas tanto en el ámbito
intramural como extramural
(brotes epidémicos) / 503
6. Evaluación de la tecnología apropiada / 503
7. Salud ambiental / 503
8. Coordinar actividades del equipo
interdisciplinario y contribuir a una activa
participación comunitaria / 504
9. Investigación / 504
10. Docencia / 504
Recomponer el espacio epidemiológico / 504
CAPÍTULO 20
Herramientas epidemiológicas
para la organización sanitaria / 507
Población y Técnicas de Muestreo / 507
Tipo de estudio / 508
Estrategia de muestreo / 508
Técnicas de recolección de datos / 511
Instrumentos tradicionales
de medición epidemiológica / 511
Medidas de ocurrencia de eventos
o problemas de salud / 512
Medidas de asociación o riesgo / 515
Medidas de significación estadística / 516
Errores potenciales de los estudios / 517
Validez y Confiabilidad / 518
Pruebas / 519
Instrumentos estratégicos de la Epidemiología / 522
1. Estrategia de trazadores / 523
2. Estrategia de unidades
geográfico-poblacionales / 524
3. Estrategia de vigilancia centinela / 524
4. Estrategia de estudios de escenarios
o nichos socioecológicos / 524
5. Estrategia de mapas inteligentes / 525
6. Estrategia de evaluaciones
epidemiológicas rápidas / 525
7. Estrategia de conglomerados (clusters) / 526
8. Estrategia de instrumentos de priorización
de riesgos e intervenciones / 526
9. Paquetes informáticos especializados / 526
Endemias y Epidemias. Estudio de
brotes epidémicos / 528
Definición del caso / 532
Confirmación de brote epidémico / 532
Etapas de la investigación
epidemiológica de un brote / 534
Etapa descriptiva / 534
Etapa analítica / 537
Etapa de intervención (experimental) / 540
Screening / 541
Metanálisis / 542
Addenda: Estudio de brotes / 544
Primera parte: Introducción / 544
Segunda parte: Definición de caso / 545
Tercera parte: Elección de controles / 545
Cuarta parte: Perfil de casos,
tasa de ocurrencia / 545
Quinta parte: Epidemiología descriptiva / 546
Sexta parte: Comparación de casos y
controles. Lugar de residencia / 546
Séptima parte: Comparación de casos
y controles. Higiene y estado
sanitario del medio / 547
Octava parte: Programación de actividades
de intervención en el SILOS / 547
CAPÍTULO 21
Actividades preventivas
en las organizaciones de salud / 549
Trasfondo / 549
¿Cuál es el sentido de intervenir? / 549
Salud y enfermedad / 551
Pequeños riesgos diseminados:
un gran problema sanitario / 553
Prevención individual vs.
estrategia de alto riesgo / 554
Diagnóstico precoz e historia natural
de la enfermedad / 556
Individuos y Poblaciones / 557
¿Qué puede considerarse normal? / 558
Colofón / 559
CAPÍTULO 22
Gestión por procesos / 561
Introducción / 561
Gestión por procesos / 563
Métodos para la identificación de procesos / 564
Método estructurado / 564
Método creativo / 564
Implementación de la Gestión por procesos / 565
Consecuencias / 568
CAPÍTULO 23
Planificación y
programación sanitarias / 569
Prolegómenos y trasfondo / 569
Triángulo de gobierno / 571
Políticas y función públicas / 573
Planificación estratégica / 575
Tipos de planificación / 576
Programación sanitaria / 577
Identificación de problemas / 580
Priorización / 583
Enfoques y Métodos de identificación
de problemas y necesidades de salud / 584
Enfoque por indicadores / 584
Técnicas de identificación de problemas / 584
Priorización cualitativa / 585
Preprogramación y Programación / 585
Desarrollo del plan del programa / 585
Objetivos / 586
Funciones de los objetivos / 586
Formulación del objetivo / 586
Productividad de los recursos / 586
Eficacia potencial o teórica
de los recursos (potency) / 588
Elementos técnicos: el plan de operaciones / 588
Evaluación del programa / 588
Propósitos de la evaluación
y cuestiones conexas / 593
Evaluación para la responsabilidad / 594
Evaluación para el desarrollo / 594
Evaluación para el conocimiento / 594
Actividades generales de evaluación / 595
Conceptualización y diseño / 595
Pasos a considerar en el diseño
de programas / 595
Dirección y responsabilidad en la
implementación / 597
Valoración de la utilidad del programa / 598
Indicencia de la política en la evaluación / 598
Acotación y contextualización / 599
Administración estratégica / 601
CAPÍTULO 24
Investigación, docencia y Bioética en
organizaciones de atención de la salud / 605
Bioética en investigación clínica / 605
Introducción / 605
Los abusos y los intentos de regulación:
algunos antecedentes históricos / 605
Tipos de comités de Ética / 607
Comités de Ética:
regulación normativa en Argentina / 609
A. A nivel nacional / 609
B. A nivel provincial / 610
C. A nivel municipal / 611
Administración Nacional de Medicamentos,
Alimentos y Tecnología Médica (ANMAT) / 615
Análisis FODA de la ética
en investigación en Argentina / 616
Las fortalezas / 617
Las debilidades / 617
Las amenazas / 618
Las oportunidades / 618
Algunas estrategias frente a las
debilidades y amenazas de la ética
en investigación / 619
Conclusiones / 620
Medicina y docencia en Bioética:
fundamentos y estrategias / 620
Introducción / 620
Antecedentes filosóficos
del modelo médico hegemónico / 621
Estrategia para el cambio:
la enseñanza de las humanidades médicas / 621
Perfil de la enseñanza de la Bioética
en una universidad pública / 622
Una propuesta pedagógica con eje
en la Bioética / 623
A. Labor docente en el grado / 624
B. Labor docente en el posgrado / 625
C. Labor docente en
extensión universitaria / 629
Conclusión / 631
BIBLIOGRAFÍA / 633
ÍNDICE ANALÍTICO / 655
PRÓLOGO
El creciente interés que la salud y su atención despiertan en las sociedades modernas, el avasallante avance
de la tecnología, los costos crecientes y la importancia que hoy se concede a la equidad como condición para la
gobernabilidad hacen de la Administración Sanitaria un área prioritaria en nuestros años.
Bienvenido, en consecuencia, este esfuerzo de Lemus, Aragües y Oroz y Lucioni en este nuevo emprendimiento, dada la movilidad que caracteriza a este área en función de los cambios sociales, las experiencias
concretadas y los resultados alcanzados.
Y es que por la misma índole de su objetivo, la atención de la salud y la enfermedad requiere el mejor resultado
PHGLDQWHXQDySWLPDFRPELQDFLyQGHUHFXUVRVD¿QGHVDWLVIDFHUWDQWRODVQHFHVLGDGHV\H[SHFWDWLYDVLQGLYLGXDles como colectivas, y las exigencias que supone un margen de recursos siempre escasos.
Si repasamos la bibliografía sobre el tema podemos observar cómo, a través de los años, los textos de AdmiQLVWUDFLyQ6DQLWDULD\+RVSLWDODULDYDQUHÀHMDQGRVXFUHFLPLHQWR\SHUIHFFLRQDPLHQWR\FyPRGHVGHWULEXWDULDGH
otras disciplinas como la economía, la administración general o la sociología, fue madurando y desarrollando su
actividad con luz propia, incorporando conocimientos y técnicas de aquellas áreas pero generando su identidad a
través de experiencias y objetivos propios.
Adoptando una visión panorámica de la evolución en nuestro país y tomando los últimos cincuenta años –a
partir de la creación de la Escuela de Salud Pública de la UBA– resulta interesante recordar que los primeros
textos utilizados fueron importados: el de Hanlon, en su tercera edición traducida de 1960, y Principios de Administración Sanitaria, del querido maestro Gustavo Molina, publicado en 1961 y presentado poco después entre
nosotros (1962), por el propio autor.
Pocos años después comenzaron a aparecer nuestros textos, fruto del acontecer argentino, conformando una
valiosa colección, ya que enfocan los problemas de la salud y la enfermedad a través de nuestra experiencia y
nuestros problemas, así como en función del desarrollo que la Administración Sanitaria ha ido adquiriendo en las
últimas décadas.
Y es importante este acontecer –al que se suma este texto–, ya que contribuye a acercar el conocimiento
básico, que es un insumo crítico a la voluntad y las decisiones políticas y a la estrategia en la aplicación de los
programas. Ambas instancias, sumadas a la experiencia que proporciona la realidad, constituyen la fórmula que
posibilitará el logro de los objetivos que se propongan los responsables del desarrollo del sector.
El libro que hoy presentan Lemus, Aragües y Oroz y Lucioni se inscribe en esta línea y constituye un llamativo
esfuerzo dado que propone una amplia y compleja visión del panorama sanitario. La simple revisión de su contenido permite apreciar la amplitud de los temas analizados así como la complejidad de los sujetos tratados que
van desde conceptualizaciones seminales hasta aspectos estratégicos y tácticos que hacen a la práctica diaria,
señalando la amplitud y la profundidad de los enfoques que presentan al lector.
Este amplio registro de los temas considerados, visible en los distintos capítulos, permite una visión panorámica del espectro de la atención, que transita desde los aspectos y conceptos más generales a los más concretos y
que incluye, además de los temas tradicionales, otros más recientes como son los que hacen a la gestión clínica,
el tablero de comando y el enfoque georreferencial de indudable vigencia futura, lo que resulta especialmente
interesante en la administración hospitalaria, destino del grueso de los fondos del Sector Público.
Por tratarse de un tema de gran actualidad y de importancia futura, creemos necesario señalar el enfoque de
la atención primaria asociada al hospital, conformando un sistema único y no como subsistemas contrapuestos,
FRQ¿UPDQGRODVH[SHULHQFLDVSRVLWLYDVGHOp[LWRGHDTXHOORVSURJUDPDVGHDWHQFLyQSULPDULDSUHFLVDPHQWHFXDQGRVRQHQIRFDGRVHQXQVLVWHPDGHDWHQFLyQXQL¿FDGRTXHLQFOX\HDORVHVWDEOHFLPLHQWRVKRVSLWDODULRV
El amplio espectro de temas tratados explica la diversidad de los autores –argentinos y españoles– de distinta
formación y ámbito de trabajo, pero expertos todos ellos en cada una de las áreas tratadas y que unen a su conocimiento una amplia experiencia por su trayectoria profesional.
Quede pues este texto de Administración Hospitalaria y de organizaciones de la Atención de la Salud, de
Lemus, Aragües y Oroz y Lucioni, como un destacado aporte a la bibliografía argentina sobre este área, que se
suma a las publicaciones aparecidas en los últimos años y que esperamos contribuya a la instauración de una
DWHQFLyQH¿FLHQWHGHDOWDFDOLGDGHTXLWDWLYD\UHVSHWXRVDGHODFRQGLFLyQKXPDQDSDUDWRGRVORVKDELWDQWHVGH
nuestro país.
ACADÉMICO ABRAAM SONIS
1
SALUD PÚBLICA, SISTEMAS DE SERVICIOS
Y ORGANIZACIONES DE LA SALUD PÚBLICA
El concepto de Salud Pública tiene en la actuaOLGDG XQ HQIRTXH LQWHJUDO H LQWHJUDGR VRVWHQLpQGRVHTXHHODGMHWLYRpúblicaQRVLJQL¿FDXQ
FRQMXQWR GH VHUYLFLRV HQ SDUWLFXODU QL XQD IRUPDGHSURSLHGDGQLXQWLSRGHSUREOHPDVVLQR
XQQLYHOHVSHFt¿FRGHDQiOLVLVDVDEHUXQQLYHO
SREODFLRQDO$GLIHUHQFLDGHODPHGLFLQDFOtQLFD
TXHRSHUDDXQQLYHOLQGLYLGXDO\GHODLQYHVWLJDFLyQELRPpGLFDTXHDQDOL]DHOQLYHOVXELQGLYLGXDOODHVHQFLDGHOD6DOXG3~EOLFDFRQVLVWHHQ
TXHDGRSWDXQDSHUVSHFWLYDEDVDGDHQJUXSRVGH
JHQWHRSREODFLRQHV(VWDSHUVSHFWLYDSREODFLRnal inspira sus dos aplicaciones:
‡&yPRFDPSRGHOFRQRFLPLHQWR
‡&yPRiPELWRSDUDODDFFLyQ
3RU HOOR HV LPSRUWDQWH VHxDODU TXH OD 6DOXG
3~EOLFDLPSOLFDXQFDPSRGHFRQRFLPLHQWRV\
SDUWLFXODUPHQWHGHSUiFWLFDSRVLEOHGHGHOLPLtarse y de organizarse como tal. La Salud Pública no es una ciencia o una disciplina. Los conoFLPLHQWRVTXHUHTXLHUHSDUDVXVWHQWDUVXSUiFWLFD
VRQSURYLVWRVSRUGLYHUVDVGLVFLSOLQDVDUWLFXODGDVHQIXQFLyQGHVXREMHWLYR(VDDUWLFXODFLyQ
GHOFRQRFLPLHQWRHQIXQFLyQGHVXXVR SUiFWLFD HQ XQD GLPHQVLyQ LQWHUGLVFLSOLQDULD HV OD
HVHQFLDHSLVWHPROyJLFDGHODVDOXGS~EOLFDTXH
SXHGHWUDVFHQGHUDYHFHVDODVGLVFLSOLQDVTXH
OD VLUYHQ SHUR VLQ FRQVWUXLU XQD GLVFLSOLQD HVSHFt¿FD/DDUWLFXODFLyQGHOFRQRFLPLHQWRH[LJH
un instrumento o método; la Salud Pública puede utilizar GLIHUHQWHV GLVFLSOLQDV GHSHQGLHQGR
GHOREMHWLYR\SUiFWLFDHVSHFt¿FRVHQFRQVLGHUDFLyQ8QD disciplinaVLQHPEDUJRSDUHFHWHQHU
una presencia y potencial mayor en la Salud PúEOLFDVLUYLHQGRIUHFXHQWHPHQWHDHVHSURSyVLWR
OD(SLGHPLRORJtD8QDHSLGHPLRORJtDDPSOLDGD
WDPELpQ HQ VX REMHWLYR GH HVWXGLR LQFOX\HQGR
todos los condicionantes y aspectos de la salud y
no sólo las enfermedades. Poseyendo un campo
de conocimiento y siendo un campo de práctiFDODVDOXGS~EOLFDVHFRQVWLWX\HHQXQFDPSR
GHJHQHUDFLyQGHFRQRFLPLHQWRTXHHQULTXHFHD
ODVGLVFLSOLQDQTXHODVLUYHQ 236 )UHQN
GH¿QH OD nueva Salud Pública como planteánGRVHXQHVIXHU]RVLVWHPiWLFRSRULGHQWL¿FDUODV
QHFHVLGDGHV GH VDOXG \ RUJDQL]DU VHUYLFLRV VDnitarios globales con una base poblacional bien
GH¿QLGD$EDUFD SXHV HO SURFHVR GH LQIRUPDción necesario para caracterizar las patologías
GH OD SREODFLyQ \ D OD PRYLOL]DFLyQ GH ORV UHcursos necesarios para responder a ellas. Por lo
WDQWRLQFOX\HRUJDQL]DUDOSHUVRQDO\ODVLQVWDODFLRQHVGHSUHVWDFLyQGHORVVHUYLFLRVVDQLWDULRV
UHTXHULGRVGHSURPRFLyQGHODVDOXGSUHYHQFLyQ
GHODHQIHUPHGDGGLDJQyVWLFR\WUDWDPLHQWRGH
ODVHQIHUPHGDGHV\UHKDELOLWDFLyQItVLFDVRFLDO
y profesional.
'HQWUR GH OD QXHYD FRQFHSWXDOL]DFLyQ GH OD
6DOXG3~EOLFDHVTXHOD236206KDHODERUDGR
XQDDSUR[LPDFLyQDODV)XQFLRQHV(VHQFLDOHVGH
6DOXG 3~EOLFD TXH RIUHFH OD RSRUWXQLGDG SDUD
DQDOL]DUORVLGHDOHVGHVDOXGGHODVRFLHGDGORV
SULQFLSDOHV UHWRV D HQIUHQWDU \ ORV UHVSHFWLYRV
FDPSRVGHDFFLyQSDUDDOFDQ]DUORVDVtFRPRODV
responsabilidades correspondientes a los actores
LQYROXFUDGRVHQODVRFLHGDGHQVXFRQMXQWRFRQ
HVSHFLDO UHIHUHQFLD D OD UHGH¿QLFLyQ GHO URO GHO
Estado en materia de salud. El sector salud se
FDUDFWHUL]DDFWXDOPHQWHSRUODIDOWDGHHTXLGDG
HQHODFFHVRDORVVHUYLFLRVS~EOLFRVODIDOWDGH
FRRUGLQDFLyQHQWUHODVLQVWLWXFLRQHVORVVXEVHFWRUHV \ ORV VHFWRUHV QDFLRQDOHV OD LQH¿FLHQWH
DVLJQDFLyQGHORVHVFDVRVUHFXUVRVGLVSRQLEOHV\
22 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
ODIDOWDGHVRVWHQLELOLGDG¿QDQFLHUD/RVFDPELRV
GHPRJUi¿FRV HSLGHPLROyJLFRV \ HO GHVDUUROOR
WHFQROyJLFR VHFWRULDO RIUHFHQ QXHYDV SRVLELOLGDGHV SDUD PHMRUDU HO LPSDFWR GH ORV VHUYLFLRV
sobre el problema de salud.
SALUD PÚBLICA BASADA EN LA EVIDENCIA
/RVHQIRTXHVSULRULWDULRVGHULYDQGHODD¿UPDción de la salud como derecho humano fundamentalGHODequidadFRPRH[SUHVLyQGHMXVWLFLDVRFLDOGHTXHODVDOXGRFXSHXQlugar central
en el desarrollo\GHODética como rectora de
todas las acciones de salud pública y las relaciones entre políticas económicas y políticas sociaOHVDVtFRPRODVSROtWLFDVODLQYHVWLJDFLyQ\OD
SUHVWDFLyQGHORVVHUYLFLRVGHVDOXG
Se hace necesaria una “salud pública basaGDHQHYLGHQFLDV´HVGHFLUODXWLOL]DFLyQFRQVFLHQWH\PLQXFLRVDGHODPHMRUHYLGHQFLDDFWXDO
como soporte para la toma de decisiones en las
LQWHUYHQFLRQHVGLULJLGDVDODSREODFLyQ\JUXSRV
SREODFLRQDOHV TXH SDUD -HQLFHN FRPSUHQGHUtD
los siguientes pasos:
- formulación de una cuestión clara sobre un
SUREOHPDGHVDOXGFROHFWLYD
E~VTXHGDGHHYLGHQFLDV
HYDOXDFLyQGHHVWDVHYLGHQFLDV
VHOHFFLyQGHODPHMRUHYLGHQFLDSDUDODGHFLsión en salud pública
UHODFLRQDUODHYLGHQFLDFRQODH[SHULHQFLDHO
conocimiento y la práctica de la salud pública
LPSOHPHQWDFLyQGHHYLGHQFLDVXWLOL]DEOHVHQ
OD SUiFWLFD GH OD VDOXG S~EOLFD SROtWLFDV \
SURJUDPDV
HYDOXDFLyQGHWDOHVLPSOHPHQWDFLRQHV\GHOD
ejecución global de la práctica de una salud
S~EOLFDEDVDGDHQHYLGHQFLDV
- enseñar a otros la práctica de una salud públiFDEDVDGDHQHYLGHQFLDV
Dentro de esta conceptualización podría de¿QLUVH
Función
&RQFHSWR TXH KDFH UHIHUHQFLD D XQ TXHKDFHU
XQ SDSHO RULHQWDGR D XQ SURSyVLWR R ¿QDOLGDG
GH¿QLGRV$OXGH D XQ HQWH R VXMHWR D TXLHQ VH
DWULEX\H R VH UHVSRQVDELOL]D HO FXPSOLPLHQWR
GHXQDIXQFLyQGDGDDVtFRPRDXQREMHWRDOTXH
se dirige u orienta la acción del ente. Con otras
SDODEUDV ODV IXQFLRQHV VH XELFDQ HQ HO SODQR
de las relaciones entre ente y objeto. Se asume
FRPRHQWHDODVRFLHGDGGHQWURGHODTXHGHVWDFD HO (VWDGR ±R VXV H[SUHVLRQHV GH JRELHUQR
HQHOFDPSRGHODVDOXG±\ODVRFLHGDGFLYLO(O
objeto de la acción del Estado es la población
\HODPELHQWHHQTXHYLYH HQVXVGLPHQVLRQHV
ELROyJLFDItVLFDTXtPLFD\VRFLRFXOWXUDO Esencial
&RQFHSWR TXH KDFH UHIHUHQFLD D OD VXVWDQFLD R
HVHQFLDGHODVFRVDVHVGHFLUHVLQKHUHQWHDOR
VXVWDQWLYRGHOHQWHFRQGLFLyQsine qua non TXH
UHVXOWD QHFHVDULD DO PDQWHQLPLHQWR GH OD H[presión continua y plena de un sistema simple
o complejo. No se entiende a lo esencial como
HTXLYDOHQWH GH OR EiVLFR FRPR OR PtQLPR LQGLVSHQVDEOH QL FRPR OR SULRULWDULR VLQR FRPR
OR UHOHYDQWH \ OHJtWLPR SDUD HO IXQFLRQDPLHQWR
óptimo de un sistema.
(QEDVHDORH[SXHVWRHVTXHKR\VHGH¿QH
a la Salud Pública como un compromiso de la
sociedad con sus ideales de salud, haciendo
referencia al conjunto de prácticas sociales –y
los valores, creencias, actitudes y conocimientos formales y no formales subyacentes– que
en una sociedad tienden a desarrollar, preservar o mejorar la salud de la población y del
ambiente/D6DOXG3~EOLFDLQFOX\HSHURQRVH
OLPLWDDODVDFWLYLGDGHVGHSURPRFLyQ\SUHYHQción.
FUNCIONES ESENCIALES DE LA SALUD PÚBLICA
/D 236206 FRQVLGHUD IXQFLRQHV HVHQFLDOHV
para la Salud Pública a las siguientes:
‡ 6HJXLPLHQWR HYDOXDFLyQ \ DQiOLVLV GH OD VLtuación de salud
‡9LJLODQFLDLQYHVWLJDFLyQ\FRQWUROGHULHVJRV
y daños
‡3URPRFLyQGHODVDOXG
‡3DUWLFLSDFLyQGHORVFLXGDGDQRVHQODVDOXG
‡ 'HVDUUROOR GH SROtWLFDV \ FDSDFLGDG LQVWLWXFLRQDOGHSODQL¿FDFLyQ\JHVWLyQ
‡)RUWDOHFLPLHQWRGHODFDSDFLGDGLQVWLWXFLRQDO
GHUHJXODFLyQ\¿VFDOL]DFLyQ
‡(YDOXDFLyQ\SURPRFLyQGHODFFHVRHTXLWDWLYRDORVVHUYLFLRVGHVDOXGQHFHVDULRV
‡'HVDUUROORGHUHFXUVRVKXPDQRV\FDSDFLWDción
‡*DUDQWtD\PHMRUDPLHQWRGHODFDOLGDGGHORV
VHUYLFLRVGHVDOXGLQGLYLGXDOHV\FROHFWLYRV
1 - Salud Pública, sistemas de servicios y organizaciones de la Salud Pública / 23
‡,QYHVWLJDFLyQ
‡5HGXFFLyQGHOLPSDFWRGHODVHPHUJHQFLDV\
desastres en salud
Estas funciones esenciales se consideran hoy
dignas de ser especialmente destacadas y la educación en Salud Pública debe proponerse incorpoUDUXQDYLVLyQGHODVDOXGPiVFRPSOHWDHVGHFLU
TXHODVDOXGQRHVVRODPHQWHODDXVHQFLDGHHQIHUPHGDGDVtFRPRSRQHUGHUHOLHYHODQHFHVLGDGGH
TXHHO(VWDGRDVXPDXQDIXHUWHUHVSRQVDELOLGDG
en la regulación y orientación de los cambios en
acuerdo a los principios de equidad HQWHQGLGD
WDO FXDO H[SUHVD 6RQLV FRPR LJXDO DFFHVR D OD
salud para igual necesidad; igual utilización de
recursos para igual necesidad y atención de igual
FDOLGDGSDUDWRGRV solidaridad y H¿FLHQFLD.
CAMPO DE LA SALUD
6LPLODULPSRUWDQFLDDGTXLHUHSDUDOD6DOXG3~blica la delimitación del concepto de “campo de
ODVDOXG´GHVFRPSXHVWRSRU/DORQGH HQ
cuatro amplios componentes:
‡%LRORJtDKXPDQD SREODFLyQ
Que incluye todos los hechos relacionados
FRQ OD VDOXG WDQWR ItVLFD FRPR PHQWDO TXH
VHPDQL¿HVWDQHQHORUJDQLVPRFRPRFRQVHcuencia de la biología fundamental del ser
humano y de la constitución orgánica del
LQGLYLGXR KHUHQFLD JHQpWLFD PDGXUDFLyQ \
HQYHMHFLPLHQWRHWF
‡0HGLR$PELHQWH
4XHLQFOX\HWRGRVDTXHOORVIDFWRUHVUHODFLRQDGRVFRQODVDOXGTXHVRQH[WHUQRVDOFXHU-
SRKXPDQR\VREUHORVTXHODSHUVRQDWLHQH
SRFRRQLQJ~QFRQWURO DJXDDOLPHQWRVFRQWDPLQDFLyQGHODLUHGHVHFKRVPHGLRVRFLDO
HWF
‡(VWLORGHYLGD
4XH LQFOX\H HO FRQMXQWR GH GHFLVLRQHV TXH
WRPDHOLQGLYLGXRFRQUHVSHFWRDVXVDOXG\
VREUHODVTXHHMHUFHFLHUWRJUDGRGHFRQWURO
KiELWRVFRQGXFWDVHWF
‡2UJDQL]DFLyQGHODDWHQFLyQGHVDOXG 6HUYLFLRVGH$WHQFLyQ0pGLFD
4XHLQFOX\HFDQWLGDGFDOLGDGRUGHQtQGROH
y relaciones entre las personas y los recursos en la prestación de la atención de salud
SUiFWLFDV PpGLFDV GH HQIHUPHUtD KRVSLWDOHVFHQWURVGHVDOXGHWF
Este concepto de campo de salud permite la
XQL¿FDFLyQGHWRGRVORVIUDJPHQWRVHQTXHVHGLYLGHODUHVSRQVDELOLGDGHQ6DOXGEULQGDQGRXQD
YLVLyQLQWHJUDOHLQWHJUDGDTXHHYLWDODVVROXFLRnes limitadas a una única esfera de interés.
7DQWRODVfunciones esenciales como el concepto de campo de la salud nos hablan de la imSRUWDQFLDGHOD$GPLQLVWUDFLyQOD*HVWLyQ\OD
2UJDQL]DFLyQGHORV6LVWHPDVGHORV6HUYLFLRV\
de las Organizaciones de atención de la salud.
6LQ HPEDUJR UH¿HUH 6LOYD 3DLP TXH WDQWR
ODSODQL¿FDFLyQFRPRODJHVWLyQHQVDOXGQRKD
sido materia de estudios más sistemáticos ya sea
sobre sus posibles objetos o sobre sus métodos y
WpFQLFDVDOFRQWUDULRGHORTXHKDRFXUULGRFRQ
la Epidemiología en las últimas décadas.
INVESTIGACIÓN EN SISTEMAS Y SERVICIOS DE SALUD
Contribución potencial a la
reducción de la mortalidad
Biología humana
27
Afectación actual de
los gastos en salud
7,9
1,6
1,5
Entorno
19
Estilo
de vida
43
11
Sistema de cuidados
90
3RURWUDSDUWHVHVLJXHGLVFXWLHQGRODLQWHUFDPELDELOLGDGGHORVWpUPLQRVVLVWHPDVSRUXQODGR
\ VHUYLFLRV SRU RWUR FRQVLGHUDQGR 'HOLD 6iQFKH] TXH ORV VLVWHPDV VRQ XQD GLPHQVLyQ PiV
amplia del fenómeno de la organización de una
VRFLHGDG HQ XQ WLHPSR GDGR SDUD UHVROYHU VXV
GHVDItRVHQHOWHPDVDOXGPLHQWUDVTXHVHUYLFLRV
LPSOLFD XQ QLYHO PiV HVSHFt¿FR GH FDVR VL VH
TXLHUHHQHOTXHVHSULYLOHJLDDORVFRPSRQHQWHV
del sistema. Por ello también se habla de SistePDVGHVHUYLFLRV
La delimitación del objeto de estudio de esta
área de conocimiento y práctica en Salud PúbliFD SXHGH WHQHU XQD SULPHUD UHIHUHQFLD H[WUDtGD
S
Promedio de vida
Satisfacción
interna
Satisfacción
externa
Enfermedad
som
al
Reserva
SALUD
(bienestar)
Comportamiento
interpersonal
psiquico
E
ILI
BR
IO
Malestar
SERVICIOS
DE
ATENCIÓN
Discapacidad MÉDICA,
prevención,
cura,
cuidado,
Participación en la rehabilitación
atención de la salud
Conducta de salud
Conducta social
QU
SIS
TEM
AS
CU
LT
UR
AL
ES
co
á ti
MEDIO
AMBIENTE
Fetal, físico
(natural por
acción
del hombre),
sociocultural
(economía,
educación,
trabajo, etc.)
S
Comportamiento
ecológico
EC
O
LÓG
ICO
ESTILO DE VIDA
actitudes
conductas
AS
SO
UR
EC
LE
RA
TU
NA
POBLACIÓN
(tamaño, distribución,
tasa de crecimiento,
acervo genético)
HERENCIA
soc
i
R
24 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
C
AC
ISF
SAT
IO
N
MA
HU
S
NE
Figura 1.1: Concepto de Campo de Salud (Lalonde, 1974)
GHODGH¿QLFLyQGH,QYHVWLJDFLyQHQ6LVWHPDV\
6HUYLFLRV GH 6DOXG LQFOXLGD HQ HO Working Paper del Institute of Medicine`s Comité on Health
Services Research ³XQD DFWLYLGDG LQWHUGLVFLSOLQDULD GLUHFWDPHQWH
UHOHYDQWHSDUDODVDOXG\TXHLQWHQWDDPSOLDUODFRPSUHQVLyQ GH ORV YDULRV IDFWRUHV TXH LQÀXHQFLDQ OD
SURYLVLyQGHVHUYLFLRVGHVDOXGFRQHOREMHWLYR¿QDO
GHPHMRUDUORV\WRUQDUVXXVRPiVH¿FLHQWH(QJOREDXQDPSOLRHVSHFWURGHDFWLYLGDGHVTXHYDQGHVGH
ODLQYHVWLJDFLyQEiVLFDUHFROHFFLyQGHLQIRUPDFLyQ
HVWDGtVWLFD GHVDUUROOR GH LQYHVWLJDFLyQ DSOLFDGD
WHVWVSLORWR testing \HYDOXDFLRQHVSDUDHODQiOLVLV
GHSROtWLFDV policy análisis \SDUDODSODQL¿FDFLyQ
DODUJRSOD]R6XSUHRFXSDFLyQVXVWDQWLYDHVLJXDOPHQWHDPSOLDHLQFOX\HODSODQL¿FDFLyQRUJDQL]DFLyQ¿QDQFLDPLHQWRJHUHQFLDXVR\HIHFWLYLGDGGH
ORV6HUYLFLRV\6LVWHPDVGH6DOXG´
5H¿HUH $OPHLGD TXH OD KLVWRULD GHO
GHVDUUROOR GH ORV VLVWHPDV \ VHUYLFLRV GH VDOXG
FRPRXQFDPSRHVSHFt¿FRGHUHÀH[LyQWLHQHVX
RULJHQ HQ VX HVSHFt¿FD HVWUXFWXUDFLyQ D SDUWLU
de la Segunda Guerra Mundial. Se introdujo un
fuerte crecimiento de los mismos en forma más
DUWLFXODGD\DVHDDWUDYpVGH¿QDQFLDPLHQWRHVWDWDOGLUHFWRRDWUDYpVGHVXEVLGLRVHVSHFt¿FRV/D
FHQWUDOLGDGGHODDVLVWHQFLDPpGLFD\GHOKRVSLWDO
FRPRHMHHVWUXFWXUDGRUGHHVRVVLVWHPDVFRQORV
FRQFRPLWDQWHVGHVDUUROORVFLHQWt¿FRV\WHFQROyJLFRVDJUHJDORVHOHPHQWRVFHQWUDOHVTXHYDQDLQWHUIHULUHQODFRQ¿JXUDFLyQGHOFDPSRGHHVWXGLR
$SDUWLUGHDOOtVHSURGXMRODQHFHVLGDGUiSLGDPHQWH FUHFLHQWH GH LQIRUPDFLRQHV VREUH
GLVSRQLELOLGDGFRVWRH¿FLHQFLDH¿FDFLD\FDOLGDGGHORVVHUYLFLRVGHVDOXG SULQFLSDOPHQWHGH
DVLVWHQFLDPpGLFD ORTXHH[SDQGLyHOFDPSRGH
DGPLQLVWUDGRUHVFXDQWRGHLQYHVWLJDGRUHV
/DFULVLV¿VFDOGHO(VWDGRDSDUWLUGHODVHJXQGD PLWDG GH ORV DxRV RULHQWy ORV UHÀHFWRUHV
hacia otros problemas de los sistemas de salud; la
H¿FLHQFLDHQHOXVRGHORVUHFXUVRV\ODHIHFWLYLGDG
HQORVUHVXOWDGRVGHORVVHUYLFLRV$XQTXHHOJDVWR
VDQLWDULR\DKXELHVHDXPHQWDGRGHVGHHOpQIDVLVTXHVHGLRHQWRQFHVDVXPRQLWRUHDPLHQWRIXH
sin precedentes. Por lo menos dos realidades objeWLYDVKDEtDQFDPELDGRORVFRVWRVPpGLFRVKDEtDQ
VXELGR FRQ PXFKD PiV UDSLGH] TXH HQ FXDOTXLHU
GpFDGDDQWHULRU\ODSDUWHJXEHUQDPHQWDOHQHO¿QDQFLDPLHQWR KDEtD DXPHQWDGR VXVWDQWLYDPHQWH
ya sea en los países con sistemas mayoritariamente
S~EOLFRVRHQDTXHOORVTXHSULYLOHJLDEDQDOVHFWRU
SULYDGR&LHUWDPHQWHORVDYDQFHVHQODVFLHQFLDV\
HQODWHFQRORJtDKDEtDQFUHDGRQXHYDVGHPDQGDV
de inversión, DGHPiVGHTXHKDEtDQDXPHQWDGRODV
UHLYLQGLFDFLRQHVSRUPHMRUHVVDODULRVHQVLQWRQtD
FRQHOFOLPDSROtWLFRGHODpSRFD3HURVLQGXGDOD
causa de los altos costos no era tanto la intensidad
GHOFODPRU\GHODVUHLYLQGLFDFLRQHVVLQRHODXPHQto en los componentes del costo de la asistencia
PpGLFDHVGHFLUHOSXQWRFUtWLFRVHGLVORFyKDFLDOD
estructura de ¿QDQFLDPLHQWRGHORVVLVWHPDVVDQLWDrios y hacia la propia estrategia de desarrollo de los
VHUYLFLRVGHVDOXGLPSOHPHQWDGDKDVWDHQWRQFHV
1 - Salud Pública, sistemas de servicios y organizaciones de la Salud Pública / 25
$SDUWLUGHORVDxRVVHDVLVWHDXQFDPELR
del consenso político anterior en la dirección de
la contención de costos y de la reducción de los
VLVWHPDVGHVDOXG %LFH:DOW :LOVRQ
$OPHLGD :DOW 6H SXHGH
GHFLU TXH KXER XQ FDPELR VLJQL¿FDWLYR HQ OD
DUHQD SROtWLFD VHFWRULDO HO TXH :DOW :LOVRQ
DQDOL]DQFRPRVLHQGRHOSDVDMHGHOFRQVHQVR DO FRQÀLFWR R D OD LQFHUWLGXPEUH :DOW
(OLQVWUXPHQWRGHSROtWLFDHVFRJLGRSDUD
implementar la contención de costos y el redireccionamiento de los sistemas de salud fue el
DXPHQWRGHOFRQWURO\ODUHJXODFLyQ *UHHQEHUJ
&KRL$OPHLGD 3RUORWDQWRHQXQSULPHUPRPHQWRODVSUHRFXSDFLRQHVHVWDEDQYLQFXODGDVDODSHUVSHFWLYD
GHH[WHQVLyQGHODFREHUWXUDSREODFLRQDOGHORV
VLVWHPDVGHVHUYLFLRVGHVDOXG\SRVWHULRUPHQWHDODQHFHVLGDGGHFRQWHQFLyQGHFRVWRV\GH
mayores controles sobre el desarrollo de los serYLFLRVVREUHWRGRORVGHDVLVWHQFLDPpGLFD
$PHGLDGRVGHODGpFDGDDSDUHFHHOHQIRTXH
GHOD$WHQFLyQ3ULPDULDFRQHOFRPSURPLVRHQ
Alma Ata de 155 estados en esa directriz; como
XQDSUHVFULSFLyQJHQHUDOTXHDERJDEDTXHORV
sistemas sanitarios deberían dar prioridad a la
DVLVWHQFLDHVHQFLDODQWLFLSDQGR\HYLWDQGRORV
SUREOHPDVGHVDOXG\ORVDJUDYDPLHQWRVGHODV
HQIHUPHGDGHV\TXHEUDQGRORVFLFORVSHUYHUVRV
SURGXFWRUHVGHODHQIHUPHGDG\FRPRXQFRQMXQWR GH DFFLRQHV \ VHUYLFLRV TXH FRPSRQtDQ
OD$36\VHH[WHQGtDQPiVDOOiGHOFDPSRHVWULFWR GH OD DVLVWHQFLD PpGLFD IRFDOL]DQGR ODV
FRQGLFLRQHVGHYLGD\VDOXGGHODVSREODFLRQHV
incorporando acciones en el área de educaFLyQ VDQHDPLHQWR SURPRFLyQ GH OD RIHUWD GH
DOLPHQWRV \ GH OD QXWULFLyQ DGHFXDGD VDOXG
PDWHUQRLQIDQWLO LQFOX\HQGR SODQL¿FDFLyQ IDPLOLDU PHGLGDVGHSUHYHQFLyQVXPLQLVWURGH
PHGLFDPHQWRVHVHQFLDOHVJDUDQWtDGHDFFHVRD
ORVVHUYLFLRVHWF
8QQXHYRSDVRVHUtDSDUDOD$GPLQLVWUDFLyQ
6DQLWDULDODLQFRUSRUDFLyQGHOGHVDUUROORRSHUIHFFLRQDPLHQWRGHVLVWHPDVGHLQIRUPDFLyQTXH
SRVLELOLWDVHQODFRQVWUXFFLyQGHLQGLFDGRUHVTXH
apoyasen tanto la formulación de las políticas
de salud y de programas como su monitoreo y
HYDOXDFLyQTXHH[DPLQDVHQODHVWUXFWXUD\IXQFLRQDPLHQWRGHORVVLVWHPDVGHVDOXGHQODSHUVSHFWLYDGHFRPSUREDUVLODVSHVDGDVLQYHUVLRQHV
HIHFWXDGDVKDEtDQDOFDQ]DGRVXVREMHWLYRVHQHO
WHPDGHODXQLYHUVDOLGDGHIHFWLYLGDGH¿FLHQFLD
\HTXLGDG
(ODOLHQWRTXHHO%DQFR0XQGLDOGLRDFXHVWLRQHVFRPRFRVWRVH¿FDFLD\HIHFWLYLGDGDSDUWLUGHODGpFDGDGHORV±WDQWRFRPROD2(&'
a elaborar gran cantidad de análisis comparados
VREUH VLVWHPDV GH VHUYLFLRV GH VDOXG± SURGXMR
XQPRYLPLHQWRLPSRUWDQWHHQSURGHODVUHIRUmas sanitarias en todo el mundo y hacia la geneUDFLyQGHGLYHUVRVPRGHORVDOWHUQDWLYRVTXHVH
HULJLHURQFRPRQXHYRVSDUDGLJPDVHQVHUYLFLRV
GH VDOXG (VWD DFWLYLGDG LQFUHPHQWy OD LPSRUWDQFLDGHORV$GPLQLVWUDGRUHVGHVLVWHPDVVHUYLFLRV\RUJDQL]DFLRQHVGHDWHQFLyQGHODVDOXG
DWDOSXQWRTXHVHPXOWLSOLFDURQHQODGpFDGDGH
ORVORVFXUVRVGHIRUPDFLyQ\FDSDFLWDFLyQD
QLYHOLQWHUQDFLRQDOQDFLRQDO\ORFDO
3DUD %HOPDUWLQR HQ IRUPD WUDGLFLRQDOel servicio es la organización prestadora de
DWHQFLyQ 0pGLFD HQ WDQWR TXH OD LQYHVWLJDFLyQ
GHORVPLVPRVVHGH¿QHFRPR³HOHVWXGLRGHODV
UHODFLRQHVHQWUHHVWUXFWXUDVSURFHVRV\UHVXOWDGRVHQODSUHVWDFLyQGHVHUYLFLRVGHVDOXG´(VWH
WLSR GH DERUGDMH GLFH ³YLQFXOD DO QLYHO PLFUR
DOHTXLSRGHVDOXGFRQVXFOLHQWHODODRIHUWD\
la demanda de prestaciones; la organización y
XWLOL]DFLyQ GH UHFXUVRV ¿QDQFLHURV WpFQLFRV \
humanos; las conductas y prácticas de prestadores y pacientes. El abordaje se complejiza senVLEOHPHQWH FXDQGR GHMD GH FRQVLGHUDUVH H[FOXVLYDPHQWHHOQLYHOGHORV VHUYLFLRV\FRPLHQ]DD
razonarse en términos de sistemasD~QFXDQGR
ORV VHUYLFLRV SXHGDQ FRQVLGHUDUVH FRPR SDUWH
VLJQL¿FDWLYDGHOVLVWHPD´
3RGUtDPRVVHxDODUHQHVHVHQWLGRGHORPLcro a lo macro:
‡(QIRTXHPpGLFRSDFLHQWH
‡(QIRTXHVHUYLFLRVSDFLHQWHVGHXQiUHD
‡(QIRTXHVLVWHPDVSREODFLyQ
6HSURGXFLUtDDVtXQDQXHYDLQVWDQFLDLQWHUPHGLDTXHOODPDGHODVUHODFLRQHVLQWHULQVWLWXFLRQDOHVTXHFRUUHVSRQGHUtDDOD³UHODFLyQHQWUH
LQVWLWXFLRQHVDJHQWHVDFWRUHVFRQSUHVHQFLDHQ
HOVHFWRUGRQGHVHGH¿QHODSXJQDHQWUHORVLQWHreses constituidos en su interior. Sería el espacio
GHYLQFXODFLyQHQWUHRUJDQL]DFLRQHV¿QDQFLDGRUDVHLQVWLWXFLRQHVSUHVWDGRUDVHQWUHODVHVIHUDV
GHUHJXODFLyQ\FRQWURO\DTXHOODVLQVWLWXFLRQHV
\VHUYLFLRVVRPHWLGDVDVXLPSHULRHOOXJDUGRQde se produce la rearticulación entre lo estatal y
ORSULYDGRHQODRUJDQL]DFLyQVHFWRULDO´
3DLP UH¿HUH TXH SXHGHQ HQ HVWH FRQWH[WR
LGHQWL¿FDUVH DXQTXH GH IRUPD EDVWDQWH HVTXH-
26 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
PiWLFDVXEFRQMXQWRVGHUDFLRQDOLGDGHVTXHLQÀXHQFLDUtDQ HQ OD SODQL¿FDFLyQ \ OD JHVWLyQ HQ
salud:
‡ Racionalidad económica – Considera el
principio de la escasez en la relación neceVLGDGHVUHFXUVRV\EXVFDXQDFRPSDWLELOL]DFLyQHQWUHDPERVFRQYLVWDDODH¿FLHQFLD
‡Racionalidad administrativa o burocrática
± 3URFXUD EiVLFDPHQWH XQD DGHFXDFLyQ GH
PHGLRV \ ¿QHV IRUPDOPHQWH FRQVLGHUDGRV
SRU OD RUJDQL]DFLyQ VXERUGLQiQGROD D ODV
QRUPDVEXURFUiWLFDVYLJHQWHV
‡ 5DFLRQDOLGDG SROtWLFD ± ([SUHVD ORV PRYLPLHQWRVGHDFXPXODFLyQSpUGLGDGHSRGHU\
GHPRGL¿FDFLyQGHVXVUHODFLRQHVFRQVLGHrados en los cálculos de los actores sociales
\SDUWLFXODUPHQWHGHORVGLULJHQWHV
‡5DFLRQDOLGDGPpGLFRDVLVWHQFLDO – Se centra en la concepción de enfermedad y de inWHUYHQFLyQGHODFOtQLFD\HQODSULPDFtDGH
OR LQGLYLGXDO VXERUGLQDGR D OD GHPDQGD HVpontánea.
‡5DFLRQDOLGDGWpFQLFRVDQLWDULD – Se mani¿HVWDHQHOSULYLOHJLRGDGRDODVROXFLyQGH
problemas de salud en el ámbito de la poblaFLyQEXVFDQGRHQHOVDEHUHSLGHPLROyJLFRHO
LQVWUXPHQWR GH WUDEDMR SULYLOHJLDGR SDUD HO
DOFDQFHGHOLPSDFWRRGHODHIHFWLYLGDG
'HQWURGHHVWHFRQWH[WRVHGH¿QHFOiVLFDPHQte a un sistema de salud como una organización creada para proveer servicios destinados
a promover, prevenir, recuperar o rehabilitar
el daño en salud, con la meta de asegurar el
acceso a una atención de calidad adecuada y a
un costo razonable. El sistemaHVWiFRPSXHVWR
HQWUHRWURVSRUHVWDEOHFLPLHQWRVTXHVHRUJDQL]DQHQQLYHOHVGHFRPSOHMLGDGGHDFXHUGRDXQ
PRGHOR GH DWHQFLyQ GH¿QLGR (VWRV HVWDEOHFLPLHQWRVVHUHODFLRQDQHQWUHVtDWUDYpVGHVLVWHmas de referencia y contrarreferencia de pacienWHVFRQIRUPDQGRORTXHVHGHQRPLQDXQDred de
atención o de servicios de salud.
MODELOS DE ATENCIÓN
comprensión y el estudio de su comportamiento;
HQHOFDVRGHOVHFWRUVDOXGHVWDEOHFHQODVPRGDOLGDGHV GH DWHQFLyQ DPEXODWRULD \ KRVSLWDODULD
SRUHMHPSOR HOWLSRGHUHFXUVRKXPDQRTXHRWRUJD OD DWHQFLyQ PpGLFRV HVSHFLDOLVWDV PpGLFRV
GH IDPLOLD HQIHUPHUDV HWF GHWHUPLQDQ HO WLSR
GHVHUYLFLRVTXHVHHQWUHJDUiQSRUQLYHO\ORVUHcursos necesarios. Algunos modelos incluyen las
entidades prestadoras y las interrelaciones entre
pVWDV\ORVXVXDULRVODSDUWLFLSDFLyQFRPXQLWDULD
ODFRRUGLQDFLyQLQWHUVHFWRULDODVtFRPRORVPHFDQLVPRVGH¿QDQFLDPLHQWR
(O PRGHOR GH DWHQFLyQ HVTXHPDWL]D OD UHVSXHVWD RUJDQL]DFLRQDO GHO VHFWRU VDOXG DO SHU¿O
GHPRJUi¿FR\HSLGHPLROyJLFRDGDSWDGRDOQLYHO
GHGHVDUUROORWHFQROyJLFR\VRFLDOGHVXUHDOLGDG
y en donde tienen gran importancia los niveles
de atención y las modalidades de atención.
El nivel de atención corresponde a un concepWRTXHFRQMXJDGRVDVSHFWRVlas necesidades de
salud y los recursos necesarios para satisfacerlas.
(VWHFRQFHSWRGHVFDQVDHQODLGHDGHTXHODVnecesidadesVHSXHGHQRUGHQDUHQXQJUDGLHQWHFRQ
XQJUDQQ~PHURIiFLOGHUHVROYHUFRQWHFQRORJtDV
VLPSOHV \ XQ SHTXHxR Q~PHUR GH QHFHVLGDGHV
TXHUHTXLHUHQWHFQRORJtDVGHDOWDFRPSOHMLGDGR
costo. Los recursos en salud también presentan
XQJUDGLHQWHHQHOTXHSUHGRPLQDQORVGHPHQRU
FRPSOHMLGDG \ FRVWR SULPHU QLYHO GH DWHQFLyQ con un reducido número de recursos complejos y
GHDOWRFRVWR WHUFHUQLYHOGHDWHQFLyQKRVSLWDOHV
RFHQWURVHVSHFLDOL]DGRV Un sistema de salud debería ser universal
(todas las personas tienen la posibilidad de acceder a él), integral (debe satisfacer la diversidad de necesidades de salud de la población),
equitativo (debe favorecer más a los grupos con
mayores necesidades) y económicamente sosteQLEOHVXVDFFLRQHVGHEHQVHUH¿FDFHVVHJXUDV
y oportunas. Se ha producido, en forma similar
DODWUDQVLFLyQGHPRJUi¿FD\HSLGHPLROyJLFD
una transición en los sistemas de salud.
Los sistemas de salud conforman organizaFLRQHVTXHSXHGHQHVWXGLDUVHDWUDYpVGHOD7HR&DGDVLVWHPDGHVDOXGSRVHHXQRRYDULRVmode- UtDGHOD+RPHRVWDVLV\GHORV6LVWHPDVFDUDFlos de atenciónTXHHVWDEOHFHQODIRUPDGHRUJD- WHUL]iQGRVH SRU VXV SURSLHGDGHV PRUIRJpQLFDV
QL]DFLyQGHORVQLYHOHVGHDWHQFLyQ\ORVVLVWHPDV HVGHFLUTXHHQOXJDUGHEXVFDUXQHTXLOLEULRHVGHGHULYDFLyQGHQWURGHODUHGDVLVWHQFLDO(OPR- table tienden a una permanente transformación
GHORHVXQHVTXHPDWHyULFRGHXQVLVWHPDRGHXQD HVWUXFWXUDO$XQTXHHVWiLQWHJUDGDDOD7HRUtDGH
UHDOLGDGFRPSOHMDTXHVHHODERUDSDUDIDFLOLWDUVX ORV6LVWHPDVQRH[LVWHQRWUDVDQDORJtDVHQWUHXQ
1 - Salud Pública, sistemas de servicios y organizaciones de la Salud Pública / 27
DIRECTOR COMO
PUESTO POLÍTICO
SERVICIOCENTRISMO
HOSPITALOCENTRISMO
SALUD
JEFES DE SERVICIO
SEÑORES DE FEUDOS - TODOPODEROSOS
SUELEN ACCEDER POR PROFESIONALISMO MÁS
QUE POR CAPACIDAD DE ADMINISTRACIÓN
H
HOSPITAL
VALORES
POLÍTICAS
FUNCIONES DEL
ESTADO EN SALUD
LO
MODE DE
ICO Y
POLÍT MAS
SISTE
MODELO DE GESTIÓN
DE SERVICIOS
DIVORCIADO DEL RESTO
TIRONEADA ENTRE LA CIENCIA
Y LA NECESIDAD DE DAR
SERVICIOS A LA GENTE
TURNOS, LISTAS DE
ESPERA, ATENCIÓN
PREVIA AL ACTO MÉDICO
MODELO DE ATENCIÓN
(POBLACIÓN)
ÓPTICA DE LA
POBLACIÓN
CALIDAD - MALTRATO
CUÁNTO DEBE GASTARSE
DE DÓNDE DEBEN
PROVENIR LOS RECURSOS
CÓMO ASIGNARLOS
MODELO DE
FINANCIAMIENTO
Figura 1.2: Modelos en el ámbito de la salud (Lemus JD, workshop Puerto Madero 2008)
sistema mecánico o el cuerpo humano con relaFLyQDXQDRUJDQL]DFLyQVDQLWDULDVLELHQDPERV
VXMHWRV SXHGHQ VHU FRQFHELGRV FRPR VLVWHPDV
donde el todo está formado por la mutua dependencia de las partes y es siempre más complejo
TXH OD VXPD GH pVWDV$ GLIHUHQFLD GHO FXHUSR
KXPDQRFRQHOTXHVHDVHPHMDHQORVPRGHORV
GHWLSRRUJiQLFRFDEHH[SOLFDUTXHODVFDUDFWHUtVWLFDVGHODRUJDQL]DFLyQHQORTXHKDFHDVX
HVWUXFWXUD VRQ GLVFUHWDV HQ OXJDU GH FRQFUHWDV
\ HQ FRQVHFXHQFLD QR SXHGHQ VHU FRQFHELGDV
FRPRGHSHQGLHQWHVGHXQVLVWHPDQHUYLRVRFHQWUDO$GHPiVODVSDUWHVLQWHJUDQWHVGHODRUJDQLzación sanitaria son capaces de elaborar conducWDV ±GLVWLQWDV \ FDPELDQWHV± TXH JHQHUDOPHQWH
GL¿HUHQ GH ODV FRQGXFWDV IRUPDOL]DGDV TXH ODV
iUHDVFHQWUDOHVTXLHUHQLPSRQHU
8QVLVWHPDVDQLWDULRQRSXHGHVHUFRQIXQGLGR
FRQODHVWUXFWXUDTXHVXVFRPSRQHQWHVDGRSWHQ
VXEVLVWHPDRVXSUDVLVWHPD HQXQPRPHQWRGHterminado; su estructura es trascendente y puede
DGRSWDURWUDVIRUPDVVHJ~QODVQHFHVLGDGHVTXH
HOFRQWH[WRRVXQLYHOLQWHUQROHH[LMDQ
(VWDSHUPDQHQWHWUDQVIRUPDFLyQHVWUXFWXUDO
OHMRVGHVHUQRFLYD\SHUMXGLFLDOFRPRORVXSRQHXQPRGHORPHFiQLFRXRUJiQLFRFRQVWLWX\H
HO SUHUUHTXLVLWR SDUD TXH ODV RUJDQL]DFLRQHV VH
FRQVHUYHQHQIRUPDDFWLYD\H¿FLHQWHHQVXPD
HVVXSURSLDUD]yQGHVXSHUYLYHQFLD
/D H[LVWHQFLD GH XQD GRVLV GH WHQVLyQ HV
una característica propia de los sistemas de
VDOXG OR LPSRUWDQWH QR HVWi HQ HUUDGLFDUOD
VLQR HQ LQWHJUDUOD DO QLYHO ySWLPR TXH HO VLVtema necesita.
28 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
Histórica y políticamente cada país ha adopWDGR GHWHUPLQDGRV VLVWHPDV GH VDOXG GHVGH HO
aspecto macro de superestructura sanitaria hasta
HOPLFURTXHFRPRKHPRVUHIHULGRKDVLGRGH¿QLGRFRPR6,/26 VLVWHPDORFDOGHVDOXG HV
GHFLUODmínima estructura político-administrativa capaz de dar respuesta a las necesidades
y demandas de salud de un conjunto de población, hasta el grado que sea considerado como
equitativo y justo en una sociedad determinada.
(QHOiPELWRGHORVVLVWHPDV\VHUYLFLRVFRmienza el proceso de DGPLQLVWUDFLyQ HVWUDWpJLFDHQVDOXGGH¿QLGRcomo una forma de relacionar los problemas y necesidades en salud
de los conjuntos sociales que viven en espacios
JHRJUi¿FRVGHOLPLWDGRVFRQORVFRQRFLPLHQWRV
y recursos, institucionales y comunitarios, de
WDO PRGR TXH VHD SRVLEOH GH¿QLU SULRULGDGHV
considerar alternativas reales de acción, asignar recursos y conducir el proceso hasta la resolución o control del problema. Este proceso
SXHGHVHUPDFUR XQVLVWHPDORFDOGHVDOXGSRU
HMHPSOR RPLFUR XQDLQVWLWXFLyQGHVDOXGKRVSLWDOHVFHQWURVGHVDOXGHWF /DVIXQFLRQHVTXHFDUDFWHUL]DQDODDGPLQLVtración estratégica son la conducciónODSURJUDmación y la JHUHQFLD$XQTXHODSURJUDPDFLyQ
puede ser considerada como parte integrante de
ODIXQFLyQGHFRQGXFFLyQRODGHJHUHQFLD VHJ~Q
HO HQIRTXH HOHJLGR VH SUH¿HUH GHVWDFDUOD SRU
la importancia singular que adquiere al ser el
momento en que se articula la formulación política (conducción) con la práctica (gerencia).
Asimismo, estas funciones se desempeñan a lo
largo del proceso administrativo sin solución de
FRQWLQXLGDGQRVLHQGRSRVLEOHODLGHQWL¿FDFLyQ
de secuencias necesarias entre ellas.
Función de conducción
(VHOHMHFHQWUDO\GLVWLQWLYRGHOHQIRTXHHVWUDWpJLFR \ VH OD HQWLHQGH FRPR OD capacidad de
promover consenso, concertar intereses y artiFXODUHVIXHU]RVFRQOD¿QDOLGDGGHDOFDQ]DUXQR
o más objetivos establecidos. En su ejercicio
SUHGRPLQDQORVDVSHFWRVGHWRPDGHGHFLVLRQHV
DGTXLULHQGR SRU OR WDQWR FDUDFWHUtVWLFDV PiV
acentuadamente políticas. El conductor –al deFLUGH*DQGXJOLD3LURYDQR±HVHOTXHWLHQHHOpoder de poder poder. El poder así es una categoUtDLPSUHVFLQGLEOHSRUVXFDSDFLGDGH[SOLFDWLYD
\HQHOHQWHQGLGRTXHSDUDSURGXFLUFDPELRVR
WUDQVIRUPDFLRQHVWHQHPRVTXHDSOLFDUUHFXUVRV
GHSRGHU\ODH¿FDFLDSROtWLFDGHWDOHVDFFLRQHV
GHWHUPLQDUi XQD QXHYD DFXPXODFLyQ R GHVDFXPXODFLyQGHSRGHU 5RYHUH Se deben tener en cuenta los siguientes asSHFWRVUHODFLRQDGRVFRQODSRVLELOLGDGGHDGRSWDUGHFLVLRQHVH¿FDFHV\RSRUWXQDV
‡/DH[LVWHQFLDGHGLYHUVDVYHUGDGHVFRQRSciones múltiples para el tratamiento de los
SUREOHPDV /D LQFHUWLGXPEUH HO FRQÀLFWR
ODIUDJPHQWDFLyQODGHSHQGHQFLD\ODFRPplejidad son características inherentes a los
SURFHVRVGHVDOXGS~EOLFD/DÀH[LELOLGDGHQ
ODVVROXFLRQHVHOPRQLWRUHRGHODFR\XQWXUD
DQiOLVLVFRQWLQXRGHOLPSDFWRTXHODFR\XQtura tiene sobre la marcha del proceso en la
GLUHFFLyQGHVHDGDVREUHODH¿FDFLD\YDOLGH]
de las estrategias seleccionadas y sobre la
YLDELOLGDG\IDFWLELOLGDGGHODVSURSXHVWDVHQ
HOPHGLDQR\ODUJRSOD]R \HOEDODQFHSHUPDQHQWH HQWUH OR GHVHDGR \ OR SRVLEOH VRQ
rasgos típicos de la función de conducción.
‡ /D FRQVLGHUDFLyQ GH ORV FRQWH[WRV VRFLDO
SROtWLFR HFRQyPLFR \ FXOWXUDO WDQWR HQ OD
consideración de problemas como de soluciones
‡/DFRQVLGHUDFLyQ\UHFRQRFLPLHQWRGHORVHOHPHQWRV FRQVWLWXWLYRV GHO XVR \ GLVWULEXFLyQ
GHOSRGHUSROtWLFRDGPLQLVWUDWLYR\WpFQLFR
‡ /D UHODFLyQ SHUPDQHQWH GH ODV DFFLRQHV GH
corto con las de mediano y largo plazo
‡/DFUHDFLyQGHFRQVHQVRFRQFHUWDFLyQ\QHJRFLDFLyQ SDUD JHQHUDU OD YLDELOLGDG GH ODV
propuestas
‡$\XGDUDFUHDUODVFRQGLFLRQHVQHFHVDULDVSDUD
una amplia participación de todos los actores
\FRQMXQWRVVRFLDOHVLQYROXFUDGRV
‡5HODFLRQDU\HYDOXDUORVDVSHFWRVQRUPDWLYRV
\HVWUDWpJLFRVGHPDQHUDTXHQRVHFRQWUDponga el presente posible con el futuro deseado.
Función de programación
&RPSUHQGHODVDFWLYLGDGHVTXHWLHQHQFRPR¿QDOLGDGSUHYHUORVFXUVRVGHDFFLyQTXHVHUiQVHJXLGRV(VXQLQVWUXPHQWRTXHD\XGDHQODWRPD
GH GHFLVLRQHV JDUDQWL]D OD H¿FLHQFLD HQ HO XVR
GHORVUHFXUVRV\WDPELpQIDFLOLWDORVSURFHVRV
GHQHJRFLDFLyQ\SDUWLFLSDFLyQVRFLDOGHQWURGHO
marco de referencia establecido por las políticas
y estrategias nacionales.
(VWDV DFWLYLGDGHV SXHGHQ VHU FRQVLGHUDGDV
del siguiente modo:
‡ ,GHQWL¿FDFLyQ GH ORV SUREOHPDV GH VDOXG \
SULPHUDH[SOLFDFLyQLQLFLDO
1 - Salud Pública, sistemas de servicios y organizaciones de la Salud Pública / 29
‡9DOLGDFLyQ\SULPHUOLVWDGRGHSULRULGDGHV
‡'HWHUPLQDFLyQGHODVSHUVRQDVFRVDVRVLWXDFLRQHVHQODVTXHSXHGHSUHVHQWDUVHHOIHQymeno o los problemas
‡,GHQWL¿FDFLyQGHORVFRQRFLPLHQWRVGLVSRQLbles para dar solución a los problemas idenWL¿FDGRV VDOXG S~EOLFD EDVDGD HQ OD PHMRU
HYLGHQFLDGLVSRQLEOH
‡6HOHFFLyQGHODWHFQRORJtDPiVDGHFXDGDGH
DFXHUGRFRQFULWHULRVGHGLVSRQLELOLGDGYLDELOLGDGIDFWLELOLGDGFRVWRVH¿FDFLD\DFHStabilidad
‡ 'H¿QLFLyQ GH SURJUDPDV \ VXESURJUDPDV
SURFHVR GH QHJRFLDFLyQ FRQ DGMXGLFDFLyQ
de problemas y grupos de población al efector elegido
‡'HWHUPLQDFLyQGHODFDQWLGDGGHDFWLYLGDGHV
a partir de la aplicación de normas para cada
tipo de recurso
‡ 'HWHUPLQDFLyQ HQ FDGD XQD GH ODV XQLGDGHV
GHVHUYLFLRGHORVUHFXUVRVUHTXHULGRV\ORV
disponibles y las diferentes opciones para las
prioridades
‡5HDMXVWHGHODVSURSXHVWDVSUHOLPLQDUHV\SUHSDUDFLyQGHODVGH¿QLWLYDV
‡(ODERUDFLyQGHOSUHVXSXHVWRUHODFLyQFRQORV
IRQGRVGLVSRQLEOHVHVWXGLRVGHFRVWRVDFWLYLGDGHVDOWHUQDWLYDV
‡1HJRFLDFLyQSUHVXSXHVWDULDQXHYDVIXHQWHV
GH¿QDQFLDPLHQWRFRQVROLGDFLyQGHOSUHVXSXHVWR GLVSRQLEOH DSUREDFLyQ ¿QDO GH DFciones
‡(MHFXFLyQ\DMXVWHSHUPDQHQWHGHODSURJUDmación
‡'HWHUPLQDFLyQGHODVIRUPDVGHVXSHUYLVLyQ
FRQWURO\HYDOXDFLyQ&RQWUROGHJHVWLyQHVTXHPDSDUDODUHQGLFLyQGHFXHQWDV
‡ 6HJXLPLHQWR GH OD HMHFXFLyQ UHYLVLyQ GH OD
H[SOLFDFLyQ LQLFLDO \ GHO GLDJQyVWLFR GH VLWXDFLyQGHWHUPLQDFLyQSRVLEOHGHXQQXHYR
orden de prioridades
orientar y controlar su comportamiento. Son
los que tienen la responsabilidad de asignar
funciones, orientar sobre el modo de ejecutarlas y evaluar los resultados.
/DJHUHQFLDHQWHQGLGDFRPRDFWLYLGDGSURSLDGHORVJHUHQWHVRDGPLQLVWUDGRUHVFRPSUHQGHODDFFLyQTXHKDFHYLDEOH\IDFWLEOHHOPHMRU
XVRGHORVUHFXUVRVSDUDHOORJURGHORVREMHWLYRV
VRFLDOHVSHUVHJXLGRVPHGLDQWHXQSURFHVRFRQWLQXR GH WRPD GH GHFLVLRQHV TXH VH IXQGDPHQWDHQODGH¿QLFLyQ\DQiOLVLVGHSUREOHPDV\HQ
la asignación de los correspondientes recursos
SDUDODVROXFLyQGHPDQHUDTXHHVDVGHFLVLRQHV
VHFRQYLHUWDQHQDFFLRQHVHIHFWLYDV
/D IXQFLyQ DGPLQLVWUDWLYD TXH FRQOOHYD OD
JHUHQFLDOHMRVGHVHUHTXLYDOHQWHDOPDQHMRUXWLnario y carente de imaginación de las cosas y de
ODV SHUVRQDV FRVL¿FDGDV HV XQ HOHPHQWR HVHQFLDOSDUDHOORJURGHORVREMHWLYRVSHUVHJXLGRV
siempre y cuando se admita salir de los estreFKRV PiUJHQHV GH¿QLGRV SRU DQWLJXDV FXOWXUDV
organizacionales y tomar los caminos abiertos
SRUODVQXHYDVFRQFHSFLRQHVGHODJHUHQFLDHVtratégica.
/D FRPXQLFDFLyQ OD DGDSWDFLyQ OD FRQFHUWDFLyQODGHFLVLyQODFUHDWLYLGDGODÀH[LELOLGDG
y asumirse como un entrepreneur son los ejes
IXQGDPHQWDOHVGHODDFWLYLGDGGHOJHUHQWHHQOD
DFWXDOLGDGDGLIHUHQFLDGHODQWLJXRRUGHQXQLIRUPLGDG\H[LVWHQFLDGHXQDUDFLRQDOLGDGVXSHrior.
/DQXHYDJHUHQFLDXWLOL]DORVVLJXLHQWHVFRQceptos:
‡2UJDQL]DFLyQFRQEDVHHQXQequipo de trabajo GHMDQGR GH ODGR OD HVSHFL¿FDFLyQ EXURFUiWLFDGHODVWDUHDV\GH¿QLHQGRSULPHUR
capacidades y habilidades y luego estructura
por tareas.
‡ 2UJDQL]DFLyQ descentralizada y modular;
DXWyQRPD UHGXQGDQWH FDGD VHFWRU GHVHPSHxD VXV WDUHDV FRQ DXWRQRPtD IXQFLRQDO
eliminando las grandes unidades de control
Función de gerencia
EXURFUiWLFR GLIHUHQFLDGD SRU REMHWLYRV
(VODDFWLYLGDGGHVDUUROODGDSRUWRGRVORVLQWHLQWHJUDGD SRU FRPXQLFDFLRQHV LQWHQVLYDV \
JUDQWHVGHXQVLVWHPDGHVDOXGFRQOD¿QDOLGDG
IXQGDPHQWDGDHQHTXLSRV
GHRUJDQL]DU\FRRUGLQDUORVUHFXUVRVGHTXHGLVSRQHQSDUDODHMHFXFLyQH¿FD]\H¿FLHQWHGHODV
La moderna capacidad gerencial implica:
DFWLYLGDGHVDWLQHQWHVFRQVXVUHVSRQVDELOLGDGHV
‡ $QDOL]DU H LQWHUSUHWDU ORV FRQWH[WRV VRFLDO
\FRPSHWHQFLDVHVSHFt¿FDV(QHOFRQWH[WRPLSROtWLFRHFRQyPLFR\FXOWXUDO
FURVHODGH¿QHFRPRel campo de intervención
‡ &UHDU ODV FRQGLFLRQHV QHFHVDULDV SDUD TXH
especializado de los administradores o gerenparticipen todos los agentes y grupos sociates, es decir, de aquellas personas que dentro
les implicados
de la organización tienen la responsabilidad de
30 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
‡5HODFLRQDUORVWLHPSRVSROtWLFRV\WpFQLFRV
‡ 'HVDUUROODU PRGRV GLVWLQWRV GH SURFHGHU HQ
consonancia con el momento político local y
HOFRQWH[WRQDFLRQDO
‡&RQVLGHUDUODQHJRFLDFLyQFRPRLQVWUXPHQWR
fundamental de ajuste generador de consenVRFDSD]GHVXVWHQWDU\YLDELOL]DUSURSXHVWDV
de acción conjunta
‡2ULHQWDUHOGHVDUUROORLQVWLWXFLRQDOHLQWHULQVtitucional
‡'LULJLU\FRQWURODUODLPSOHPHQWDFLyQGHFDPbios en los programas de trabajo
(Q UD]yQ GH ORV ¿QHV GH HVWH WH[WR \ HQ HO
FRQWH[WR GH OR DQWHV H[SXHVWR HQ HVWH SULPHU
capítulo debemos también tomar en cuenta la
LQÀXHQFLDGHHVWRVFRQFHSWRVHLQVWUXPHQWRVHQ
la actual administración hospitalaria.
Crecimiento de la inversión en Salud
)DFWRUHVLQYROXFUDGRV
‡ (O SURJUHVLYR HQYHMHFLPLHQWR GH OD SRblación
‡6HHVWLPDTXHHQHOORVPD\RUHVGH
DxRVUHSUHVHQWDUiQDSUR[LPDGDPHQWHHO
de las poblaciones.
‡6HJ~QOD2&'(HOFRQVXPRGHUHFXUVRVVDQLWDULRV FUHFH H[SRQHQFLDOPHQWH D SDUWLU GH
ORVDxRVOOHJDQGRKDVWDDPXOWLSOLFDUSRU
FXDWURORVQLYHOHVEiVLFRVDODOFDQ]DUORV
DxRVGHYLGD
‡/DLQWURGXFFLyQGHQXHYDWHFQRORJtD
‡ (O GHVDUUROOR HVSHFWDFXODU GH WHFQRORJtDV \
WUDWDPLHQWRV FX\DV DSOLFDFLRQHV SUiFWLFDV
HVWiQVLHQGRFDGDYH]PiVGLItFLOHVGHVRSRUtar económicamente: transplantes de órganos
VyOLGRV\WHMLGRVQXHYRVIiUPDFRVGLVHxDGRV
y producidos por técnicas de ingeniería geQpWLFDLQFUHPHQWRGHDFWLYLGDGGHODFDUGLRORJtDLQWHUYHQFLRQLVWDHWF
‡3DWRORJtDVHPHUJHQWHV\UHHPHUJHQWHV
‡/DHPHUJHQFLDGHQXHYDVSDWRORJtDV\HOLQcremento de la incidencia de otras en relación con cambios medio-ambientales y socioculturales y con el propio desarrollo de la
SUiFWLFD FOtQLFD LQIHFFLRQHV HQ LQPXQRGHSULPLGRV6,'$EURQTXLWLVFUyQLFDSUHPDWXULGDG«
‡(OSURJUHVLYRLQFUHPHQWRGHOFRQVXPRGHUHcursos sanitarios
‡ /D JHQHUDOL]DFLyQ GH OD H[WHQVLyQ GH OD FREHUWXUDDOVHUODVDOXGXQDGHODVSULQFLSDOHV
preocupaciones de los ciudadanos de cualTXLHUSDtV
‡/DJHQHUDOL]DFLyQGHODmedicina defensiva
‡(VWDPRGDOLGDGLQWURGXFLGDHQODSUiFWLFDPpdica diaria surge como respuesta a la presión
social y a la judicialización de la asistencia
sanitaria.
3RU~OWLPRHVFRQYHQLHQWHHQXPHUDUDOJXQDV
UHFRPHQGDFLRQHVSDUDFRQVHJXLUODÀH[LELOLGDG
GHODRUJDQL]DFLyQVDQLWDULD 236 ‡5HHVWUXFWXUDUVyORHQIXQFLyQGHREMHWLYRV\
estrategias
‡&RORFDUODGHFLVLyQORPiVFHUFDSRVLEOHGHO
lugar de la acción
‡(YLWDUODH[LVWHQFLDGHQXPHURVRVQLYHOHVMHUiUTXLFRVYHUWLFDOHV
‡'LVPLQXLUDOPtQLPRHOQ~PHURGHMHIDWXUDV
intermedias
‡$WULEXLU PD\RU SRGHU GH GHFLVLyQ VREUH ORV
PHGLRVDORVUHVSRQVDEOHVSRUORV¿QHV
‡%XVFDUODFRKHUHQFLDGHOVLVWHPDSRUPHGLR
GHORVREMHWLYRV\QRPHGLDQWHODHVWUXFWXUD
de poder y autoridad
‡$FHSWDU XQD UD]RQDEOH VXSHUSRVLFLyQ GH DFWLYLGDGHV
‡ (YLWDU ODV JUDQGHV OtQHDV GH PDQGR TXH VLUYHQ SDUD ODV JUDQGHV GHFLVLRQHV SHUR VRQ
obstáculos para las decisiones diarias
‡$FHSWDU\HVWLPXODUODUHGGHFRPXQLFDFLRQHV
informales
‡8WLOL]DUDOPi[LPRJUXSRVGHWUDEDMRWHPSRrarios para el desarrollo de proyectos innoYDGRUHV
‡ ,QFRUSRUDU FLHUWD OLEHUWDG IXQFLRQDO SDUD OD
FUHDWLYLGDG\ODLQQRYDFLyQ
‡'HVFHQWUDOL]DUVLHPSUHFRQ¿DQGRHQODLQVWLtución y en sus funcionarios
‡(QXQPXQGRHQUiSLGRFDPELRXQDJUDQRUJDQL]DFLyQ FRPR ORV VLVWHPDV GH VDOXG HV
demasiado compleja para poder ser admiQLVWUDGDDWUDYpVGHPDQXDOHVUHVROXFLRQHV
GLVSRVLFLRQHV X RWUDV yUGHQHV GH VHUYLFLR
FHQWUDOL]DGDV 6HUtD OD ÀH[LELOLGDG HVWUXFWX- Supresión de prácticas ineficaces
UDORLQFOXVLYHODUHODWLYDIDOWDGHHVWUXFWXUD
OR TXH HQ GH¿QLWLYD JDUDQWL]D OD DGDSWDFLyQ ‡ (Q FRQWUDSRVLFLyQ D HVWH SDQRUDPD GHVcontinua a la coyuntura.
DOHQWDGRU SRGHPRV FRPSUREDU TXH GHILciencias de:
1 - Salud Pública, sistemas de servicios y organizaciones de la Salud Pública / 31
SODQL¿FDFLyQ GLVFRQWLQXLGDG HQ OD DWHQFLyQHQWUHHOQLYHOSULPDULRHVSHFLDOL]DGR\VRFLRVDQLWDULRHVFDVRGHVDUUROORGH
ODDWHQFLyQSUHYHQWLYD
- organización; desigual distribución de reFXUVRVHQWUHORVGLVWLQWRVQLYHOHVGHDWHQción
- gestión; presupuestos hospitalarios ajustados al gasto y no a la producción
SUiFWLFD FOtQLFD GLDULD HVFDVD LQÀXHQFLD
GHODHYLGHQFLDFLHQWt¿FD\GHOFRQFHSWR
FRVWRHIHFWLYLGDG HQ OD WRPD GH GHFLVLRnes clínicas
‡6XSRQHQFRQWLQXDVSUiFWLFDVLQH¿FDFHVFX\D
VXSUHVLyQ VLJQL¿FDUtD XQ LPSRUWDQWH DKRUUR
de costos.
Gestión hospitalaria
‡'HORVGHWHUPLQDQWHVGHODVDOXGHOVLVWHPD
VDQLWDULR LQÀX\H HQ HOOD XQ \ GHO WRWDO
GHO JDVWR TXH OD VDOXG JHQHUD FRQVXPH XQ
GHpVWHFRUUHVSRQGLHQGRPiVGHO
del mismo a la asistencia hospitalaria y meQRVGHODODDWHQFLyQSULPDULD
Recursos humanos
pVWDTXHGHEHEXVFDUODH[FHOHQFLDHQVXIXQcionamiento.
‡ /RV GLIHUHQWHV SODQWHDPLHQWRV GH RUJDQL]DFLyQLQWHUQDGHORVKRVSLWDOHVODVGLIHUHQWHV
WDUHDVDGHVDUUROODUGHQWURGHHTXLSRVKRPRJpQHRVODSULRULGDGGHGLIHUHQWHVDVSHFWRVHQ
HOWUDEDMRGLDULRGHORVVHUYLFLRV\ODQHFHVLdad de compatibilizar los puestos de trabajo
FRQ ODV H[SHFWDWLYDV GH GHVDUUROOR SURIHVLRQDO\SHUVRQDOGHORVWUDEDMDGRUHVSDUDHYLWDU
la frustación y obtener rendimientos adecuaGRVHYLGHQFLDQODQHFHVLGDGGHGLVSRQHUGH
la posibilidad de elegir a las personas adecuadas para cada proyecto.
‡3RUORWDQWRXQDYH]GHPRVWUDGDODLGRQHLGDGH
LJXDOGDG GH FRQRFLPLHQWRV FLHQWt¿FRWpFQLFRV
HQWUHORVFDQGLGDWRVVHQHFHVLWDUtDTXHODOHJDOLGDGYLJHQWH\HOFRQVHQVRVRFLDOSHUPLWLHVHQ
ODHOHFFLyQGHOSHUVRQDODFDGDKRVSLWDOVREUH
ODEDVHGHEDUHPRVREMHWLYRVTXH consigan eleJLUGHHQWUHORVDVSLUDQWHVDDTXHOORVFRQODVDStitudes más adecuadas para el puesto.
‡ 6HOHFFLRQDGR HO SHUVRQDO OD SROtWLFD GH UHFXUVRV KXPDQRV GLVHxDGD GHEH WHQHU OD ¿QDOLGDG
GHFRQVHJXLUTXHpVWHSHUPDQH]FDLPSOLFDGR\
FRPSURPHWLGRFRQHOIXQFLRQDPLHQWRGHOFHQWUR
realizando adecuadamente sus tareas diarias.
‡(OKRVSLWDOS~EOLFRGHKR\HQGtDHVXQDHP- Aspectos clave
SUHVD GH VHUYLFLRV TXH SURGXFH VDOXG FX\R Salario
¿QQRHVDOFDQ]DUXQUHQGLPLHQWRHFRQyPLFR ‡'HEHUtDDVHJXUDUODFREHUWXUDGHODVQHFHVLGDGHV ¿VLROyJLFDV HOHPHQWDOHV GHO SHUVRQDO
sino una rentabilidad social.
VDQLWDULRGH¿QLGDVVHJ~QORVPtQLPRVDFHS‡&RPRHQWRGDHPSUHVDGHVHUYLFLRVHOFDSLtados por cada sociedad conforme al conceptal humano es su recurso más importante y
WRFROHFWLYRGHHVWDGRGHELHQHVWDUSUHGRPLFODUDPXHVWUDGHHOORHVTXHHQWRUQRDO
nante en cada momento.
de su presupuesto se gasta en el capítulo de
‡ 'HEHUtD UHÀHMDU OD SRVLFLyQ TXH HO SHUVRQDO
personal.
sanitario ocupa en la sociedad por su forma‡ /DV GHFLVLRQHV PiV LPSRUWDQWHV SDUD ORV
ción y responsabilidad.
usuarios y para el prestigio del hospital son
ODVTXHWRPDQORVPpGLFRV\HOSHUVRQDOGH ‡/DVRFLHGDGGHEHFXLGDUDORVTXHFXLGDQGH
sus enfermos.
enfermería en el acto asistencial.
‡ 'HEHUtD UHFRJHU ODV VLPLOLWXGHV D LJXDO KR‡6RQpVWRVORVDXWpQWLFRVJHVWRUHVGHORVVHUUDULR\QLYHOLJXDOVDODULR \ODVGLIHUHQFLDV
YLFLRV SUHVWDGRV SRU HO FHQWUR WDQWR HQ VX
UHVSRQVDELOLGDGHV GH SXHVWRV GH WUDEDMR
HIHFWLYLGDG PHMRUDGHODVDOXG FRPRHQVX
FRQVHFXFLyQ GH REMHWLYRV GH ORV GLYHUVRV
H¿FLHQFLD DOPHQRUFRVWR \FDOLGDG
SXHVWRVGHWUDEDMRORTXHVHUHDOL]DUtDDWUD‡ 3RU OR WDQWR HV HYLGHQWH TXH OD SROtWLFD GH
YpVGHODYDORUDFLyQGHWDUHDV\ORVLQFHQWLrecursos humanos de un hospital debe ser su
YRVSRUREMHWLYRV
principal herramienta de gestión.
‡/DHOHFFLyQGHOSHUVRQDODGHFXDGRTXHFXPSOD ORV UHTXLVLWRV SUHYLDPHQWH GH¿QLGRV HQ Motivaciones
cuanto a aptitud y actitud ante el trabajo a
‡6LQHPEDUJRXQVDODULRTXHPRWLYHQRHVSRUVt
GHVDUUROODU HV OD FODYH GHO EXHQ IXQFLRQDVRORVX¿FLHQWHSDUDTXHH[LVWDPRWLYDFLyQHQHO
PLHQWR GH XQD HPSUHVD GH VHUYLFLRV FRPR
desempeño de las tareas en el puesto de trabajo.
32 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
‡+D\RWURVIDFWRUHVGHORVTXHVHGHEHLQWHQtar dotar al puesto de trabajo para conseguir
implicar al personal en la marcha de la emSUHVD DXWRQRPtD WRPD GH GHFLVLRQHV IRUmación continuada...
La gestión y el personal
‡(O SHUVRQDO PpGLFR \ GH HQIHUPHUtD VXSRQH
DSUR[LPDGDPHQWH HO GH OD SODQWLOOD GH
los hospitales y son los auténticos gestores
GHORVVHUYLFLRVSUHVWDGRV HOGHORVUHcursos sanitarios lo asignan los profesionaOHVIXQGDPHQWDOPHQWHPpGLFRVHQVXVGHFLVLRQHVGLDJQyVWLFDV\WHUDSpXWLFDV ‡ 3RU HOOR HV XQ DVSHFWR FODYH GH OD JHVWLyQ
de los recursos humanos conseguir no sólo
OD PRWLYDFLyQ GH HVWRV SURIHVLRQDOHV HQ VX
SXHVWRGHWUDEDMRVLQRODLPSOLFDFLyQGHORV
mismos con la institución y sus principios
básicos de asistencia.
‡6HGLFHTXHDOFDQ]DGRXQVDODULRTXHSHUPLWD XQ QLYHO GH YLGD DFRUGH FRQ XQ SUHVWLJLR
VRFLDOFDQWLGDGHVVXSHULRUHVQRFRQVHJXLUiQ
TXHDXPHQWHODPRWLYDFLyQRODLPSOLFDFLyQ
con la empresa.
‡$OFDQ]DGRHVWHSXQWRSDUDODLPSOLFDFLyQHV
más importante conseguir la autodeterminación en el trabajo y el reconocimiento social
y de los pares.
‡ $TXt VH GHEHQ LQWURGXFLU PHFDQLVPRV TXH
aseguren la consecución de estos logros y
el principal de ellos es la implantación de
la carrera profesional en la organización del
SHUVRQDOGHOKRVSLWDOORTXHSHUPLWHHQWURQcar la política de recursos humanos con el
siguiente pilar básico de la gestión hospitalaria: las áreas clínicas.
Áreas clínicas
Aspectos clave
La característica principal de las empresas saQLWDULDVHVTXHODVGHFLVLRQHVGHLQWHUpVSDUDHO
correcto funcionamiento de los hospitales no se
toman en las cúpulas de los organigramas sino
en las bases de los mismos.
‡(VWDLQYHUVLyQGHODSLUiPLGHGHPDQGRHVOD
EDVH FRQFHSWXDO GH OR TXH KR\ FRQRFHPRV
FRPR*(67,Ï1&/Ë1,&$\ODMXVWL¿FDFLyQ
para acercar la gestión al acto en donde se
toman las decisiones y de implicar al agente
TXHODVGHEHWRPDU
‡/D FDUDFWHUtVWLFD IXQGDPHQWDO GH HVWD IRUPD
GHJHVWLyQHVODFRQ¿DQ]DEDVDGDHQODrela-
ción de interés mutuo y en la doble función
GHOPpGLFRWDQWRORVTXHJHUHQFLDQDGPLQLVWUDWLYDPHQWHFRPRORVHQIHUPRVGHSRVLWDQVX
FRQ¿DQ]DHQpOXQRVSDUDTXHVHXWLOLFHQORV
recursos necesarios para realizar correctaPHQWHVXIXQFLyQ\ORVRWURVSDUDTXHKDJDQ
lo necesario para curarlos o mejorarlos.
‡(VWDUHODFLyQVHURPSHVLODFRQ¿DQ]DUHVXOWD
GHIUDXGDGD GHPRVWUDGDSRUFLIUDVTXHLQIRUPHQVREUHODFDQWLGDGFDOLGDG\JDVWRHQXQ
FDVR \ REMHWLYDGD SRU FDXVDV LPSXWDEOHV DO
PpGLFRHQHORWUR ‡ (Q DPERV FDVRV SDUD XQ ySWLPR IXQFLRQDPLHQWR GHO KRVSLWDO HO JHUHQWH SUHFLVD GH
autoridad legal y reconocida para romper la
UHODFLyQHVWDEOHFLGD\SDUDJDUDQWL]DUTXHOD
institución cuenta con profesionales de con¿DQ]DSDUDODDWHQFLyQGHVXVXVXDULRV
‡ (VWH SDSHO HVHQFLDO HQ OD DVLVWHQFLDJHVWLyQ
VDQLWDULDVHGHVDUUROODSOHQDPHQWHDWUDYpVGH
ODFDUUHUDSURIHVLRQDOTXHGRWDGHFRQWHQLGR
esta doble función del médico:
)XQFLyQ GH JHVWLyQ UHSUHVHQWDGD SRU HO
FDUJR \ VHQVLEOH D OD DFWLYLGDG JDVWR \
calidad percibida
)XQFLyQ GH DVLVWHQFLD VDQLWDULD DVXPLGD
por la categoría y sensible a la calidad
FLHQWt¿FRWpFQLFD
‡$VtHOPpGLFRHQVXGREOHIXQFLyQGHFDUJR\
GHFDWHJRUtDWHQGUiLQWHUpVSRUODDFWLYLGDG
HOJDVWR\ODFDOLGDGLQWHJUDO\DTXHVXSHUmanencia en el cargo y ascenso en la categoría dependería de ello.
‡6HUiQSXHVODViUHDVFOtQLFDVODVUHVSRQVDEOHV
GHODRUJDQL]DFLyQGHODDVLVWHQFLDTXHYDQD
prestar y para ello deben trabajar con una seULHGHSUHPLVDVSUHYLDPHQWHFRQVHQVXDGDV
Premisas consensuadas
‡ 7RGD OD RUJDQL]DFLyQ HVWDUi FHQWUDGD HQ OD
DWHQFLyQDOSDFLHQWHTXHGHEHVHUYLVWRPiV
FRPREHQH¿FLDULRTXHFRPRSDFLHQWH
‡$VSHFWRVGHFDOLGDGSHUFLELGD±FRPRHOWUDWRODSXQWXDOLGDG\ODDGHFXDGDLQIRUPDFLyQ
HQ WLHPSR \ IRUPD± DGTXLULUiQ LPSRUWDQFLD
similar a la preocupación por la calidad cienWt¿FRWpFQLFD
‡/DDFWLYLGDGGHEHVHUSODQL¿FDGDSUHYLDPHQte y se establecerán los recursos humanos y
PDWHULDOHVQHFHVDULRVSDUDOOHYDUODDFDER
‡/DJHVWLyQGHOiUHDQRVyORDEDUFDUiORFRQcerniente a la atención del paciente en el cenWURKRVSLWDODULR\DTXHVXUHVSRQVDELOLGDGVH
1 - Salud Pública, sistemas de servicios y organizaciones de la Salud Pública / 33
H[WHQGHUiDODFRUUHFWDDWHQFLyQGHVXVSDWR- Dirección
ORJtDVFRUUHVSRQGLHQWHVGHVGHODSUHYHQFLyQ ‡(QHVWHVLVWHPDGHVFHQWUDOL]DGRODVIXQFLRQHV
primaria hasta la asistencia sociosanitaria de
GH OD GLUHFFLyQ GHO KRVSLWDO DGTXLHUHQ XQD
las mismas.
importancia cardinal.
‡ &RQFHSWXDOPHQWH HO JLUR HV FRSHUQLFDQR
‡3DUDHOORVHRUJDQL]DUiODDVLVWHQFLDKRVSLWDlaria de los pacientes y se deberá liderar la
de una dirección planificadora y controladora del gasto se pasaría a una dirección
adecuada organización de las otras fases de
auditora sistémica y facilitadora de las acODDVLVWHQFLDFRQORVQLYHOHVGHDWHQFLyQSULWLYLGDGHV
maria y sociosanitaria.
‡/DWDUHDHVGLItFLO\H[LJHFRQRFLPLHQWRVDGH‡/DDWHQFLyQFOtQLFDGHEHHVWDUGH¿QLGDSRUSDFXDGRV\KDELOLGDGHVSHUVRQDOHVTXHSHUPLUiPHWURV GH FDOLGDG \ H¿FLHQFLD KDFLpQGRVH
WDQ GHVHPSHxDU HVWH QXHYR FRPHWLGR HQ XQ
DTXHOORTXHVHWLHQHTXHKDFHU\VXSULPLHQGR
entorno de delegación de funciones y resprácticas y tiempos de atención no indicados.
ponsabilidades.
‡6HHODERUDUiQJXtDVGHSUiFWLFDFOtQLFDRYtDV
FOtQLFDV TXH SHUPLWDQ DVHJXUDQGR XQD FDOLGDG FLHQWt¿FRWpFQLFD VHJ~Q OD HYLGHQFLD Nuevas funciones de la Dirección
‡ (VWDEOHFHU ORV FRQFHSWRV HVWUDWpJLFRV EiFLHQWt¿FD DFWXDO UHDOL]DU DVLVWHQFLDV FRVWR
VLFRV DOUHGHGRU GH ORV TXH VH RUJDQL]DUi HO
HIHFWLYDV
IXQFLRQDPLHQWR GHO KRVSLWDO D WUDYpV GH VXV
‡6HDVHJXUDUiHOUHJLVWURGHODDFWLYLGDGUHDOL]DGDORTXHSHUPLWLUiPHGLUSDUDFRPSDUDU
GLIHUHQWHViUHDVFDOLGDGLQWHJUDOH¿FLHQFLD
\HQFRQVHFXHQFLDSDUDUHFRPSHQVDURVDQDWHQFLyQFHQWUDGDHQHOSDFLHQWHJHVWLyQLQWHJUDGDGHODVSDWRORJtDVHWF
cionar.
‡/DDFWLYLGDGGRFHQWHHLQYHVWLJDGRUDGHEHVHU ‡ 6HOHFFLRQDU ODV QHFHVLGDGHV GH LQIRUPDFLyQ
SDUDSRGHUHYDOXDU
LJXDOPHQWHSODQL¿FDGDTXHODDVLVWHQFLDO
- La adhesión de las diferentes áreas a los
SULQFLSLRVEiVLFRVSUHGH¿QLGRV
Papel de los Jefes de Servicio
- La asistencia clínica realizada en todas sus fa‡ (VWD WUDQVIHUHQFLD GH UHVSRQVDELOLGDGHV \
FHWDV WDQWRGHSURGXFFLyQFRPRGHFDOLGDG
riesgos obliga a un cambio en las relaciones
/DDFWLYLGDGGRFHQWHHLQYHVWLJDGRUD
de las personas entre sí y con la dirección de
‡(VWDHYDOXDFLyQGHEHVHUFRQWLQXDWHQLHQla Organización de Atención de la Salud.
GR FRPR UHIHUHQFLD QLYHOHV PtQLPRV GH
‡(O-HIHGH6HUYLFLRFDPELDVXSDSHOWUDGLFLRREOLJDGR FXPSOLPLHQWR SUHYLDPHQWH DFRUnal por otro más cercano al de un gestor sanitario\VXVFRODERUDGRUHVVHFRQYLHUWHQHQ
dados.
sus socios de gestión.
‡(OVHJXLPLHQWRGHOFXDGURGHPDQGRV\ODGL‡(VWRLPSOLFDODQHFHVLGDGGHDGTXLULUQXHYDV
UHFFLyQSRUREMHWLYRVVRQODVSULQFLSDOHVKHKDELOLGDGHV SHUVRQDOHV SRU SDUWH GH WRGRV
UUDPLHQWDVSDUDOOHYDUDFDERHVWDWDUHD
ORVDJHQWHVDIHFWDGRVSRUHOFDPELRTXHOHV ‡(VWDEOHFHUPHFDQLVPRVGHFRUUHFFLyQGHODVGHVSHUPLWDQ GHVDUUROODU VXV QXHYDV IXQFLRQHV
YLDFLRQHV GHWHFWDGDV TXH GHEHQ VHU DFHSWDGRV
con competencia.
SRUODRUJDQL]DFLyQHQODVFRQGLFLRQHVGHDFWLYDFLyQGHpVWRVTXHSUHYLDPHQWHVHDFXHUGHQ
Tablero de Comando
‡ $VHJXUDU XQD FRKHUHQFLD RUJDQL]DWLYD XQ
‡8QBalanced scorecard¿QDOHYDOXDUiHOIXQHTXLOLEULR HQWUH ODV GLYHUVDV iUHDV FRQ LQcionamiento del área.
GHSHQGHQFLD GHO SHVR DVLVWHQFLDO TXH SXHGD
‡(QpOQRVyORFRQVWDUiQLQJUHVRV\JDVWRVVLQR
WHQHU FDGD XQD GH HOODV FHUFLRUiQGRVH GHO
WDPELpQODUHQWDELOLGDGVRFLDO GH¿QLGRVSUHcumplimiento de unos mínimos organizatiYLDPHQWH ORV tWHPV TXH HYDOXDVHQ HVWH FRQYRVEiVLFRVGHFDGDiUHD
FHSWR FRQVHJXLGRVHQHOSHUtRGRSDFWDGR
‡ 3RVWHULRUPHQWH HO VLVWHPD VH DXWRUUHJXODUi
‡ /DV iUHDV FOtQLFDV rentables en términos de
pero siempre por encima de estos mínimos y
salud se recompensarían según mecanismos
GHHVWHHTXLOLEULREiVLFRLQDPRYLEOH
SUHYLDPHQWHHVWDEOHFLGRV\ODVno rentables
‡/D IRUWDOH]D GH XQD HPSUHVD VH PLGH SRU OD
VHVDQFLRQDUiQVLQTXHHOORVXSRQJDXQGHdebilidad de su eslabón más frágil.
trimento en la atención de los usuarios con
‡)DFLOLWDUODUHODFLyQHQWUHODVGLIHUHQWHViUHDV
estas patologías.
DUELWUDQGRHQORVFRQÀLFWRVTXHVXUMDQ\ID-
34 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
FLOLWDQGR OD FRRUGLQDFLyQ FRPXQLFDFLyQ \
cooperación entre ellas.
‡6HUiHOyUJDQRUHVSRQVDEOHGHYHUDOKRVSLWDO
FRPRXQWRGRGHHQVDPEODUHOVLVWHPD
‡/DUHSUHVHQWDFLyQH[WHUQDGHODLQVWLWXFLyQHQ
GLIHUHQWHVIRURV\VREUHWRGRFRQORV¿QDQFLDGRUHVTXHPDQWHQLHQGRODFRKHUHQFLDGHO
sistema deberían delegar responsabilidades y
FDSDFLGDG GH JHVWLyQ SRU OR WDQWR ULHVJRV VREUH ORV JHUHQWHV GH ORV FHQWURV D FDPELR
GHO FXPSOLPLHQWR GH REMHWLYRV SUHGH¿QLGRV
\PHGLEOHVTXHSHUPLWDQODUHFRPSHQVDROD
sanción.
Gestión integrada de las patologías
‡ (VWH ~OWLPR SLODU GH OD RUJDQL]DFLyQ KRVSLtalaria pretende hacer coincidir la atención
GHGLYHUVDVSDWRORJtDVFRQVXFXUVRQDWXUDO
LQGHSHQGLHQWHPHQWH GHO QLYHO GH DWHQFLyQ
UHVSRQVDEOH GH OD DVLVWHQFLD GHVGH HO OLGHUD]JR TXH HO KRVSLWDO RVWHQWD HQ HO VLVWHPD
sanitario.
‡/DDVLVWHQFLDVDQLWDULDGHEHVHUXQFRQWLQXR
VLQGHVFRQH[LRQHVHQODDWHQFLyQHQODTXH
el cuidado de la salud empieza desde el moPHQWR HQ TXH pVWD VH WLHQH SDUD HYLWDU TXH
VHSLHUGD\WHUPLQDHQHOWUDWDPLHQWRGHODV
VHFXHODVTXHSURGXFHODHQIHUPHGDG
‡/DDFWXDFLyQEDVDGDHQODHYLGHQFLDFLHQWt¿FD
actual y coordinada con la atención primaria
\VRFLRVDQLWDULDUHYHUWLUiHQEHQH¿FLRVIiFLOPHQWHREMHWLYDEOHVSDUDHOVLVWHPD\SDUDORV
usuarios.
‡7RGRHOORVXSRQGUiXQDPHMRUDGHFXDFLyQGHO
FRQVXPRGHORVUHFXUVRVVDQLWDULRVH[LVWHQWHV
‡ /D DFWXDFLyQ FRRUGLQDGD HQ SODQHV GH SUHYHQFLyQSULPDULD\VHFXQGDULDGLVPLQXLUiOD
incidencia de enfermedades o las detectará
HQHVWDGLRVPiVSUHFRFHVFRQHOFRQVLJXLHQWHDXPHQWRGHODVXSHUYLYHQFLDGHODSREODción.
‡/DDFWXDFLyQFRRUGLQDGDHQSODQHVGHSUHYHQFLyQWHUFLDULDPHMRUDUiODFDOLGDGGHYLGDGH
los pacientes afectos de una patología.
‡/DDFWXDFLyQSURWRFROL]DGDFRQDPERVQLYHles de atención permitirá establecer los puntos de asistencia apropiados a cada patoloJtDHQFDGDPRPHQWRLQWHQWDQGRDFHUFDUOD
atención al paciente y optimizando las deriYDFLRQHV
‡ 7RGR HOOR VXSRQGUi XQD PHMRU DGHFXDFLyQ
GHOFRQVXPRGHORVUHFXUVRVVDQLWDULRVH[LVtentes.
‡/DPHGLGDGHORVUHVXOWDGRVREWHQLGRVFRQOD
LQWHJUDFLyQGHODDWHQFLyQTXHSHUPLWLUiQOD
UHFRPSHQVDVDQFLyQVHJ~QORVREMHWLYRVSUHYLDPHQWH FRQVHQVXDGRV VH UHDOL]DUi D GRV
QLYHOHV
(QSULPHUOXJDUDWUDYpVGHUHVXOWDGRVLQWHUPHGLRV FRPR OD GHWHUPLQDFLyQ GH ODV
GHULYDFLRQHVGHSULPDULDDHVSHFLDOL]DGD\
la solicitud de pruebas diagnósticas con su
correspondiente adecuación a protocolo.
(Q VHJXQGR OXJDU D WUDYpV GH UHVXOWDGRV
¿QDOHV FRPR OD PHGLFLyQ GH OD FDOLGDG
GHYLGDUHODFLRQDGDFRQODVDOXGODPHGLFLyQGHWDVDVGHSUHYDOHQFLDGHFLHUWDV
HQIHUPHGDGHVRODYDULDFLyQGHODVXSHUYLYHQFLDGHODSREODFLyQ
(QUHVXPHQSDUDORVH[SHUWRV
En un sistema de asistencia sanitaria en
HOTXHHOJDVWRQRHV¿QLWRORVFDPELRVHQHO
YROXPHQ \ OD LQWHQVLGDG GH OD SUiFWLFD FOtQLFD
son los principales factores del aumento de los
FRVWRV 3RU OR WDQWR OD DGHFXDFLyQ GH GLFKD
SUiFWLFD FOtQLFD D DFWXDFLRQHV FRVWRHIHFWLYDV
VHJ~Q OD HYLGHQFLD FLHQWt¿FD \ OD DGHFXDFLyQ
GHODRUJDQL]DFLyQVDQLWDULDSDUDFRQVHJXLUOD
ySWLPD DVLVWHQFLD GH ORV SDFLHQWHV LQWHJUDQGR
ODDWHQFLyQGHODVSDWRORJtDVSHUPLWLUtDPDQWHner el actual sistema con sus características de
XQLYHUVDOLGDG\HTXLGDGHQORVDxRVYHQLGHURV
\HVWHREMHWLYRGHEHUtDVHUXQGHEHUPRUDOSDUD
FRQ ODV JHQHUDFLRQHV IXWXUDV WDQWR GH ORV LPplicados en la gestión de la sanidad como de
los usuarios de la misma.
(Q HVWH FRQWH[WR ORV KRVSLWDOHV VH SUHVHQWDQ FRPR OD RUJDQL]DFLyQ PiV FRPSOHMD TXH
SDUWLFLSDHQODSUHVWDFLyQGHVHUYLFLRVGHVDOXG
6XV IXQFLRQHV KDQ DWUDYHVDGR XQ SHUtRGR GH
UiSLGRV FDPELRV D PHGLGD TXH HO PRGHOR GH
DWHQFLyQKDLGRDOWHUDQGRHOHTXLOLEULRHQWUHOD
atención de pacientes hospitalizados y la atenFLyQDPEXODWRULD\KDQDXPHQWDGRODVSUHVLRQHV ¿QDQFLHUDV 3RU OR WDQWR OD FXHVWLyQ PiV
GLItFLOTXHVHGHEHUHVROYHUHVHQFRQWUDUODIRUPDGHLQWHJUDUORVVHUYLFLRVKRVSLWDODULRVHQHO
VHQRGHOVLVWHPDGHVDOXGORTXHHVWiDOWHUDQGR
LQGHIHFWLEOHPHQWHODSRVLFLyQTXHpVWRVRFXSDQ
HQpO 236 (Q VtQWHVLV ORV FDPELRV LPSRQHQ DO DGPLnistrador capacidades y desafíos cada día más
FRPSOHMRVHQGRQGHVHGHVWDFDQORVVLJXLHQWHV
HOHPHQWRV %HUQDFFKLQL 1 - Salud Pública, sistemas de servicios y organizaciones de la Salud Pública / 35
Organización, gestión y proceso de cambio
Las reformas en salud ya no son procesos con
XQSULQFLSLR\XQ¿QDOVLQRPRYLPLHQWRVFRQWLQXRVTXHH[LJHQXQDH[WUDRUGLQDULDFDSDFLGDG
GHDSHUWXUDPHQWDOGHVXVSURWDJRQLVWDV SURIHVLRQDOHV\JHVWRUHV HLJXDOÀH[LELOLGDGRUJDQL]DWLYDGHODVLQVWLWXFLRQHVHQFDUJDGDVGHDVHJXrar a la población su atención de salud.
A los factores de cambio hasta ahora conocidos:
WUDQVLFLyQGHPRJUi¿FD
- transición epidemiológica
H[SDQVLyQGHODWHFQRORJtD
- presión sobre los costos
VH VXPDQ DKRUD IDFWRUHV HPHUJHQWHV GH H[traordinaria importancia.
/DVWUDQVIRUPDFLRQHVTXHVHKDREVHUYDGRHQ
las instituciones de salud forman parte de un moYLPLHQWRPiVDPSOLRTXHKDLQFOXLGRWDQWRDHPSUHVDVGHELHQHVFRPRGHVHUYLFLRV/RVHOHPHQWRVTXHFDUDFWHUL]DQORTXHSRGUtDGHQRPLQDUVHOD
JHVWLyQ PRGHUQD HQ FRPSDUDFLyQ FRQ OD JHVWLyQ
WUDGLFLRQDOKDQVLGRFRQFHSWXDOL]DGRVSRUDOJXQRV
autores como gestión de cuarta generación. Los
FRPSRQHQWHVTXHVHLQFOX\HQHQHVWHFRQFHSWRVRQ
ODJHVWLyQGHFDOLGDGTXHSRQHHODFHQWRWDQWRHQ
SURFHVRVFRPRHQSURGXFWRVHOWUDEDMRHQHTXLSR
TXH EXVFD FRPSURPHWHU ORV DSRUWHV GH WRGRV ORV
integrantes de las organizaciones con sus objetiYRV\HOXVRGHSUXHEDVFLHQWt¿FDV evidence HQOD
toma de decisiones de gestión para hacer las cosas
GHODPHMRUPDQHUDSRVLEOH 236 Se trata de comprometer a los ciudadanos
HQVXSURSLRELHQHVWDU\SURWHFFLyQDGRSWDQdo el Estado un papel facilitador y redistribuidor.
Homologación progresiva
de la oferta asistencial
En un sistema con libre circulación de trabajadores y ciudadanos entre subsectores y jurisdicFLRQHVGLItFLOPHQWHFDEHHVSHUDUTXHHODFFHVRD
la salud sea diferenciado.
Esto traerá como consecuencia una homoloJDFLyQSURJUHVLYDGHODRIHUWDDVLVWHQFLDOGHOD
contribución de los ciudadanos y del consumo y
SUHFLRVGHSURGXFWRV\VHUYLFLRV
Estos vasos comunicantes sortearán listas de
HVSHUDSURFXUDUiQPHMRUHVVHUYLFLRVRVHSDJDUi
menos.
(QODHYROXFLyQTXHKDQSUHVHQWDGRORVVLVWHPDV GH VDOXG VH KD HVWDGR SURGXFLHQGR XQ
FDPELROHQWRHQODRULHQWDFLyQGHORVVHUYLFLRV
GHVGH XQD VLWXDFLyQ HQ TXH VH KDFtD KLQFDSLp
en los productos hacia un mayor énfasis en la
orientación al usuario.
Tecnología de la información
La globalización y popularización de las redes
GH LQIRUPDFLyQ HO PDQHMR PDVLYR GH LQIRUPDción y el abaratamiento de los costos de uso
plantean ya diferentes retos.
La información desempeña un papel esWUDWpJLFR TXH GHEH VHU HQIDWL]DGR (O HQIRTXH
Revisión del papel del Estado
HVWUDWpJLFRFRQVLGHUDHQWUHRWURVODSODQL¿FDFLyQHOFRQWURO\ODFRPXQLFDFLyQHQORVTXH
7RGRV ORV SDtVHV HVWiQ UHIRUPXODQGR HO SDSHO el sistema de información es considerado como
del Estado con respecto a la protección social XQ LQVXPR 1R REVWDQWH WDPELpQ H[LVWH XQD
y la distribución de oportunidades de sus ciu- JHVWLyQ GH OD LQIRUPDFLyQ TXH DFW~D FRPR LQdadanos.
VXPRTXHSHUPLWHSODQL¿FDU\TXHDXQWLHPSR
Reenfocan su actuación hacia políticas de ha de ser gestionada.
HTXLGDG UHJXODFLyQ \ HVWDELOLGDG ¿QDQFLHUD GH
Permitirá controlar y optimizar mejor los
ODFREHUWXUDGHORVVHUYLFLRVS~EOLFRV
SURFHVRV SDUD DFHOHUDU FLUFXLWRV GLDJQyVWLFRV
/DJHVWLyQGLUHFWDGHORVVHUYLFLRVVHWUDVOD- HYDOXDU PHMRU ODV SUiFWLFDV FOtQLFDV LQGLYLGXDGDSURJUHVLYDPHQWHGHXQDXRWUDPDQHUDKD- OHV \ HYDOXDU PiV FHUWHUDPHQWH ORV UHVXOWDGRV
FLDODVRFLHGDGFLYLO\ODLQLFLDWLYDSULYDGD
clínicos y económicos de cada unidad y centro
La regulación del sistema de salud trata de asistencial.
ordenar su funcionamiento para responder al
GREOH REMHWLYR SULPHUR JDUDQWL]DU XQ DFFHVR Ciudadanos más autónomos
HTXLWDWLYR D XQD DWHQFLyQ VDQLWDULD GH FDOLGDG
\VHJXQGRDVHJXUDUODH¿FLHQFLDHFRQyPLFDGHO 7UDHUiFRPRFRQVHFXHQFLD
VLVWHPD \ GH HVD PDQHUD HYLWDU OD GLODSLGDFLyQ ‡XQSDFLHQWHPHMRUHGXFDGRPiVPD\RUSHUR
de recursos.
también más sano
36 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
‡XQDFRPXQLGDGTXHVHFRPSRUWDFRPRVRFLHdad de consumo en salud y plantea un mayor
pQIDVLVHQORVGHUHFKRVLQGLYLGXDOHV
‡ PHQRU WROHUDQFLD D HVSHUDV WUDWR LQFRUUHFWR IDOWD GH LQIRUPDFLyQ YDULDELOLGDG HQ ODV
SUiFWLFDVQHJOLJHQFLD\UHVXOWDGRVDGYHUVRV
‡ /D UHGXFFLyQ GH OD UHG GH VRSRUWH IDPLOLDU
implicará demandas adicionales de cuidados
GHVDOXGHQHOWHUFHUQLYHOHQGHWULPHQWRGH
redes más ligadas al tratamiento de agudos.
Fuertes presiones sobre
las prácticas clínicas
La práctica clínica deberá fundamentar el soporWHWHyULFRGHVXVGHFLVLRQHV 0HGLFLQDEDVDGDHQ
OD(YLGHQFLD Deberá ajustar las decisiones clínicas con el
PHMRU XVR GH ORV UHFXUVRV GLVSRQLEOHV GHPRVWUDUH¿FDFLD\VHJXULGDGGHORVSURFHGLPLHQWRV\
mostrar sensibilidad hacia las decisiones informadas de los pacientes.
7HQGUiPiVLPSRUWDQFLDODJHVWLyQGHOFRQRFLPLHQWRFRQLQFHQWLYRVEDVDGRVHQUHVXOWDGRV\
QRHQSURGXFFLyQVLVWHPDVGHSURPRFLyQEDVDGRVHQFHUWL¿FDFLyQ\GHVDUUROOR
Nunca se ha sometido a tanta tensión la gesWLyQGHVDOXGHQWHPDVWDQGHOLFDGRVWDQWRSRU
VXVLPSOLFDQFLDVpWLFDVFRPRDQWHODH[LJHQFLD
internacional por la contención de costos de los
VHUYLFLRVGHVDOXGVLQTXHHOORPHQRVFDEHODFDOLGDG\ODHTXLGDG(VWRHVHVSHFLDOPHQWHFLHUWR
HQHOiUHDGHODDWHQFLyQWHUFLDULDGRQGHVHJDVWDQJUDQSDUWHGHORVUHFXUVRVVDQLWDULRVGDGRVHO
SHU¿OHSLGHPLROyJLFR\GHPRJUi¿FRHOPRGHOR
GHDWHQFLyQ\ORVDYDQFHVWHFQROyJLFRVSUHYDOHcientes.
Aceleración del desarrollo tecnológico
7UDHUiFRQVLJRQXHYDVSUHVLRQHVVREUHORVFRVWRV\HOHPHQWRVFXDOLWDWLYDPHQWHGLIHUHQWHV
‡0HGLFLQD\FLUXJtDYLGHRDVLVWLGDVPLQLDWXULzación y telemedicina
‡%XHQDSDUWHGHODDVLVWHQFLDSDVDUiGHOKRVSLtal a un centro de salud ambulatorio o incluso
al domicilio del paciente
‡ OD LUUXSFLyQ GH OD ELRWHFQRORJtD \ OD JHQpWLFD FOtQLFD WUDHUi FRQVLJR UHYROXFLRQHV HQ
HO WUDWDPLHQWR GH FLHUWDV HQIHUPHGDGHV
DSDULFLyQ GH QXHYDV YDFXQDV \ QXHYDV SRsibilidades terapéuticas para patologías hoy
incurables.
/DIXQFLyQ\ODDFWLYLGDGGHOKRVSLWDOHQHVWH
FRQWH[WRGHEHUiHVWDUGH¿QLGD\HVWUHFKDPHQWH
coordinada con las entidades sanitarias restantes como respuesta integral a las necesidades
GHODSREODFLyQ3RUHMHPSORKR\ODKRVSLWDOL]DFLyQFRQYHQFLRQDOFOiVLFDQRHVPiVTXHXQD
de las modalidades de tratamiento disponibles.
3DUDUHVSRQGHUDODVH[SHFWDWLYDVGHORVSDFLHQWHVPHMRUDUODFDOLGDGUHGXFLUORVULHVJRV\ORV
FRVWRV HO VLVWHPD GH VDOXG HVWi DGDSWDQGR ODV
PRGDOLGDGHV GH WUDWDPLHQWR HQ ORV KRVSLWDOHV
priorizando la cirugía ambulatoria y prograPDQGRVXVSUHVWDFLRQHVWHQLHQGRHQFXHQWDORV
días de internación promedio de los pacientes
ingresados.
Mejora de la calidad de vida
&RPLHQ]DDDSDUHFHUXQQXHYRFRQFHSWRGHVDOXG PiV YLQFXODGR QR VyOR D OD FXUDFLyQ GH OD
enfermedad sino a la mejora de la calidad de
YLGD life enhancement
'XUDQWHODV~OWLPDVGpFDGDVODVLWXDFLyQGH
la salud ha seguido mejorando de manera contiQXDGD(OORHVUHÀHMRGHGLYHUVRVIDFWRUHVVRFLDOHV DPELHQWDOHV FXOWXUDOHV \ WHFQROyJLFRV DVt
FRPR GH OD PD\RU GLVSRQLELOLGDG GH VHUYLFLRV
de atención a la salud y de programas de salud
pública.
Esto producirá una frontera más difusa entre
salud y bienestar.
(VWRSUHVHQWDUiLPSRUWDQWHVFRQÀLFWRVpWLFRV
\¿QDQFLHURVXQLPSRUWDQWHSUREOHPDGHGHVOLQdar hasta dónde el sistema de salud ha de llegar
HQPHMRUDUODFDOLGDGGHYLGDGHODVSHUVRQDV\
TXp VH GHEH GHMDU D OD UHVSRQVDELOLGDG LQGLYLdual.
Se espera un ejercicio de determinación de
SULRULGDGHV HQ FRQMXQWR HQWUH OD VRFLHGDG ORV
profesionales y el estado.
Evolución en la gestión
de las instituciones de Salud
Se espera una mejora y desarrollo de las capacidades e instrumentos de gestión mucho más
acelerados.
Serán piezas fundamentales para seguir los
pasos de los cambios en la gestión de salud:
‡DXWRQRPtDKRVSLWDODULD
‡FDPELRVGHOPHUFDGRODERUDOVDQLWDULR
‡ FRPSDUDELOLGDG \ benchmarking de resultados entre los centros y unidades
1 - Salud Pública, sistemas de servicios y organizaciones de la Salud Pública / 37
‡JHVWLyQ\DFUHGLWDFLyQGHODFDOLGDG
‡LQFHQWLYRVVREUHUHVXOWDGRVDSURIHVLRQDOHV\
GLUHFWLYRV
8QVLVWHPDGHVDOXGPiVGHVFHQWUDOL]DGRHQ
lo político y en lo regulatorio traerá consigo nueYDV\QHFHVDULDVIyUPXODVGHFRODERUDFLyQHQWUH
HOVHFWRUS~EOLFR\HOSULYDGR\QXHYDVIyUPXODV
de gestionar lo público.
7RGRHOORH[LJHDOPHQRVGRVFRVDVHQSULPHUOXJDUHTXLSRVGHJHVWLyQFDSDFLWDGRVSDUD
VROXFLRQDUSUREOHPDVHQFRQWH[WRVGHFUHFLHQWH
complejidad y apreciables dosis de incertidumEUH 1R EDVWD FRQ VHU EXHQRV DGPLQLVWUDGRUHV
VHQHFHVLWDQGLUHFWLYRVFDSDFHVGHFRPXQLFDU\
PRWLYDUFRQLQGHSHQGHQFLDLQFOXVRHQHQWRUQRV
OHJDOHV\DGPLQLVWUDWLYRV\VLVWHPDVUHWULEXWLYRV
LQDSURSLDGRV6HSUHFLVDHQ¿QGLUHFWLYRVPiV
FDSDFLWDGRV HQ HO XVR GH HQIRTXHV SUREDELOtVWLFDV \ GH FRQWLQJHQFLDV TXH HQ HO GH PRGHORV
QRUPDWLYRVRGHFHUWH]DV
Gestión de pacientes y enfermedades
La adaptación de modalidades de atención
gestionada a los sistemas nacionales de salud
UHTXHULUiGHQXHYRVLQVWUXPHQWRVRUJDQL]DWLYRV
\¿QDQFLHURVTXHIDFLOLWHQXQDDWHQFLyQFRRUGLQDGD\FHQWUDGDHQHOSDFLHQWH\QRHQODLQVWLWXFLyQRSURIHVLRQDO\TXHREWHQJDPD\RUYDORU
de los recursos utilizados.
$ YHFHV VH XWLOL]D HO WpUPLQR UHLQJHQLHUtD
SDUD VLQWHWL]DU HVWH HQIRTXH GH FDPELR 'LFKR
concepto combina una lógica de análisis por
SURFHVRV XQ FDPELR GUiVWLFR HQ OD FRQFHSFLyQ
de la organización y el uso de información como
soporte crítico para el rediseño.
6HLQWHJUDUiQGLYHUVRVWLSRVGHFHQWURVHQUHGHVGHVHUYLFLRV
(O PD\RU GHVDItR YHQGUi SDUD ORV KRVSLWDOHV
LQWHUPHGLRVREOLJDGRVDSHQVDUHQSURFHVRVDPbulatorios y no en camas y en sistemas de soporte
DODUHGLQWHJUDGDGHVHUYLFLRV\QRDODLQYHUVD
Control social sobre los servicios públicos
Se espera un control social más directo de los
SURSLRVFLXGDGDQRVHQODJHVWLyQGHORVFHQWURV
WDQWR D WUDYpV GH VX SDUWLFLSDFLyQ GLUHFWD HQ HO
JRELHUQR GH ORV FHQWURV FRPR D WUDYpV GH XQD
información más transparente y un más estrecho escrutinio social sobre los resultados del
VLVWHPDXQDPD\RUFDSDFLGDGGHHOHFFLyQXQD
PHQRU WROHUDQFLD VRFLDO D PDQWHQHU VHUYLFLRV R
XQLGDGHVGH¿FLHQWHV\XQDFDSDFLGDGGHSUHVLyQ
UHIRU]DGDSDUDDMXVWDUODRIHUWDGHVHUYLFLRVDODV
necesidades y deseos de la población.
Las organizaciones de atención de la salud
deben prepararse para afrontar con seguridad
ORVHVFHQDULRVPiVSUHGHFLEOHVDOPLVPRWLHPSRTXHDGTXLHUHQODÀH[LELOLGDGQHFHVDULDSDUD
UHDFFLRQDU IUHQWH D OR LPSUHGHFLEOH 'HEH SRU
WDQWRUHDOL]DUVHXQHVIXHU]RSRUGHVOLQGDUODLPNueva arquitectura de los servicios
SRUWDQFLD GH ORV IDFWRUHV TXH DFWXDUiQ VREUH HO
/RV QXHYRV VHUYLFLRV GH VDOXG UHTXHULUiQ GH IXWXURGHOVLVWHPDGHVDOXGMXQWRFRQODLQFHUXQDQXHYDDUTXLWHFWXUDGHOVLVWHPDEDVDGDHQOD WLGXPEUHTXHFRPSRUWDQQRVGHEHDFHUFDUFRQ
PiVSUREDELOLGDGHVGHp[LWRDOVLJOR;;,´
FRODERUDFLyQPiVTXHHQODFRPSHWHQFLD
El reto ya no estará en seguir reduciendo margiQDOPHQWHORVGtDVGHLQWHUQDFLyQVLQRHYLWDQGR
SRUFRPSOHWRODKRVSLWDOL]DFLyQDWUDYpVGHXQD
anticipación de los episodios de enfermedad y
FRPSOLFDFLRQHV disease management
Se asistirá a una política de sustitución de
cuidados HQWUH WHFQRORJtDV \ HQWUH WUDQVIHUHQFLDVDSULPHURVQLYHOHV
Desaparecerán las fronteras entre profesioQDOHVHVSHFLDOLGDGHV\QLYHOHVDVLVWHQFLDOHV
/RV QXHYRV VHUYLFLRV GH VDOXG UHTXHULUiQ
OD FRODERUDFLyQ FRQMXQWD GH GLVWLQWRV \ QXHYRV
profesionales actuando más coordinada e integralmente.
2
HISTORIA DE LA ADMINISTRACIÓN
GENERAL Y SANITARIA
Nélida Cosattini
CPN y Lic. en Administración (UBA). Docente universitaria
INTRODUCCIÓN
se remontan a las consecuencias generadas por
ODUHYROXFLyQLQGXVWULDO(QWRQFHVVHHQFXHQWUDQ
ante un crecimiento acelerado y desorganizado
de las empresas UD]yQ SRU OR FXDO SODQWHDQ OD
necesidad de aumentar la H¿FLHQFLD y la competencia de las organizaciones. La Escuela de la
Administración FLHQWt¿FD pone su énfasis en las
tareas. Taylor SULQFLSDO DXWRU SURFHGtD GH XQD
IDPLOLDGHFXiTXHURVGHSULQFLSLRVUtJLGRV\IXH
HGXFDGRGHQWURGHXQDPHQWDOLGDGGHGLVFLSOLQD
GHYRFLyQ DO WUDEDMR \ DO DKRUUR ,QLFLy VX YLGD
SURIHVLRQDOFRPRREUHURHQSDVDQGRDFDSDWD]VXSHUYLVRUMHIHGHWDOOHU\DLQJHQLHURHQ
(VWXGLyHOSUREOHPDGHODSURGXFFLyQHQ
sus mínimos detalles.
La administración es una de las áreas del conocimiento humano más impregnada de complejiGDGHV\GHVDItRVKDVXIULGRXQDODUJDHYROXFLyQ
DWUDYpVGHOWLHPSR\HVWDOFRPRODHQFRQWUDPRVKR\HOUHVXOWDGRLQWHJUDGRGHODFRQWULEXFLyQ DFXPXODWLYD GH QXPHURVRV SUHFXUVRUHV
¿OyVRIRVHFRQRPLVWDVHVWDGLVWDV\RWURVHQWUH
TXLHQHV VH LQFOX\HQ HPSUHVDULRV TXH FRQ HO
WUDQVFXUULU GHO WLHPSR IXHURQ GHVDUUROODQGR \
GLYXOJDQGRVXVREUDV\teorías. (VDVtTXHODadministración utiliza conceptos y principios maWHPiWLFRVHVWDGtVWLFRVGHODVcienciasKXPDQDV
SVLFROyJLFRVVRFLROyJLFRVELROyJLFRVSHGDJyJLFRVGHODVcienciasItVLFDVGHODItVLFDGHOD
TXtPLFDGHOGHUHFKRGHODLQJHQLHUtDHWF
La $GPLQLVWUDFLyQFLHQWt¿FD constituye una
(Q HO &XDGUR VH SUHVHQWD OD FURQRORJtD FRPELQDFLyQJOREDOTXHSXHGHUHVXPLUVHDVt
GHORVSULQFLSDOHVHYHQWRVHQORVRUtJHQHVGHOD ‡&LHQFLDen lugar de empirismo
administración.
‡$UPRQtDHQYH]GHGLVFRUGLD
En los antecedentes históricos de la adminis‡&RRSHUDFLyQQRLQGLYLGXDOLVPR
tración SRGHPRV HQFRQWUDU LQÀXHQFLDV GH ORV ‡5HQGLPLHQWRPi[LPRHQOXJDUGHSURGXFFLyQ
JUDQGHV¿OyVRIRVGHODorganización de la iglesia
reducida
FDWyOLFDGHODorganizaciónPLOLWDUGHODUHYROX‡'HVDUUROORGHFDGDKRPEUHHQHOVHQWLGRGH
FLyQLQGXVWULDOGHORVHFRQRPLVWDVOLEHUDOHVHWF
alcanzar mayor H¿FLHQFLD y prosperidad
ESCUELA DE LA ADMINISTRACIÓN CIENTÍFICA
Desarrollada por un ingeniero norteamericano
llamado Frederick Winslow Taylor 'LFKD HVFXHOD VH SUHRFXSy HVSHFt¿FDPHQWH HQ
aumentar la H¿FLHQFLDGHODLQGXVWULDDWUDYpVGH
la racionalización del trabajo del operario. Otros
DXWRUHV GH HVWD HVFXHOD VRQ +HQU\ /DZUHQFH
*DQWW)UDQN%XQNHU*LOEUHWK+DUULQJWRQ(PHUVRQ\+HQU\)RUG/RVRUtJHQHVGHHVWDHVFXHOD
Para Taylor los elementos de aplicación de la
$GPLQLVWUDFLyQFLHQWt¿FD son:
D (VWXGLR GH WLHPSRV \ SDWURQHV GH SURGXFción
E 6XSHUYLVLyQIXQFLRQDO
F (VWDQGDUL]DFLyQ GH KHUUDPLHQWDV H LQVWUXmentos
G Planeamiento de las tareas y cargos
H (OSULQFLSLRGHODH[FHSFLyQ
I /DXWLOL]DFLyQGHODUHJODGHFiOFXOR\GHLQVtrumentos para economizar tiempos
40 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
AÑOS
a.C.
Egipcios
a.C.
a.C.
Egipcios
Egipcios
a.C.
+DPXUDEL %DELORQLD
a.C.
Hebreos
a.C.
AUTORES
a.C.
Nabucodonosor
%DELORQLD
0HQFLXV &KLQD
a.C.
6yFUDWHV *UHFLD
&LUR 3HUVLD
3ODWyQ *UHFLD
a.C.
&DWyQ 5RPD
-HV~V -XGHD
'LRFOHFLR 5RPD
Arsenal de Venecia
1LFROiV0DTXLDYHOR
,WDOLD
Sir James Stuart
,QJODWHUUD
$GDP6PLWK ,QJODWHUUD
(OL:KLWQH\
(VWDGRV8QLGRV
EVENTOS
Reconocimiento de la necesidad de
SODQHDURUJDQL]DU\FRQWURODU
Descentralización en la organización
Reconocimiento de la necesidad de
yUGHQHVHVFULWDV8VRGHFRQVXOWRUtDGH
staff
8VRGHFRQWUROHVFULWR\WHVWLPRQLDO
establecimiento del salario mínimo;
UHFRQRFLPLHQWRGHTXHODUHVSRQVDELOLGDG
no puede ser transferida
Conceptos de organización; principio
HVFDODUSULQFLSLRGHODH[FHSFLyQ
&RQWUROGHODSURGXFFLyQHLQFHQWLYRV
salariales
Reconocimiento de la necesidad de
sistemas y estándares
(QXQFLDGRGHODXQLYHUVDOLGDGGHOD
administración
Reconocimiento de la necesidad de las
relaciones humanas; uso del estudio de
PRYLPLHQWRVDUUHJORItVLFR\PDQHMRGH
materiales
Enunciado del principio de la
especialización
8VRGHODVGHVFULSFLRQHVGHIXQFLRQHV
8QLGDGGHPDQGRUHJODPHQWRV
relaciones humanas
Delegación de autoridad
&RQWDELOLGDGGHFRVWRVYHUL¿FDFLRQHV
\EDODQFHVSDUDFRQWUROQXPHUDFLyQ
GHLQYHQWDULRVLQWHUFDPELRGHSDUWHV
utilización de la técnica de línea de
PRQWDMHXVRGHODDGPLQLVWUDFLyQGH
SHUVRQDOestandarizaciónGHODVSDUWHV
FRQWUROGHLQYHQWDULR\FRQWUROGHFRVWRV
&RQ¿DQ]DHQHOSULQFLSLRGHOFRQVHQVR
GHOJUXSRUHFRQRFLPLHQWRGHOD
necesidad de cohesión en la organización
HQXQFLDGRGHODVFXDOLGDGHVGHOLGHUD]JR
descripción de tácticas políticas
7HRUtDGHODIXHQWHGHODDXWRULGDG
LPSDFWRGHODDXWRPDWL]DFLyQ
diferenciación entre gerentes y
WUDEDMDGRUHVEDVDGDHQODVYHQWDMDVGHOD
especialización
Aplicación del principio de
especialización a los trabajadores
manufactureros; conceptos de control
0pWRGRFLHQWt¿FRXVRGHODFRQWDELOLGDG
GHFRVWRV\GHOFRQWUROGHFDOLGDG
aplicación del concepto de intercambio
GHODVSDUWHVUHFRQRFLPLHQWRGHOD
DPSOLWXGDGPLQLVWUDWLYD
(continúa en página siguiente)
2 - Historia de la administración general y sanitaria / 41
-DPHV:DWW
0DWKHZ%RXOWRQ
,QJODWHUUD
5REHUW2ZHQ
,QJODWHUUD
Charles Babbage
,QJODWHUUD
Daniel C. Mc Callum
(VWDGRV8QLGRV
Henry Metcalfe
(VWDGRV8QLGRV
)UHGHULFN:7D\ORU
(VWDGRV8QLGRV
Procedimientos estandarizados de
RSHUDFLyQHVSHFL¿FDFLRQHVPpWRGRVGH
WUDEDMRSODQHDPLHQWRLQFHQWLYRVDODULDO
WLHPSRVHVWiQGDUGDWRVSDWURQL]DGRV
ERQL¿FDFLRQHVQDYLGHxDVVHJXURV
PXWXRVDORVHPSOHDGRVXWLOL]DFLyQGHOD
auditoría
Reconocimiento y aplicación de
prácticas de personal; asunción de la
responsabilidad por el entrenamiento de
los operarios; introducción de planes de
YLYLHQGDSDUDORVRSHUDULRV
eQIDVLVHQHOHQIRTXHFLHQWt¿FR
pQIDVLVHQODHVSHFLDOL]DFLyQGLYLVLyQ
GHOWUDEDMRHVWXGLRGHWLHPSRV\
PRYLPLHQWRVFRQWDELOLGDGGHFRVWRV
HIHFWRVGHODVGLYHUVDVYDULDEOHVHQOD
H¿FLHQFLDGHORSHUDULR
8VRGHRUJDQLJUDPDVSDUDPRVWUDUOD
estructura organizacional; aplicación
de la administración sistémica en los
ferrocarriles
Arte de la administración; ciencia de la
administración
$GPLQLVWUDFLyQFLHQWt¿FDDSOLFDFLyQGH
VLVWHPDVDGPLQLVWUDFLyQGHSHUVRQDO
necesidad de cooperación entre el
WUDEDMR\ODJHUHQFLDVDODULRVHOHYDGRV
GLYLVLyQHTXLWDWLYDHQWUHHOWUDEDMR
\JHUHQFLDRUJDQL]DFLyQIXQFLRQDO
SULQFLSLRGHH[FHSFLyQDSOLFDGRDOWDOOHU
VLVWHPDGHFRVWRVHVWXGLRGHPpWRGRV
HVWXGLRGHWLHPSRVGH¿QLFLyQGHOD
DGPLQLVWUDFLyQFLHQWt¿FDpQIDVLVHQ
ODWDUHDDGPLQLVWUDWLYDpQIDVLVHQOD
LQYHVWLJDFLyQSODQHDPLHQWRFRQWURO\
cooperación
Cuadro 2.1: Cronología de los principales eventos de los orígenes de la Administración
J *XtDVGHLQVWUXFFLRQHVGHVHUYLFLR
K /DLGHDGHWDUHDVDVRFLDGDDLQFHQWLYRVGH
SURGXFFLyQSRUVXHMHFXFLyQH¿FLHQWH
L SistemasSDUDODFODVL¿FDFLyQGHORVSURGXFWRV
y del material utilizado en la manufactura
M Sistema de delineamiento de la rutina de trabajo.
(OSHUtRGRTXHDEDUFyDHVWDHVFXHODHVGHD
\VXiUHDGHDFWXDFLyQIXHHOVHFWRULQGXVWULDO
6tQWHVLVGHVXVLGHDV\WUDEDMRVPiVVLJQL¿FDWLYRV
‡ ,QWURGXFHQ D OD administración FLHQWt¿FD en
lugar de la administraciónGHLQLFLDWLYD
‡5DFLRQDOL]DQ\VLVWHPDWL]DQORVSURFHVRVLQdustriales
‡(VWXGLDQHLPSODQWDQsistemasGHLQFHQWLYRV
‡ 'HVDUUROODQ HO HVTXHPD GH VXSHUYLVLyQ IXQcional
‡ 'HVDUUROODQ OD SODQL¿FDFLyQ GH WRGDV ODV WDreas estableciendo sus normas y métodos de
operación
‡ &URQRPHWUL]DQ ORV WLHPSRV GH proceso HOLPLQDQ ORV WUDQVSRUWHV \ ORV PRYLPLHQWRV
inútiles.
Limitaciones de sus ideas y trabajos:
‡)XHURQIRUPDOLVWDV\DXWRULWDULRV
‡1RWXYLHURQHQFXHQWDDOKRPEUHHQWRGDVX
dimensión.
‡ (Q HVSHFLDO GHVFRQRFLHURQ ODV YDULDEOHV GH
ODFRQGXFWD\ORVIDFWRUHVGHODPRWLYDFLyQ
42 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
VXSRQLHQGR HUUyQHDPHQWH TXH HUDQ VyOR GH
FayolGH¿QHHODFWRGHadministrar mediante
tipo económico.
ODV IXQFLRQHV DGPLQLVWUDWLYDV TXH HQJOREDQ ORV
‡)XHURQHPSLULVWDVWUDEDMDURQVRODPHQWHHQHO elementos de la administración:
campo formal y en el área industrial.
1) PlanearYLVXDOL]DUHOIXWXUR\WUD]DUHOSURgrama de acción
Teorías\RtécnicasTXHVHDSOLFDQ\TXHLQ2) Organizar: construir tanto el organismo mategran la actual ciencia de la administración:
terial como el social de la empresa
‡7pFQLFDV de racionalización y H¿FLHQFLD
3) Dirigir: guiar y orientar al personal
‡7pFQLFDVGHWLHPSRV\PRYLPLHQWRV
4) CoordinarOLJDUXQLUDUPRQL]DUWRGRVORV
‡7pFQLFDV de lay-out y de transportes internos
DFWRV\WRGRVORVHVIXHU]RVFROHFWLYRV
‡7pFQLFDVde H¿FLHQFLD fabril en general
5) Controlar YHUL¿FDU TXH WRGR VXFHGD GH
‡7HRUtD de la programación y control de la proacuerdo con las reglas establecidas y las órducción
denes dadas
‡7HRUtDGHODVXSHUYLVLyQIXQFLRQDO
)D\RO WDPELpQ HQXQFLy ORV SULQFLSLRV JHQH(QUHVXPHQFRQOD$GPLQLVWUDFLyQ&LHQWt¿FD rales de la administración. Ellos son 14 y se prese implantó el concepto de homo economicusHVWR VHQWDQHQHO&XDGUR
HVHO³KRPEUHHFRQyPLFR´6HJ~QHVHFRQFHSWR
toda persona es concebida como profundamente
Los miembros de esta escuela se preocupaLQÀXHQFLDGDSRUODVUHFRPSHQVDVVDODULDOHVHFR- URQSRUODGLYLVLyQGHOWUDEDMR\ODHVSHFLDOL]DQyPLFDV\PDWHULDOHV(QRWURVWpUPLQRVHOKRP- FLyQ\SRUORVFRQFHSWRVGHOtQHD\GHVWDII HVWD
EUHEXVFDHOWUDEDMRQRSRUTXHOHJXVWDVLQRFRPR función tiene solamente autoridad de especialisXQPHGLRGHJDQDUVHODYLGDDWUDYpVGHOVDODULR WD\QRDXWRULGDGGHPDQGR TXHHOWUDEDMROHSURSRUFLRQD3RUFLHUWRpVWDHV
XQDHVWUHFKDYLVLyQGHODQDWXUDOH]DKXPDQD
Los elementos de la administración SDUD8UZLFN
son:
D ,QYHVWLJDFLyQ
ESCUELA DE LA ADMINISTRACIÓN INDUSTRIAL
E 3UHYLVLyQ
Y GENERAL
F Planeamiento
G Organización
0LHQWUDVTXH7D\ORU\RWURVLQJHQLHURVQRUWHDPHH &RRUGLQDFLyQ
ricanos desarrollaban la Administración CienI 0DQGR
Wt¿FD HQ ORV (VWDGRV 8QLGRV HQ VXUJtD HQ g) Control
)UDQFLDGLIXQGLpQGRVHUiSLGDPHQWHSRU(XURSD
la llamada teoría clásica de la Administración.
3DUD*XOOLFNHVRVHOHPHQWRVVRQ
6XSULQFLSDODXWRUIXH+HQU\)D\RO D Planeamiento
Era ingeniero de minas y su preocupación fue la
E Organización
estructura de la organización como un todo. EnF $VHVRUtD
WRQFHV SDUWLy GH XQ HQIRTXH VLQWpWLFR JOREDO \ G Dirección
XQLYHUVDOGHODempresaLQDXJXUDQGRXQHQIRTXH H &RRUGLQDFLyQ
anatómico y estructuraO TXH UiSLGDPHQWH GHVI Información
SOD]yDOHQIRTXHDQDOtWLFR\FRQFUHWRGH7D\ORU J 3UHVXSXHVWDFLyQ
Otros autores de esta escuela fueron: James MooQH\/\QGDOO8UZLFN/XWKHU*XOOLFN
8UZLFNWDPELpQHQXQFLDSULQFLSLRVGHadministración:
)D\RO SURSRQH TXH WRGD empresa puede ser
D 3ULQFLSLRGHODHVSHFLDOL]DFLyQ
GLYLGLGDHQJUXSRV
E 3ULQFLSLRGHDXWRULGDG
)XQFLRQHVtécnicas
F 3ULQFLSLRGHODDPSOLWXGDGPLQLVWUDWLYD
)XQFLRQHVFRPHUFLDOHV
G 3ULQFLSLRGHODGH¿QLFLyQ
)XQFLRQHV¿QDQFLHUDV
)XQFLRQHVGHVHJXULGDG
El período de actuación de esta escuela es
)XQFLRQHVFRQWDEOHV
HQWUH\\VHGHGLFyDOiUHDDGPLQLV )XQFLRQHVDGPLQLVWUDWLYDV
WUDWLYD\GHdirección general.
2 - Historia de la administración general y sanitaria / 43
1. DIVISIÓN DEL TRABAJO
2. AUTORIDAD
3. DISCIPLINA
4. UNIDAD DE DIRECCIÓN
5. UNIDAD DE MANDO
6. SUBORDINACIÓN DE INTERÉS
INDIVIDUAL AL BIEN COMÚN
7. REMUNERACIÓN
8. CENTRALIZACIÓN
9. JERARQUÍA
10. ORDEN
11. EQUIDAD
12. ESTABILIDAD DEL PERSONAL
13. INICIATIVA
14. ESPÍRITU DE EQUIPO
&XDQWRPiVVHHVSHFLDOLFHQODVSHUVRQDVFRQPD\RUH¿FLHQFLD
GHVHPSHxDUiQVXR¿FLR(VWHSULQFLSLRGHEHVHUPX\FODURHQ
la moderna línea de montaje.
/RVJHUHQWHVWLHQHQTXHGDUyUGHQHVSDUDTXHVHKDJDQODV
FRVDV6LELHQODDXWRULGDGIRUPDOOHGDHOGHUHFKRGHPDQGDU
ORVJHUHQWHVQRVLHPSUHREWHQGUiQREHGLHQFLDDPHQRVTXH
WHQJDQWDPELpQDXWRULGDGSHUVRQDO OLGHUD]JR /RVPLHPEURVGHXQDRUJDQL]DFLyQWLHQHQTXHUHVSHWDUODV
UHJODV\FRQYHQLRVTXHJRELHUQDQODHPSUHVD(VWRVHUi
HOUHVXOWDGRGHXQEXHQOLGHUD]JRHQWRGRVORVQLYHOHVGH
DFXHUGRVHTXLWDWLYRV WDOHVGLVSRVLFLRQHVSDUDUHFRPSHQVDU
HOUHQGLPLHQWRVXSHULRU \VDQFLRQHVSDUDODVLQIUDFFLRQHV
aplicadas con justicia.
/DVRSHUDFLRQHVTXHWLHQHQXQPLVPRREMHWLYRGHEHQVHU
GLULJLGDVSRUXQVRORJHUHQWHTXHXVHXQVRORSODQ
Cada empleado debe recibir instrucciones sobre una operación
particular solamente de una persona.
(QFXDOTXLHUHPSUHVDHOLQWHUpVGHORVHPSOHDGRVQRGHEH
tener prioridad sobre los intereses de la organización como un
todo.
/DFRPSHQVDFLyQSRUHOWUDEDMRGHEHVHUHTXLWDWLYDWDQWRSDUD
los empleados como para los patronos.
)D\ROFUHtDTXHORVJHUHQWHVGHEHQFRQVHUYDUOD
UHVSRQVDELOLGDG¿QDOSHURWDPELpQQHFHVLWDQGDUDVXV
VXEDOWHUQRVDXWRULGDGVX¿FLHQWHSDUDTXHSXHGDQUHDOL]DU
DGHFXDGDPHQWHVXR¿FLR(OSUREOHPDFRQVLVWHHQHQFRQWUDUHO
mejor grado de centralización en cada caso.
La línea de autoridad en una organización representada hoy
generalmente por cuadros líneas y líneas de un organigrama
pasa en orden de rangos desde la alta gerencia hasta los
QLYHOHVPiVEDMRVGHODHPSUHVD
Los materiales y las personas deben estar en el lugar adecuado
HQHOPRPHQWRDGHFXDGR(QSDUWLFXODUFDGDLQGLYLGXRGHEH
ocupar el cargo o posición más adecuados para él.
/RVDGPLQLVWUDGRUHVGHEHQVHUDPLVWRVRV\HTXLWDWLYRVFRQVXV
subalternos.
8QDDOWDWDVDGHURWDFLyQGHOSHUVRQDOQRHVFRQYHQLHQWHSDUD
HOH¿FLHQWHIXQFLRQDPLHQWRGHXQDRUJDQL]DFLyQ
'HEHGDUVHDORVVXEDOWHUQRVOLEHUWDGSDUDFRQFHELU\OOHYDUD
FDERVXVSODQHVDXQFXDQGRDYHFHVVHFRPHWHQHUURUHV
3URPRYHUHOHVStULWXGHHTXLSRGDUiDODRUJDQL]DFLyQXQ
VHQWLGRGHXQLGDG5HFRPHQGDGRSRUHMHPSORHOHPSOHRGH
FRPXQLFDFLyQYHUEDOHQOXJDUGHODFRPXQLFDFLyQIRUPDOSRU
HVFULWRVLHPSUHTXHIXHUDSRVLEOH
Cuadro 2.2: Los 14 principios de administración de Fayol
Limitaciones de sus ideas y trabajos:
‡)XHIRUPDOLVWD\DXWRULWDULD
‡6XteoríaGHODDXWRULGDGGHGHUHFKRGLYLQR
IXH HO VRVWpQ GH VX PRGHOR TXH HQ FRQVHFXHQFLDQRVHDMXVWDDODUHDOLGDG
‡1RWXYRHQFXHQWDODVYDULDEOHVGHFRQGXFWD
‡6XVSULQFLSLRVUHVXOWDQDPELJXRV\FRQWUDGLFtorios.
‡ 6X FRQFHSFLyQ GH ODV FRPXQLFDFLRQHV \ GH
la estructuraHVWiYLFLDGDSRUVXVLGHDVIRUmalistas.
44 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
Los principios de esta escuela fueron enunFLDGRV SRU *HRUJH (OWRQ 0D\R FRPR FRQFOXVLyQ GH VX ODUJD H[SHULHQFLD HQ OD
SODQWDLQGXVWULDOGH+DZWKRUQH
)XHEiVLFDPHQWHXQPRYLPLHQWRGHUHDFFLyQ
y oposición a las teorías clásicas de la administración.
2WURV DXWRUHV GH HVWD HVFXHOD IXHURQ .XUW
/HZLQ )ULW] 5RHWKOLVEHUJHU 0DU\ 3DUNHU )ROOHW*HRUJH+RPDQV5REHUW7HQQHQEDXP-DFN
)UHQFK$OH[%DYHODV\RWURV
/DH[SHULHQFLDGH+DZWKRUQHIXHGHVDUUROOD3DUDFRQFOXLUGHEHPRVUHIRU]DUODDSUHFLDFLyQ da por Elton Mayo en una fábrica de la Western
crítica de esta escuela. Sus grandes errores fueron: Electric Company GHGLFDGD D OD IDEULFDFLyQ
HQIRTXH VLPSOL¿FDGR GH OD organización formal; GH HTXLSRV \ FRPSRQHQWHV WHOHIyQLFRV VLWXDGD
DXVHQFLD GH WUDEDMRV H[SHULPHQWDOHV H[WUHPR UD- HQ&KLFDJRHQHOEDUULRGH+DZWKRUQH\FX\D
cionalismo en la concepción de la administración; ¿QDOLGDGHUDGHWHUPLQDUODUHODFLyQHQWUHODLQ“teoríaGHODPiTXLQD´HQIRTXHLQFRPSOHWRGHOD tensidad de la iluminación y la H¿FLHQFLD de los
RSHUDULRV/XHJRGLFKDH[SHULHQFLDVHH[WHQGLy
organización\HQIRTXHGHsistemas cerrados.
DOHVWXGLRGHODIDWLJDDORVDFFLGHQWHVHQHOWUDEDMRDODURWDFLyQGHOSHUVRQDO\DOHIHFWRGHODV
FRQGLFLRQHVItVLFDVVREUHODSURGXFWLYLGDG
ESCUELA DE LAS RELACIONES HUMANAS
Teorías\RtécnicasTXHVHDSOLFDQ\TXHLQtegran la actual ciencia de la administración:
‡6XFRQFHSFLyQDGPLQLVWUDWLYDVXGLYLVLyQGHOD
organización en áreas y su modelo de Manual
GH )XQFLRQHV \ 3URIHVLRJUDPD VH XWLOL]DQ
pero adecuados e integrados a las modernas
teorías y técnicas de la administración.
‡ $OJXQRV GH ORV SULQFLSLRV WDPELpQ VH DSOLFDQ DXQTXH QR FRPR WDOHV VLQR FRPR JXtD
o complemento de ciertas técnicas adminisWUDWLYDV
/DV FRQFOXVLRQHV GH OD H[SHULHQFLD GH
&RQHOHQIRTXHKXPDQtVWLFRODteoría adminisWUDWLYD VXIUH XQD YHUGDGHUD UHYROXFLyQ FRQFHS- Hawthorne fueron:
WXDOODWUDQVIHUHQFLDGHOpQIDVLVDQWHVFRORFDGR D (O QLYHO GH SURGXFFLyQ HV UHVXOWDQWH GH OD
integración social
en la tarea y en la estructuraRUJDQL]DFLRQDODO
pQIDVLVHQODVSHUVRQDVTXHWUDEDMDQ\SDUWLFLSDQ E /RVHPSOHDGRV\RSHUDULRVWLHQHQXQcomportamiento social
en las organizaciones.
F (OHIHFWRGHODVUHFRPSHQVDV\ODVVDQFLRQHV
&RQ HO HQIRTXH KXPDQtVWLFR OD SUHRFXSDsociales
FLyQSRUODPiTXLQD\SRUHOPpWRGRGHWUDEDMR
G /DLPSRUWDQFLDGHORVJUXSRVLQIRUPDOHV
y la preocupación por la organización formal y
H /DUHOHYDQFLDGHODVrelaciones humanas
los principios de administraciónDSOLFDEOHVFHI /DLPSRUWDQFLDGHORVFRQWHQLGRVGHORVFDUJRV
den prioridad a la preocupación por el hombre
\ VX JUXSR VRFLDO 6H SDVD DVt GH ORV DVSHFWRV J eQIDVLVHQORVDVSHFWRVHPRFLRQDOHV
técnicos y formales a los aspectos psicológicos
El período de actuación de esta escuela fue
y sociológicos.
(O HQIRTXH KXPDQtVWLFR RFXUUH FRQ OD DSD- HQWUH\
rición de la teoría de las relaciones humanas
6tQWHVLVGHVXVLGHDV\WUDEDMRVPiVVLJQL¿HQ ORV (VWDGRV 8QLGRV DOUHGHGRU GH 6X
surgimiento fue posible por el desarrollo de las FDWLYRV
‡,QFXUVLRQDQSRUYH]SULPHUDHQHOFDPSRcomcienciasVRFLDOHVSULQFLSDOPHQWH\HQSDUWLFXportamentalDOTXHGHQRPLQDQLQIRUPDO
lar la psicología del trabajo.
‡,QYHVWLJDQODLPSRUWDQFLDGHODVYDULDEOHVGH
participación y estructura grupal.
Esta escuela se dirige a dos aspectos básicos:
‡ 'HWHFWDQ D ORV JUXSRV HVWXGLDQGR VXV QRUPDVVXestructuraVXVOtGHUHV\ODQDWXUDOH]D
D (ODQiOLVLVGHOWUDEDMR\ODDGDSWDFLyQGHOWUDGHORVFRQÀLFWRVTXHVHSURGXFHQ
bajador a éste
‡'HWHFWDQTXHHOIRFRGHDWHQFLyQHQORVHVWXGLRV
E /DDGDSWDFLyQGHOWUDEDMRDOWUDEDMDGRU
de H¿FLHQFLDQRHVHOLQGLYLGXRVLQRHOJUXSR
‡'HVWUX\HQDODteoría clásicaGHODPRWLYDFLyQ
(VWDHVFXHODGHELyFRQYLYLUFRQODJUDQGHSUHVLyQ HFRQyPLFD TXH DWRUPHQWy D WRGR HO
económica por no considerar los factores de
PXQGRDOUHGHGRUGH
la conducta.
2 - Historia de la administración general y sanitaria / 45
Limitaciones de sus ideas y trabajos:
‡ )XHURQ VRODPHQWH LQIRUPDOLVWDV $FWXDURQ
GLYRUFLDGRV GHO FRQWH[WR \ GH ORV PRGHORV
formales.
‡6XVWUDEDMRVIXHURQVXSHU¿FLDOHV\TXHGDURQ
PiVTXHQDGDHQHOSODQRGHODUHFROHFFLyQ
GHH[SHULHQFLDV
‡ 6XSXVLHURQ LQJHQXDPHQWH TXH HO FRQÀLFWR
TXHGHWHFWDURQVHUHVROYtDFRQXQWUDWRFRUdial y afectuoso.
estructuralista GHO comportamiento GH OD
matemática y de los sistemas.
Para los autores neoclásicosODadministraciónFRQVLVWHHQRULHQWDUGLULJLU\FRQWURODUORV
HVIXHU]RVGHXQJUXSRGHLQGLYLGXRVSDUDXQobjetivo FRP~Q (O EXHQ DGPLQLVWUDGRU HV HO TXH
posibilita al grupo alcanzar sus objetivos FRQ
el mínimo uso de los recursos y de esfuerzo y
FRQ PHQRV LQWHUIHUHQFLDV FRQ RWUDV DFWLYLGDGHV
útiles.
Teorías\RtécnicasTXHVHDSOLFDQ\TXHLQEsta escuela se preocupa por la centralizategran la actual ciencia de la administración:
ción y por la descentralización y también abarca
‡ 6XV H[SHULHQFLDV VLUYLHURQ SDUD TXH VH SUR- las funciones del administrador.
IXQGL]DUDHOHVWXGLRGHORVJUXSRVGHOOtGHU
6X SHUtRGR GH DFWXDFLyQ IXH HQWUH \
GHODSDUWLFLSDFLyQ\GHOFRQÀLFWR
\VHRFXSDURQGHODViUHDVLQGXVWULDO\DG‡)XHURQHQFRQVHFXHQFLDORVSUHFXUVRUHVGH PLQLVWUDWLYD
las modernas teorías sociológicas de aplicación al área de las organizaciones.
6tQWHVLVGHVXVLGHDV\WUDEDMRVPiVVLJQL¿FDWLYRV
(QFRQFOXVLyQHVWDHVFXHODVHGHGLFySULQFL‡5HQRYDURQ\DGDSWDURQODVLGHDVclásicas.
SDOPHQWHDODPRWLYDFLyQKXPDQDDOOLGHUD]JR ‡'HVDUUROODURQORVSULQFLSLRVGHODadministraa las comunicaciones en la organización D ODV
ciónVREUHORVTXHVRSRUWDURQVXFRQFHSFLyQ
organizaciones informales y a la dinámica de
DGPLQLVWUDWLYD
los grupos.
‡'HVDUUROODURQWpFQLFDVGHestructura.
ESCUELA NEOCLÁSICA
Limitaciones de sus ideas y trabajos:
‡)XHURQIRUPDOLVWDV\HQFRQVHFXHQFLDQRUHFRQRFLHURQODVYDULDEOHVGHODFRQGXFWD
‡6XVPRGHORVGHestructura fueron estáticos y
PHFDQLFLVWDVORTXHORVFRQYLHUWHHQREVROHtos e inaplicables.
‡6XVSULQFLSLRVDOLJXDOTXHORVGHOSUHFXUVRU
Fayol VRQDPELJXRV\FRQWUDGLFWRULRV
(OHQIRTXHneoclásico es igual a la teoría clásica debidamente actualizada y adaptada a la nueYDGLPHQVLyQGHORVSUREOHPDVDGPLQLVWUDWLYRV
actuales y al tamaño de las organizaciones de
KR\(VH[DFWDPHQWHODteoría clásica colocada
en el modelo de las empresas actuales.
(QUHDOLGDGQRHVXQDHVFXHODGH¿QLGDVLQR
Teorías \RtécnicasTXHVHDSOLFDQ\TXHLQXQPRYLPLHQWRUHODWLYDPHQWHKHWHURJpQHR
tegran la actual ciencia de la administración:
6XV DXWRUHV SULQFLSDOHV VRQ 3HWHU 'UXFNHU ‡6XFRQFHSFLyQDGPLQLVWUDWLYD\VXVWpFQLFDV
(UQHVW 'DOH +DUROG .RRQW] &\ULO 2'RQQHOO
de estructura y de control se utilizan en la
0LFKDHO-XFLXV:LOOLDP1HZPDQ5DOSK'DYLV
DFWXDOLGDGSHURDGHFXDGDV\PRGL¿FDGDVDOD
*HRUJH7HUU\0RUULV+XUOH\\/RXLV$OOHQ
realidad de las organizaciones.
‡$OJXQRV GH VXV SULQFLSLRV VH XWLOL]DQ FRPR
Las características principales de la teoría
guías o complementos de ciertas técnicas adPLQLVWUDWLYDV
neoclásica son:
%iVLFDPHQWH OD (VFXHOD Neoclásica anali eQIDVLVHQODSUiFWLFDGHODadministración
5HD¿UPDFLyQUHODWLYDGHORVSRVWXODGRVclá- ]y ORV VLJXLHQWHV WHPDV GLYLVLyQ GHO WUDEDMR
sicos
HVSHFLDOL]DFLyQ MHUDUTXtDV GLVWULEXFLyQ GH OD
eQIDVLVHQORVSULQFLSLRVJHQHUDOHVGHODad- autoridad y de la responsabilidad; el racionalisministración
mo de la organización IRUPDO FDUDFWHUtVWLFDV
eQIDVLVHQORVobjetivos y en los resultados
YHQWDMDV\GHVYHQWDMDVGHODorganización lineal;
3RVHHQXQHFOHFWLFLVPRUHVSHFWRGHODteo- FDUDFWHUtVWLFDVYHQWDMDV\GHVYHQWDMDVGHODorría clásicaSRUHOORUHFXUUHQDODVteorías de ganización funcional; organización línea-staff;
las relaciones humanas GH OD burocracia características de los comités; la departamentali-
46 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
zación y sus diferentes tipos y la administración
por objetivos.
ESCUELA ESTRUCTURALISTA O BUROCRÁTICA
3RVWHULRUPHQWH QRV HQFRQWUDPRV FRQ HO HQIRTXHestructuralista de la administración(VDVt
TXHHQHOLQLFLRGHOVLJOR;;0D[:HEHU VRFLyORJR DOHPiQ SXEOLFy XQD H[WHQVD
bibliografía respecto de las grandes organizaciones de su época. Le dio el nombre de burocracia
\SDVyDFRQVLGHUDUDO;;FRPRHOVLJORGHODV
burocraciasSXHVFUHtDTXHpVWDVHUDQODVorganizaciones FDUDFWHUtVWLFDV GH XQD QXHYD pSRFD
SOHQDGHQXHYRVYDORUHV\GHQXHYDVH[LJHQFLDV
La aparición de las burocracias coincidió con el
nacimiento del capitalismo.
Con la aparición de las burocraciasVXFUHFLPLHQWR \ VX SUROLIHUDFLyQ OD teoría adminisWUDWLYD JDQy XQD QXHYD GLPHQVLyQ D WUDYpV GHO
HQIRTXH estructuralista /D YLVLyQ HVWUHFKD \
limitada de los aspectos internos de la organizaciónSDVyDVHUDPSOLDGD\VXVWLWXLGDSRUXQD
YLVLyQPiVYDVWDHQYROYLHQGRDODorganización
y a sus relaciones con otras organizaciones denWURGHXQDVRFLHGDGPD\RU$SDUWLUGHDTXtHO
HQIRTXH estructuralista VH LPSRQH GH¿QLWLYDPHQWHVREUHHOHQIRTXHclásico\HOHQIRTXHGH
relaciones humanas.
$ SDUWLU GH ODV FUtWLFDV KHFKDV WDQto a la teoría clásica SRU VX PHFDQLFLVPR
como a la teoría de las relaciones humanas
SRU VX URPDQWLFLVPR LQJHQXR UHYHODURQ OD
falta de una teoría de la organización sólida
\DPSOLDTXHVLUYLHVHGHRULHQWDFLyQSDUDHO
trabajo del administrador. Algunos estudiosos fueron a buscar en el escrito del econoPLVWD \ VRFLyORJR \D IDOOHFLGR 0D[ :HEHU
OD LQVSLUDFLyQ SDUD HVWD QXHYD teoría de la
organización6XUJHDVtODteoría de la burocracia en la administración.
F (O FUHFLHQWH WDPDxR \ FRPSOHMLGDG GH ODV
empresasSDVyDH[LJLUPRGHORVRUJDQL]DFLRQDOHVPHMRUGH¿QLGRV
G (OUHVXUJLPLHQWRGHODVRFLRORJtDGHODburocraciaDSDUWLUGHOGHVFXEULPLHQWRGHORV
WUDEDMRVGH0D[:HEHUVXFUHDGRU
Otros autores importantes de la teoría de la
burocracia VRQ 5REHUW 0HUWRQ 3KLOLS 6HO]QLFN3HWHU%ODX5LFKDUG6FRWW5HLQKDUGW%HQGL[5REHUW0LFKHOOV\7HUHQFH+RSNLQV
La burocracia es una forma de organización
KXPDQDTXHVHEDVDHQODUDFLRQDOLGDGRVHDHVOD
adecuación de los medios a los objetivos pretenGLGRVFRQHO¿QGHJDUDQWL]DUODPi[LPDH¿FLHQciaSRVLEOHHQODE~VTXHGDGHHVRVobjetivos.
:HEHUQRFRQVLGHUyODburocracia como un
VLVWHPD VRFLDO VLQR SULQFLSDOPHQWH FRPR XQ
tipo de poder. Para comprender mejor la burocracia estudió los tipos de sociedad y los tipos
de autoridad.
:HEHU distinguió tres tipos de sociedad:
D 6RFLHGDGWUDGLFLRQDOHQODTXHSUHGRPLQDQ
características patriarcales y hereditarias
E 6RFLHGDGFDULVPiWLFDHQODTXHSUHGRPLQDQ
FDUDFWHUtVWLFDV PtVWLFDV DUELWUDULDV \ SHUVRnalistas
F 6RFLHGDG OHJDO UDFLRQDO R EXURFUiWLFD HQ
OD TXH SUHGRPLQDQ QRUPDV LPSHUVRQDOHV \
una racionalidad para escoger los medios
\ ORV ¿QHV (O HMHPSOR VHUtDQ ODV JUDQGHV
empresas.
$ FDGD WLSR GH VRFLHGDG FRUUHVSRQGH SDUD
WeberXQWLSRGHDXWRULGDG/DDXWRULGDGUHSUHVHQWDHOSRGHULQVWLWXFLRQDOL]DGR\R¿FLDOL]DGR
3RGHU LPSOLFD SRWHQFLDO SDUD HMHUFHU LQÀXHQFLD
VREUH ODV RWUDV SHUVRQDV 3DUD :HEHU HO SRGHU
VLJQL¿FD OD SRVLELOLGDG GH LPSRQHU OD SURSLD
YROXQWDG GHQWUR GH XQD UHODFLyQ VRFLDO /D DXtoridad proporciona el poder. La autoridad y el
SRGHUGHSHQGHQGHODOHJLWLPLGDGTXHHVODFDSDFLGDGGHMXVWL¿FDUVXHMHUFLFLR/DOHJLWLPLGDG
Esta teoría se origina por:
D )UDJLOLGDG \ SDUFLDOLGDG WDQWR GH OD teoría HVHOPRWLYRTXHH[SOLFDSRUTXpXQGHWHUPLQDclásica como de la teoría de las relaciones do número de personas obedece las órdenes de
DOJXLHQ (VD DFHSWDFLyQ HVD MXVWL¿FDFLyQ GHO
humanas.
E 6HYROYLyQHFHVDULRXQPRGHORGHorganiza- poder es llamada legitimación. La autoridad es
ciónUDFLRQDOFDSD]GHFDUDFWHUL]DUWRGDVODV legítima cuando es aceptada. El poder conduce
YDULDEOHVLQYROXFUDGDVDVtFRPRHOcompor- D OD GRPLQDFLyQ HQ OD TXH OD SHUVRQD TXH LPtamiento de los miembros en ellas partici- pone su arbitrio por sobre los demás cree tener
SDQWHVHQWRGDVODVIRUPDVGHorganización HOGHUHFKRGHHMHUFHUHOSRGHU\HOJREHUQDGRR
GRPLQDGRFRQVLGHUDTXHVXREOLJDFLyQHVREHGHhumana y principalmente a las empresas.
2 - Historia de la administración general y sanitaria / 47
cer las órdenes. La legitimidad de ese ejercicio
GHOSRGHUHVODTXHWHUPLQDRWRUJDQGRODUHODWLYD
estabilidad de la dominación.
:HEHU HVWDEOHFH XQD WLSRORJtD GH DXWRULGDG
TXHQRVHEDVDHQORVWLSRVGHSRGHUHPSOHDGRV
sino en las fuentes y tipos de legitimidad aplicados.
/DGRPLQDFLyQUHTXLHUHXQDSDUDWRDGPLQLVWUDWLYRSDUDHMHFXWDUODVyUGHQHV\VHUYLUFRPR
punto de unión entre el gobernante y los goberQDGRV (QWRQFHV OD OHJLWLPDFLyQ \ HO DSDUDWR
DGPLQLVWUDWLYR FRQVWLWX\HQ ORV GRV SULQFLSDOHV
criterios para la tipología weberiana.
UDWRDGPLQLVWUDWLYRLQFRQVWDQWHHLQHVWDEOH(O
SHUVRQDODGPLQLVWUDWLYRHVVHOHFFLRQDGRVHJ~Q
ODFRQ¿DQ]DTXHHOOtGHUGHSRVLWDHQORVVXERUGLQDGRV/DVHOHFFLyQQRVHEDVDHQFDOL¿FDFLRQHVSHUVRQDOHVQLHQODFDSDFLGDGWpFQLFD
VLQRHQODGHYRFLyQDXWHQWLFLGDG\FRQ¿DELOLdad en el subordinado. Si el subordinado deja
GH PHUHFHU OD FRQ¿DQ]D GHO OtGHU SDVD D VHU
VXVWLWXLGRSRURWURPiVFRQ¿DEOH'HDOOtOD
inconstancia e inestabilidad del aparato adPLQLVWUDWLYR HQ OD GRPLQDFLyQ PHQFLRQDGD
(MHPSORV GH SHUVRQDV FDULVPiWLFDV SXHGHQ
VHU+LWOHU.HQQHG\OD0DGUH7HUHVD*DQGKL
-XDQ3DEOR,,1DSROHyQHWF
F $XWRULGDGOHJDOUDFLRQDOREXURFUiWLFDFXDQdo los subordinados aceptan las órdenes de
ORV VXSHULRUHV FRPR MXVWL¿FDGDV HV SRUTXH
están de acuerdo con un conjunto de precepWRVRQRUPDVTXHFRQVLGHUDQOHJtWLPRV\GH
ORVTXHGHULYDHOPDQGR(VHOWLSRGHDXWRULdad técnicaPHULWRFUiWLFD\DGPLQLVWUDGD6H
basa en la promulgación. La obediencia no se
GHEHDDOJXLHQHVSHFt¿FDPHQWH\DVHDSRUVXV
FXDOLGDGHVSHUVRQDOHVH[FHSFLRQDOHVRSRUOD
WUDGLFLyQ VLQR D XQ FRQMXQWR GH UHJODV \ UHJODPHQWRVOHJDOHVSUHYLDPHQWHHVWDEOHFLGRV
(QWRQFHVODOHJLWLPLGDGGHOSRGHUUDFLRQDO\
legal se basa en normas legales racionalmente
GH¿QLGDV(QODGRPLQDFLyQOHJDOODFUHHQFLD
en la justicia de la ley es la fundamentación
GHODOHJLWLPDFLyQ(ODSDUDWRDGPLQLVWUDWLYR
TXH FRUUHVSRQGH D OD GRPLQDFLyQ OHJDO HV OD
burocracia7LHQHVXIXQGDPHQWRHQODVOH\HV
y en el orden legal. La posición de los funFLRQDULRV EXUyFUDWDV \VXVUHODFLRQHVFRQORV
JREHUQDGRV DJHQWHV VXVSURSLRVFROHJDVEXrócratas y los gobernantes son estrictamente
GH¿QLGDVSRUUHJODVSHUVRQDOHV\HVWULFWDVTXH
HVWDEOHFHQGHIRUPDUDFLRQDOODMHUDUTXtDGHO
DSDUDWR DGPLQLVWUDWLYR ORV GHUHFKRV \ GHEHUHVLQKHUHQWHVDFDGDSRVLFLyQORVPpWRGRVGH
UHFOXWDPLHQWR\VHOHFFLyQHWF7RPDQGRHVWD
GH¿QLFLyQODDXWRULGDGOHJDOQRVyORDEDUFDOD
moderna estructuraGHOHVWDGRVLQRWDPELpQ
principalmente las organizaciones no estataOHVHQSDUWLFXODUODVJUDQGHVHPSUHVDV
:HEHUGHVFULEHWUHVWLSRVGHDXWRULGDGOHJtWLPDDVDEHU
D $XWRULGDG WUDGLFLRQDO FXDQGR ORV VXERUGLnados aceptan las órdenes de los superiores
FRPRMXVWL¿FDGDVSRUTXHpVDVLHPSUHIXHOD
manera como se hicieron las cosas. El dominio patriarcal del padre de familia o del jefe
GHOFODQRHOGHVSRWLVPRUHDOUHSUHVHQWDQORV
tipos más puros de autoridad tradicional. El
SRGHU WUDGLFLRQDO QR HV UDFLRQDO SXHGH VHU
WUDQVPLWLGR SRU KHUHQFLD \ HV H[WUHPDGDPHQWHFRQVHUYDGRU/DOHJLWLPDFLyQGHOSRGHUHQODGRPLQDFLyQWUDGLFLRQDOYLHQHGHOD
FUHHQFLD HQ HO SDVDGR HWHUQR HQ OD MXVWLFLD
y en la pertinencia de la manera tradicional
GHDFWXDU(OOtGHUWUDGLFLRQDOHVHOVHxRUTXH
FRPDQGDHQYLUWXGGHVXHVWDWXVGHKHUHGHUR
o sucesor. El mejor ejemplo de este tipo de
SRGHUVHPDQL¿HVWDHQODVWUDGLFLRQDOHVempresas familiares.
E $XWRULGDG FDULVPiWLFD ORV VXERUGLQDGRV
DFHSWDQODVyUGHQHVGHOVXSHULRUFRPRMXVWL¿FDGDVDFDXVDGHODLQÀXHQFLDGHODSHUVRQDOLGDG\GHOOLGHUD]JRGHOVXSHULRUFRQTXLHQVH
LGHQWL¿FDQ&DULVPDHVXQWpUPLQRXVDGRFRQ
VHQWLGRUHOLJLRVRVLJQL¿FDQGRXQGRQJUDWXLWR
GH'LRVXQHVWDGRGHJUDFLD7DPELpQ\PiV
HQODDFWXDOLGDGWeber y otros usaron el térPLQRFRQHOVHQWLGRGHXQDFXDOLGDGH[WUDRUGLQDULDHLQGH¿QLEOHGHXQDSHUVRQD(OSRGHU
FDULVPiWLFRHVXQSRGHUVLQEDVHUDFLRQDOHV
LQHVWDEOH\IiFLOPHQWHDGTXLHUHFDUDFWHUtVWLFDV
UHYROXFLRQDULDV 1R SXHGH VHU GHOHJDGR QL
recibido en herencia como el tradicional. La
:HEHU LGHQWL¿FD WUHV IDFWRUHV SULQFLSDOHV
legitimación de la autoridad carismática pro- TXHIDYRUHFHQHOGHVDUUROORGHODPRGHUQDbuYLHQH GH ODV FDUDFWHUtVWLFDV SHUVRQDOHV FDULV- rocracia:
PiWLFDVGHOOtGHU\GHODGHYRFLyQ\DUUHEDWR (OGHVDUUROORGHXQDHFRQRPtDPRQHWDULD
TXHFRQVLJXHLPSRQHUDVXVVHJXLGRUHV(VWH (OFUHFLPLHQWRFXDQWLWDWLYR\FXDOLWDWLYRGHODV
WLSRGHOtGHUFDULVPiWLFRVHURGHDGHXQDSDWDUHDVDGPLQLVWUDWLYDVGHO(VWDGRPRGHUQR
48 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
/DVXSHULRULGDGWpFQLFDHQWpUPLQRVGHH¿ciencia, del tipo burocrático de administración
,PSHUVRQDOLGDGHQODVUHODFLRQHV
-HUDUTXtDGHDXWRULGDG
5XWLQDV\SURFHGLPLHQWRVHVWDQGDUL]DGRV
&RPSHWHQFLDWpFQLFD\PHULWRFUiWLFD
(VSHFLDOL]DFLyQGHODadministraciónVHSDrada de la propiedad
3URIHVLRQDOL]DFLyQGHORVSDUWLFLSDQWHV
&RPSOHWD SUHYLVLELOLGDG GH VX IXQFLRQDmiento
El modelo concebido con gran anticipación
SRU0D[:HEHUWLHQHPXFKDVHPHMDQ]DFRQODV
grandes organizaciones como la General MotorsODPhillipsODSears RoebuckODFordHWF
7HQHPRV TXH DFODUDU TXH VHJ~Q HO FRQFHSWR
SRSXODU OD burocracia se presenta generalmente
/DVYHQWDMDVGHODburocraciaVHJ~Q:HEHU
como una organización donde el papeleo se multiSOLFD\DXPHQWDLPSLGLHQGRVROXFLRQHVUiSLGDVR son las siguientes:
H¿FLHQWHV7DPELpQVHSXHGHSHQVDUHQXQDSHJR 5DFLRQDOLGDG
H[DJHUDGRGHORVIXQFLRQDULRVDORVUHJODPHQWRV\ 3UHFLVLyQ
5DSLGH]HQODVGHFLVLRQHV
UXWLQDVFDXVDQGRLQH¿FLHQFLDHQODorganización.
8QLGDGGHLQWHUSUHWDFLyQJDUDQWL]DGDSRUOD
(QWRQFHVVHSDVyDGDUHOQRPEUHGHburocracia a las disfunciones del sistema y no al sisreglamentación
tema en sí mismo.
8QLIRUPLGDGGHUXWLQDV\SURFHGLPLHQWRV
El concepto de burocraciaSDUD0D[:HEHU &RQWLQXLGDG
HV H[DFWDPHQWH OR FRQWUDULR /D burocracia es
5HGXFFLyQGHOFRQÀLFWRHQWUHODVSHUVRQDV
la organización H¿FLHQWH SRU H[FHOHQFLD 3DUD &RQVWDQFLD
conseguir esa H¿FLHQFLDla burocracia necesita
6XERUGLQDFLyQGHORVPiVQXHYRVDORVPiV
antiguos
SUHYHUDQWLFLSDGDPHQWH\FRQPtQLPRVGHWDOOHV
&RQ¿DELOLGDG
cómo se deberían realizar las tareas.
([LVWHQFLD GH EHQH¿FLRV EDMR HO SXQWR GH
YLVWDGHODVSHUVRQDVHQODorganización
6HJ~Q 0D[ :HEHU OD burocracia tiene las
siguientes características principales:
&DUiFWHUOHJDOGHODVQRUPDV\UHJODPHQWRV
6LQHPEDUJRODburocracia FUHDGDSRU:HEHU\SODQHDGDSDUDWHQHUXQDPD\RUH¿FLHQFLD
&DUiFWHUIRUPDOGHODVFRPXQLFDFLRQHV
en la organización WLHQH QXPHURVDV GLVIXQFLR &DUiFWHUUDFLRQDO\GLYLVLyQGHOWUDEDMR
TIPOS DE
SOCIEDAD
CARACTERÍSTICAS
LEGITIMACIÓN
APARATO
ADMINISTRATIVO
7UDGLFLRQDO
No es racional.
Poder heredado o
delegado
Basada en el señor
7UDGLFLyQ
KiELWRVXVRV\
costumbres
)RUPD
patrimonial y
forma feudal
Grupos
UHYROXFLRQDULRV
partidos
SROtWLFRV
naciones en
UHYROXFLyQ
Carismática
1RHVUDFLRQDO
QLKHUHGDGDQL
delegable. Basada
en el carisma
Características
personales
KHURtVPR
PDJLDSRGHU
PHQWDO carismáticas
del líder
Inconstante e
inestable
Escogido de
acuerdo con la
OHDOWDG\GHYRFLyQ
al líder y no por
FDOL¿FDFLRQHV
técnicas
Estados
PRGHUQRV
grandes
HPSUHVDV
ejércitos
/HJDO
racional o
burocrática
/HJDOUDFLRQDO
LPSHUVRQDOIRUPDO
Meritocrática
Justicia
de la ley
Promulgación y
reglamentación
de normas
legales
SUHYLDPHQWH
GH¿QLGDV
Burocracia
CARACTERÍSTICAS
EJEMPLOS
7UDGLFLRQDO
Patriarcal y
patrimonialista
&RQVHUYDGRUD
&ODQWULEX
IDPLOLD
socidad
PHGLHYDO
Carismática
3HUVRQDOLVWD
mística y arbitraria
5HYROXFLRQDULD
/HJDO
racional o
burocrática
Racionalidad de
los medios y de los
REMHWLYRV
TIPOS DE
AUTORIDAD
Cuadro 2.3: Tipología de sociedad y tipología de autoridad y sus características según Weber
2 - Historia de la administración general y sanitaria / 49
QHV TXH VXUJHQ GH FRQVHFXHQFLDV LPSUHYLVWDV
TXHWHUPLQDQOOHYDQGRHOPRGHORDODLQH¿FDFLD
y a la imperfección. Dichas disfunciones de la
burocracia son:
0D\RULQWHUQDFLRQDOL]DFLyQGHODVUHJODV\
H[DJHUDGRDSHJRDORVUHJODPHQWRV
([FHVRGHIRUPDOLVPR\GHSDSHOHR
*UDQUHVLVWHQFLDDOFDPELR
'HVSHUVRQDOL]DFLyQGHODVUHODFLRQHV
&DWHJRUL]DFLyQ FRPR EDVH GHO SURFHVR GHcisorio
6XSHUFRQIRUPLGDGFRQODVUXWLQDV\SURFHdimientos
'HPDVLDGD H[KLELFLyQ GH VHxDOHV GH DXWRridad
'L¿FXOWDGHVHQODDWHQFLyQGHFOLHQWHV\FRQÀLFWRFRQHOS~EOLFR
VREUH WRGR SRU OD LQTXLHWXG GHVSHUWDGD SRU HO
PRGHOREXURFUiWLFRGH:HEHU.
/DUHSUHVHQWDFLyQJUi¿FDGHOPRGHORGH:HEHUVHPXHVWUDHQHO&XDGUR
El período de actuación de esta Escuela fue
HQWUHORVDxRV
6tQWHVLVGHVXVLGHDV\WUDEDMRVPiVVLJQL¿FDWLYRV
‡(QVXFRQMXQWRHODERUDURQHOSULPHULQWHQWR
de modelo integral de la administraciónHV
GHFLUIRUPDO :HEHU HLQIRUPDO 0HUWRQ ‡ :HEHU DSRUWy XQ PRGHOR GH FRQWURO VRFLDO
muy completo apoyado en su concepción de
la autoridad legal.
‡0HUWRQOHDGLFLRQyXQDQiOLVLVGHODFRQGXFta basado en las funciones latentes y mani¿HVWDV
(Q JUDQ SDUWH HVWDV GLVIXQFLRQHV VH GHEHQ
D TXH DO IRUPDU XQ PRGHOR EXURFUiWLFR GH organización:HEHUQRKDSUHYLVWRODSRVLELOLGDG
Limitaciones de sus ideas y trabajos:
GH ÀH[LELOL]DU OD burocracia para tender a dos
‡$SHVDUGHVHULQWHJUDOHOPRGHORestructuralista arrastra el lastre de la concepción forcircunstancias:
PDOLVWDGH:HEHU
$GDSWDFLyQ GH OD burocracia D ODV H[LJHQFLDVH[WHUQDVGHORVFOLHQWHV
‡7RGRHODQGDPLDMHDGPLQLVWUDWLYRUHFRQRFHOD
$GDSWDFLyQ GH OD burocracia D ODV H[LJHQLQÀXHQFLD neoclásica siendo en consecuenFLDVXVFHSWLEOHGHWRGDVODVFUtWLFDVTXHVHOH
cias internas de los participantes
UHDOL]DURQDDTXpOORV
3DUDDOJXQRVDXWRUHVHOPRGHOREXURFUiWLFR ‡/DFRQFHSFLyQGHOD$XWRULGDG/HJDOHVIRUmalista y autoritaria.
constituye el tercer pilar de la teoría tradicional
de la organizaciónDOODGRGHOtaylorismo y de la
Teorías\RtécnicasTXHVHDSOLFDQ\TXHLQobra de Fayol \*XOLFN(VHPRGHORIXHHOSXQWR
de partida para los sociólogos y estudiosos de la tegran la actual ciencia de la administración:
‡/DestructuraGHOPRGHORGH:HEHU\0HUWRQ
SROtWLFDHQODHYDOXDFLyQGHODVorganizaciones.
HVDSOLFDEOHSHURPRGL¿FDGD\DGDSWDGDDOD
:HEHU HV WRPDGR FRPR HO SUHFXUVRU GHO estructuralismo VLQ HPEDUJR SURSRQH XQ PRGHOR
realidad de las organizaciones.
mecanicista bastante consistente dentro de las
‡ /RV WUDEDMRV GH 0HUWRQ \ *RXOGQHU FRQVtituyeron un importante punto de partida
líneas generales de la teoría de la organización
para la incorporación de los factores de la
formal y clásica&RQHVWDDVRFLDFLyQVHH[SOLFD
conducta a los modelos y teorías adminisSRUTXpHOPRGHORGH:HEHU SUHVHQWDHQJHQHUDO
WUDWLYDV
ODVPLVPDVGHVYHQWDMDVGHORVPRGHORVclásicos.
(O PRGHOR EXURFUiWLFR TXH SUHWHQGLy VHQWDU ‡ 6XV teorías GHO HTXLOLEULR \ GHO EDODQFH GH
contribuciones y compensaciones no son aplas bases de un modelo ideal y racional de ortas para la realidad de las organizaciones.
ganizaciónTXHSXGLHVHVHUDSOLFDGRDWRGDVODV
empresasDSHVDUGHVXGHIHFWROODPyODDWHQFLyQGHPXFKRVDXWRUHVTXHKLFLHURQGLIHUHQWHV
estudios sobre la burocracia 3RU HMHPSOR SR- ESCUELA DEL COMPORTAMIENTO O DE LA TEORÍA DE
demos mencionar a Amitai Etzioni; Peter Blau; LA ORGANIZACIÓN
5LFKDUG 6FRWW &KDUOHV 3HUURZ 1RUWKFRWH 3DUNLQVRQ /DXUHQFH 3HWHU 5LFKDUG +DOO \ $OYLQ &RQODHYROXFLyQFRQVWDQWHGHOSHQVDPLHQWRDG*RXOGQHU7RGRVHVWRVDXWRUHVSURIXQGL]DURQHQ PLQLVWUDWLYRVXUJHODOODPDGDHVFXHODGHOcomQXPHURVRV HVWXGLRV HO DQiOLVLV GH ORV GLVWLQWRV portamientoDGPLQLVWUDWLYRRGHODteoría de la
WLSRVRUJDQL]DWLYRV(VWRVHVWXGLRVVHUHDOL]DURQ organización.
50 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
SISTEMA MAYOR
(OTRA BUROCRACIA)
SISTEMA MENOR
B1: PRESIDENTE
Rx
F-a-r-p
Nx
Dx
AL
B2: DIRECTOR
B3: DIRECTOR
F-a-r-p
F-a-r-p
Lx
Ox
C1: GERENTE
C2: GERENTE
F-a-r-p
F-a-r-p
D1: JEFE DE
DIVISIÓN
D2: JEFE DE
DIVISIÓN
F-a-r-p
F-a-r-p
Rx: reglas
Nx: normas
Dx: decretos
Lx: leyes
Ox: ordenanzas
(x varía, en todos los casos, de 1 a N)
AL: autoridad legal
F: funciones
a: autoridad de cada cargo
r: responsabilidad de cada cargo
p: procedimientos
Cuadro 2.4: Representación del modelo de Weber
/DVUDtFHVSURIXQGDVGHHVWHQXHYRHQIRTXH cidad de conclusiones acerca de la naturaleza
SXHGHQ ORFDOL]DUVH HQ (VWDGRV 8QLGRV D SDUWLU y características del hombre. Algunas de ellas
GHORVDxRV
son:
(O HQIRTXH GHO comportamiento marca el
(OKRPEUHHVXQDQLPDOVRFLDOGRWDGRGHQHmás fuerte énfasis de las ciencias del comporcesidades.
tamiento en la teoría DGPLQLVWUDWLYD \ HQ OD (OKRPEUHHVXQDQLPDOGRWDGRGHXQsisteE~VTXHGD GH VROXFLRQHV GHPRFUiWLFDV \ ÀH[LmaSVtTXLFRJUDFLDVDOTXHWLHQHFDSDFLGDG
EOHV D ORV SUREOHPDV GH ODV RUJDQL]DFLRQHV
de organizar sus percepciones en un todo
0LHQWUDVTXHHOestructuralismo fue profundaintegrado.
PHQWHLQÀXLGRSRUODVRFLRORJtDHOHQIRTXHGHO (OKRPEUHWLHQHFDSDFLGDGGHDUWLFXODUOHQcomportamiento se originó en las ciencias de
guaje con raciocinio abstracto y tiene capaciODFRQGXFWD\VREUHWRGRGHODSVLFRORJtDRUdad de comunicación.
ganizacional.
(O KRPEUH HV XQ DQLPDO GRWDGR GH DFWLWXLas ciencias del comportamiento han brinGHVSDUDDSUHQGHU\SRUORWDQWRFDPELDUVX
dado a la teoría DGPLQLVWUDWLYD XQD PXOWLSOLcomportamiento.
2 - Historia de la administración general y sanitaria / 51
(VWD HVFXHOD VH RFXSD GH HVWDEOHFHU QXHYDV
(O comportamiento humano está orientado
hacia objetivos TXH VRQ PX\ FRPSOHMRV \ SURSRVLFLRQHV VREUH OD PRWLYDFLyQ KXPDQD (Q
este aspecto un rol muy interesante lo juega la jemutables.
(OKRPEUHVHFDUDFWHUL]DSRUXQSDWUyQGXDO UDUTXtDGHODVQHFHVLGDGHVGH$EUDKDP0DVORZ
de comportamiento SXHV SXHGH FRRSHUDU
Los presupuestos de la teoríaGH0DVORZVRQ
pero también puede competir con los otros.
6RODPHQWH FXDQGR XQ QLYHO LQIHULRU GH QHFHVLGDGHVHVWiVDWLVIHFKRHVFXDQGRHOQLYHO
La escuela de la teoría del comportamiento
LQPHGLDWDPHQWH PiV HOHYDGR VXUJH HQ HO
pregona el abandono de las posiciones normaticomportamiento.
YDV\SUHVFULSWLYDVGHODVteorías anteriores. Nos
1RWRGDVODVSHUVRQDVFRQVLJXHQOOHJDUDOD
HVWDPRVUH¿ULHQGRDODteoría clásicateoría de
cima de la pirámide.
las relaciones humanas y teoría de la burocracia /D QXHYD HVFXHOD DGRSWD SRVLFLRQHV H[SOL &XDQGRODVQHFHVLGDGHVPiVEDMDVHVWiQUD]RQDEOHPHQWH VDWLVIHFKDV ODV QHFHVLGDGHV
FDWLYDV \ GHVFULSWLYDV PDQWHQLHQGR VLHPSUH HO
ORFDOL]DGDVHQORVQLYHOHVPiVHOHYDGRVFRénfasis en las personas.
mienzan a dominar el comportamiento.
/RV DXWRUHV TXH SRGHPRV LQFRUSRUDU D HVWH
PRYLPLHQWRVRQ-DPHV0DUFK5LFKDUG&\HUW &DGD SHUVRQD SRVHH VLHPSUH PiV GH XQD
PRWLYDFLyQ
+HUEHUW 6LPRQ $EUDKDP 0DVORZ )UHGHULF
+HU]EHUJ 'RXJODV 0F*UHJRU 5HQVLV /LFNHUW
Otra teoríaHQHOWHPDGHODPRWLYDFLyQHVOD
&KHVWHU%DUQDUG&KULV$UJ\ULV:DUUHQ%HQQLV
\'DYLV0F&OHOODQG3RVLEOHPHQWH+HUEHUW6L- de los dos factores de Hertzberg.
PRQIXHOD¿JXUDPiVGHVWDFDGDGHHVWHJUXSR
3DUDHVWHDXWRUH[LVWHQGRVJUXSRVGHIDFWRres en las organizaciones.
*DQyHO3UHPLR1REHOGH(FRQRPtDHQ
NO-SATISFACCIÓN
Las frustaciones pueden ser
derivadas de:
‡)UDFDVRHQODSURIHVLyQ
,QVDWLVIDFFLyQHQHOWUDEDMR
‡%DMRstatus
‡%DMRVDODULR
VHQVDFLyQGHGHVLJXDOGDG
‡%DMDLQWHUDFFLyQ
\UHODFLyQFRQFROHJDV
MHIHV\VXERUGLQDGRV
‡7LSRGHWUDEDMR\
DPELHQWHGHWUDEDMR
PDOHVWUXFWXUDGRV
‡3ROtWLFDVGHOD
empresa
LPSUHYLVLEOHV
‡/LPLWDFLyQGHO
OXJDUGHWUDEDMR
‡5HPXQHUDFLyQ
inadecuada
SATISFACCIÓN
AUTORREALIZACIÓN
(AUTOACTUALIZACIÓN)
ESTIGMA
(EGO)
SOCIALES
(AMOR)
SEGURIDAD
Satisfacciones pueden ser
derivadas de:
‡e[LWRHQODSURIHVLyQ
3ODFHUHQHOWUDEDMR
‡,QWHUDFFLyQIDFLOLWDGD
SRUODGLVWULEXFLyQILVFDO
‡3UHVWLJLRHQODSURIHVLyQ
‡(OHYDGDLQWHUDFFLyQ\
UHODFLyQFRQFROHJDV
MHIHV\VXERUGLQDGRV
‡7LSRGHWUDEDMR\
DPELHQWHGHWUDEDMR
ELHQHVWUXFWXUDGRV
‡3ROtWLFDVHVWDEOHV\
SUHYLVLEOHVGHOD
empresa
‡5HPXQHUDFLyQDGHFXDGD
SDUDODVDWLVIDFFLyQGH
ODVQHFHVLGDGHVEiVLFDV
FISIOLÓGICAS
Cuadro 2.5: La satisfacción y no-satisfacción (frustración) de las necesidades básicas
52 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
$ XQRV ORV GHQRPLQy IDFWRUHV KLJLpQLFRV
H[WUtQVHFRV R QR PRWLYDFLRQDOHV /RV RWURV HQ
FDPELR VRQ ORV IDFWRUHV PRWLYDFLRQDOHV R LQWUtQVHFRV /RV VHJXQGRV VRQ ORV TXH UHDOPHQWH
SURYRFDQ HO HIHFWR GH OD PRWLYDFLyQ HQ ORV LQGLYLGXRV SXHV ORV DQWHULRUHV QR JHQHUDQ PRWLYDFLyQ\VRODPHQWHSXHGHQSURYRFDUVLWXDFLRQHV
TXHORJUHQTXHODVSHUVRQDVKDJDQpQIDVLVHQHO
mantenimiento del trabajo.
)LQDOPHQWH +HUW]EHUJ WDPELpQ SURSRQH HO
HQULTXHFLPLHQWRGHWDUHDVRHQULTXHFLPLHQWRGHO
FDUJRSDUDSURSRUFLRQDUPRWLYDFLyQFRQWLQXDHQ
el trabajo.
Sobre los estilos de administraciónVHSUHocupó muy especialmente Douglas McGregor
y estableció las denominadas teoría X y teoría
Y. La teoría XGLFHTXHODVSHUVRQDVVRQSHUH]RVDV H LQGROHQWHV TXH HYLWDQ HO WUDEDMR \ OD
responsabilidad y necesitan ser controladas y
GLULJLGDV2EYLDPHQWHHVWDVSHUVRQDVQRWLHQHQ
LQLFLDWLYD \ VX ~QLFD PRWLYDFLyQ HQ HO WUDEDMR
HV HO DVSHFWR GLQHUDULR (Q FDPELR la teoría
Y DEDUFD D SHUVRQDV TXH VH HVIXHU]DQ TXH OHV
JXVWD VX WUDEDMR TXH EXVFDQ \ DFHSWDQ UHVSRQVDELOLGDGHV\GHVDItRVTXHVRQFUHDWLYDV\
FRPSHWHQWHV\TXHSXHGHQVHUDXWRPRWLYDGDV\
autodirigidas.
3RUVXSXHVWRHVWDV~OWLPDVSHUVRQDVEXVFDQ
IDFWRUHVPRWLYDFLRQDOHVDOHMDGRVGHODVLPSOLFLdad del salario.
'HQWURGHHVWDHVFXHOD¿JXUDWDPELpQ5HQVLV
/LFNHUWTXHVHSUHRFXSySRUORVGLIHUHQWHVsistemas de administración.
Los caracterizó por sistema:
$XWRULWDULRFRHUFLWLYR
$XWRULWDULREHQHYROHQWH
&RQVXOWLYR
3DUWLFLSDWLYR
FACTORES MOTIVACIONALES
(SATISFACCIONES)
Contenido del cargo
&yPRVHVLHQWHHOLQGLYLGXR
HQUHODFLyQFRQVXFDUJR
1. El trabajo en sí
5HDOL]DFLyQ
5HFRQRFLPLHQWR
4. Progreso profesional
5. Responsabilidad
'HHVWDPDQHUDOOHJyDFODVL¿FDUODVGLIHUHQtes posturas dentro del liderazgo situacional.
Para otro de los autores incluidos en este moYLPLHQWRTXHHV&KHVWHU%DUQDUGODVSHUVRQDV
QRDFW~DQDLVODGDPHQWHVLQRDWUDYpVGHLQWHUDFFLRQHV FRQ RWUDV SHUVRQDV SDUD SRGHU DOFDQ]DU
sus objetivos de la mejor manera. Esas interacFLRQHV KXPDQDV JHQHUDQ XQD PXWXD LQÀXHQFLD
HQWUHODVSHUVRQDV\VRQHQGH¿QLWLYDODVUHODFLRQHV VRFLDOHV (QWRQFHV OR TXH QRV SURSRQH
Barnard es un sistema VRFLDOFRRSHUDWLYR
(VWDHVFXHODWXYRXQDJUDQLPSRUWDQFLDHQOD
teoríaGHODGHFLVLyQTXHQDFLyFRQ+HUEHUW6Lmon. Este autor concibe la organización como
un sistema de decisiones. En este sistemaFDGD
SHUVRQD SDUWLFLSD UDFLRQDO \ FRQVFLHQWHPHQWH
HVFRJLHQGR\WRPDQGRGHFLVLRQHVLQGLYLGXDOHV
UHVSHFWRGHDOWHUQDWLYDVPiVRPHQRVUDFLRQDles de comportamiento$VtHVTXHODorganización comprende decisiones y acciones.
Dentro del proceso de decisión se reconocen:
$JHQWHGHFLVRU
Objetivos
3UHIHUHQFLDV
(VWUDWHJLDV
6LWXDFLyQ
5HVXOWDGR
La racionalidad del proceso está implícita en
ODDFWLYLGDGGHHOHJLU(ODJHQWHGHFLVRUVHOHFFLRQD XQD DOWHUQDWLYD HQWUH RWUDV SDUD DOFDQ]DU XQ
GHWHUPLQDGR¿Q
Las etapas del proceso decisorio son:
3HUFHSFLyQGHODVLWXDFLyQGHTXHH[LVWHXQ
problema
$QiOLVLV\GH¿QLFLyQGHOSUREOHPD
'H¿QLFLyQGHORVobjetivos
%~VTXHGDGHDOWHUQDWLYDVGHVROXFLyQ
FACTORES HIGIÉNICOS
(INSATISFACCIONES)
&RQWH[WRGHOFDUJR
&yPRVHVLHQWHHOLQGLYLGXR
HQUHODFLyQFRQVXHPSUHVD
1. Las condiciones de trabajo
$GPLQLVWUDFLyQGHODHPSUHVD
6DODULR
5HODFLRQHVFRQHOVXSHUYLVRU
%HQH¿FLRV\VHUYLFLRVVRFLDOHV
Cuadro 2.6: Factores motivacionales y factores higiénicos
2 - Historia de la administración general y sanitaria / 53
SUPUESTOS DE LA TEORÍA X
‡/DVSHUVRQDVVRQSHUH]RVDVHLQGROHQWHV
‡/DVSHUVRQDVHYLWDQHOWUDEDMR
‡/DVSHUVRQDVHYLWDQODUHVSRQVDELOLGDGFRQHO
¿QGHVHQWLUVHPiVVHJXUDV
‡/DVSHUVRQDVQHFHVLWDQVHUFRQWURODGDV\
dirigidas
‡/DVSHUVRQDVVRQLQJHQXDV\VLQLQLFLDWLYD
SUPUESTOS DE LA TEORÍA Y
‡/DVSHUVRQDVVHHVIXHU]DQ\OHVJXVWDWHQHU
DOJRTXHKDFHU
‡(OWUDEDMRHVXQDDFWLYLGDGWDQQDWXUDOFRPR
GLYHUWLUVHRGHVFDQVDU
‡/DVSHUVRQDVEXVFDQ\DFHSWDQ
responsabilidades y desafíos.
‡/DVSHUVRQDVSXHGHQVHUDXWRPRWLYDGDV\
autodirigidas.
‡/DVSHUVRQDVVRQFUHDWLYDV\FRPSHWHQWHV
Cuadro 2.7: La Teoría X y la Teoría Y, como diferentes concepciones respecto de la naturaleza humana
FHFXDQGRHOORVSRVHHQXQGHWHUPLQDGRYDORUGH
XWLOLGDGTXHYDUtDGHLQGLYLGXRDLQGLYLGXR/DV
contribuciones son ofrecidas a la organización
por los participantes de la misma y consisten en
WUDEDMR GHGLFDFLyQ HVIXHU]R GHVHPSHxR SXQ3DUD 6LPRQ ORV HOHPHQWRV TXH LQWHUYLHQHQ WXDOLGDGOHDOWDGUHFRQRFLPLHQWRHWF/DXWLOLGDG
en el proceso decisorio son muchos. Algunos GHODVFRQWULEXFLRQHVHVHOYDORUTXHHOHVIXHU]R
GHXQLQGLYLGXRWLHQHSDUDODorganizaciónFRQHO
ejemplos:
¿QGHTXHpVWDDOFDQFHVXVobjetivos.
D 5DFLRQDOLGDGOLPLWDGDGHOGHFLVRU
En consecuencia: todo participante mantenE ,PSHUIHFFLyQGHODVGHFLVLRQHV
drá su participación en la organización PLHQF 5HODWLYLGDGGHODVGHFLVLRQHV
WUDVTXHORVLQFHQWLYRVRUHFRPSHQVDVTXHOHVRQ
G -HUDUTXL]DFLyQGHODVGHFLVLRQHV
RIUHFLGRVVHDQLJXDOHVRPD\RUHVTXHODVFRQWULH 5DFLRQDOLGDGDGPLQLVWUDWLYD
EXFLRQHVTXHOHVRQH[LJLGDV
I /DLQÀXHQFLDRUJDQL]DFLRQDO
(VWDHVFXHODWDPELpQVHRFXSDGHOFRQÀLFWR
+HUEHUW6LPRQLPSRQHOD¿JXUDGHO³KRPEUH entre los objetivos organizacionales y los objetiDGPLQLVWUDWLYR´TXHVHRSRQHDO³KRPEUHHFRQy- vosLQGLYLGXDOHV
PLFR´TXHUHVSRQGHDODteoría clásica o al “hom6REUHHVWHWHPD$UJ\ULVFRQFOX\HTXH
EUHVRFLDO´TXHSHUWHQHFHDODteoría de las relaciones humanas(OKRPEUHDGPLQLVWUDWLYRSRVHH (VSHUIHFWDPHQWHSRVLEOHODLQWHJUDFLyQGH
ODVQHFHVLGDGHVLQGLYLGXDOHVFRQORVUHTXLXQDUDFLRQDOLGDGOLPLWDGD\SRUORWDQWRVRODPHQWH
sitos de producción de una organización.
busca una manera satisfactoria y no la mejor mane /DVorganizacionesTXHSUHVHQWDQDOWRJUDGR
UDGHKDFHUXQWUDEDMR(QWRQFHVHOcomportamienGHLQWHJUDFLyQHQWUHORVobjetivos LQGLYLGXDto DGPLQLVWUDWLYREXVFDVDWLVIDFHU\QRRSWLPL]DU
OHV\RUJDQL]DFLRQDOHVVRQPiVSURGXFWLYDV
SXHVHO³KRPEUHDGPLQLVWUDWLYR´WRPDGHFLVLRQHV
TXHODVRWUDV
VLQ EXVFDU WRGDV ODV DOWHUQDWLYDV SRVLEOHV 1R VH
EXVFDHOOXFURPi[LPRVLQRHOOXFURDGHFXDGRQR (QOXJDUGHUHSULPLUHOGHVDUUROOR\HOSRWHQFLDOGHOLQGLYLGXRODVorganizaciones pueden
HOSUHFLRySWLPRVLQRHOSUHFLRUD]RQDEOH
FRQWULEXLUHQJUDQSDUWHDVXPHMRUDPLHQWR
Con respecto al comportamiento organizaFLRQDO SRGHPRV GHFLU TXH VH WUDWD GHO HVWXGLR
Las críticas principales a esta escuela se cendel funcionamiento y de la dinámica de las organizaciones\GHFyPRORVJUXSRV\ORVLQGLYLGXRV tran en:
VHFRPSRUWDQGHQWURGHHOOD(VSRUORWDQWRXQD 'HPDVLDGRpQIDVLVHQODVSHUVRQDV
([FHVLYDSUHRFXSDFLyQHQXQHQIRTXHPiV
ciencia interdisciplinaria y casi independiente.
GHVFULSWLYR\PX\SRFRSUHVFULSWLYR
$OREVHUYDUORVPRWLYRVSRUORVTXHODVSHUVR 3URIXQGD UHIRUPXODFLyQ HQ OD ¿ORVRItD DGQDVFRRSHUDQ&KHVWHU%DUQDUGSODQWHDODorganiPLQLVWUDWLYD
zación como un sistemaTXHUHFLEHFRQWULEXFLRQHV
'LPHQVLRQHVELSRODUHVGHODteoría del comde los participantes y a cambio les ofrece alicienportamiento TXH VRQ SHUPHDEOHV HQWUH Vt
WHV R LQFHQWLYRV 'LFKRV LQFHQWLYRV R DOLFLHQWHV
3RU HMHPSOR HO DQiOLVLV HV VLHPSUH WHyULFR
VRQ³SDJRV´/DXWLOLGDGGHORVLQFHQWLYRVDSDUH (YDOXDU\FRPSDUDUODVDOWHUQDWLYDV
6HOHFFLRQDUODDOWHUQDWLYDPiVDGHFXDGDSDUD
alcanzar los objetivos
,PSOHPHQWDFLyQGHODDOWHUQDWLYDHVFRJLGD
54 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
SISTEMAS DE ADMINISTRACIÓN
VARIABLES
PRINCIPALES
1
AUTORITARIOCOERCITIVO
2
AUTORITARIO
BENEVOLENTE
Proceso
decisorio
7RWDOPHQWH
centralizado en la
alta administración
Sistema de
comunicación
Bastante precario.
Sólo
comunicaciones
YHUWLFDOHV
descendentes
cargando órdenes
Centralizado
en la alta
DGPLQLVWUDFLyQ
pero permitiendo
XQDSHTXHxD
delegación de
carácter rutinario
5HODWLYDPHQWH
SUHFDULR
SUHYDOHFHQODV
comunicaciones
descendentes sobre
las ascendentes.
Relaciones
3URYRFDQ
interpersonales GHVFRQ¿DQ]D
La organización
LQIRUPDOHVYHGDGD
y considerada
perjudicial. Los
cargos y tareas
FRQ¿QDQDODV
personas.
Sistemas de
recompensas
Énfasis en los
castigos y medidas
disciplinarias.
Obediencia estricta
a los reglamentos
internos.
Raras recompensas
GHRULJHQ
estrictamente
VDODULDO
3
CONSULTIVO
Consulta a
ORVQLYHOHV
inferiores
permitiendo
participación y
delegación
Se busca
facilitar el
ÀXMRHQHO
VHQWLGRYHUWLFDO
GHVFHQGHQWH\
DVFHQGHQWH \
horizontal.
6RQWROHUDGDV
&LHUWDFRQ¿DQ]D
con cierta
en las personas
condescendencia.
y en sus
Organización
relaciones.
informal incipiente La empresa
y considerada
busca facilitar
como una amenaza el desarrollo
para la empresa
de una
organización
informal sana.
Énfasis en los
Énfasis en las
castigos y medidas recompensas
GLVFLSOLQDULDV
materiales
pero con menor
SULQFLSDOPHQWH
arbitrariedad.
VDODULRV Recompensas
Recompensas
salariales más
sociales
frecuentes.
ocasionales.
Las recompensas
Raros castigos o
sociales raras
penas
4
PARTICIPATIVO
7RWDOPHQWH
delegado y
descentralizado.
1LYHOLQVWLWXFLRQDO
GH¿QHSROtWLFDV
controla resultados.
Sistemas de
comunicación
H¿FLHQWHVVRQ
fundamentales
SDUDHOp[LWRGHOD
empresa.
7UDEDMRUHDOL]DGR
HQHTXLSRV/D
formación de
grupos se hace
importante.
&RQ¿DQ]DPXWXD
participación y
compromiso grupal
intensos
Énfasis en las
recompensas
sociales.
Recompensas
materiales y
salariales frecuentes.
Penas son raras y
cuando ocurren son
GH¿QLGDVSRUORV
grupos.
Cuadro 2.8: Los cuatro sistemas de administración según Likert
vs. empírico; macro vs. micro; organización
formal vs.LQIRUPDOFRJQLWLYRvs.DIHFWLYR
/DUHODWLYLGDGGHODVteoríasGHPRWLYDFLyQ
ORTXHSRQHHQGXGDVXYDOLGH]
3URIXQGDLQÀXHQFLDGHODVciencias del comportamiento sobre la administración
/Dorganización como un sistema de decisiones solamente formales
(O DQiOLVLV RUJDQL]DFLRQDO YDULDGR HQ VXV
GLIHUHQWHVLQWHUSUHWDFLRQHVDSDUWLUGHOcomportamiento.
6XSHUtRGRGHDFWXDFLyQIXHHQWUH
6tQWHVLVGHVXVLGHDV\WUDEDMRVPiVVLJQL¿FDWLYRV
‡'HVDUUROODURQXQDFUtWLFDGHPROHGRUDGHORV
principios clásicos.
‡5HHVWUXFWXUDURQODFRQFHSFLyQGHODDXWRULGDG
de las comunicaciones y de la estructura.
‡'HVDUUROODURQODteoría de las decisiones.
‡(ODERUDURQtécnicas de análisis y conducción
GHFRQÀLFWRV
‡'HVDUUROODURQODteoría de los objetivos.
‡0HWRGROyJLFD\VHPiQWLFDPHQWHVXVteorías
son perfectibles.
Teorías\RtécnicasTXHVHDSOLFDQ\TXHLQtegran la actual ciencia de la administración:
‡7HRUtD sobre los objetivos de la organización
‡7HRUtD de la decisión
2 - Historia de la administración general y sanitaria / 55
‡7HRUtDGHODDXWRULGDG\ODLQÀXHQFLD
‡7HRUtD de la racionalidad y la H¿FLHQFLD
‡7HRUtDGHOFRQÀLFWR
HVXQSURFHVRSODQHDGRGHPRGL¿FDFLRQHVFXOWXrales y estructuralesSHUPDQHQWHPHQWHDSOLFDGR
a una organización.
El desarrollo organizacional es una respuesta de la organización a los cambios. Es un esLimitaciones de sus ideas y trabajos:
‡ 6XV teorías HVWiQ H[FHVLYDPHQWH LQÀXHQFLD- IXHU]R HGXFDFLRQDO PX\ FRPSOHMR GHVWLQDGR D
das por la corriente sociológica conductista. FDPELDU DFWLWXGHV YDORUHV comportamientos y
la estructura de la organizaciónGHPDQHUDWDO
TXHpVWDSXHGDDGDSWDUVHPHMRUDODVQXHYDVFR\XQWXUDV PHUFDGRV WHFQRORJtDV SUREOHPDV \
ESCUELA DE LA TEORÍA DEL DESARROLLO
GHVDItRVTXHVHSUHVHQWDQGHQWURGHXQDPELHQORGANIZACIONAL
te altamente dinámico y sujeto a una mutación
(QODGpFDGDFRUUHVSRQGLHQWHDXQJUXSR aceptada.
7RGD organización interactúa con el medio
GHFLHQWt¿FRVVRFLDOHVHQORV(VWDGRV8QLGRVGHVDUUROOy FLHUWRV WUDEDMRV TXH GDQ pQIDVLV DO GH- DPELHQWH LQÀX\H \ UHFLEH LQÀXHQFLDV GHO DPELHQWHH[WHUQR
sarrollo planeado de las organizaciones.
(OPRYLPLHQWRGHOdesarrollo organizacional
Hay tres soluciones básicas para enfrentar
VXUJLy D SDUWLU GH QR FRQ XQ ~QLFR DXWRU
sino con un complejo conjunto de ideas respecto ORVFDPELRVTXHRFXUUHQHQHODPELHQWH
GHOKRPEUHGHODorganización\GHODPELHQWH D (VSHUDU LQGH¿QLGDPHQWH XQD VROXFLyQ VLQ
comportarse como agente de ella
en el sentido de propiciar el crecimiento y deE 3UHWHQGHUUHIRUPDUDWUDYpVGHODUWL¿FLRGH
sarrollo según sus potencialidades. En el sentido
yUGHQHV\GHWHUPLQDFLRQHVYHUEDOHV\HVFULHVWULFWRHOdesarrollo organizacional es un desdoblamiento práctico y operacional de la teoría
WDVTXHQRVHQVLELOL]DQDODVSHUVRQDV
del comportamiento en camino al enfoque sisF 5HFXUULUDOdesarrollo organizacional como
témico.
un proceso de cambio planeado
/RVGLYHUVRVPRGHORVGHdesarrollo organizacional FRQVLGHUDQ EiVLFDPHQWH FXDWUR YDULDbles:
(OPHGLRDPELHQWH
/Dorganización
(OJUXSRVRFLDO
(OLQGLYLGXR
Los supuestos básicos del desarrollo organizacionalVRQ
/DFRQVWDQWH\UiSLGDPXWDFLyQGHODPELHQWH
/DQHFHVLGDGGHFRQWLQXDDGDSWDFLyQ
/D LQWHUDFFLyQ HQWUH OD organización y el
ambiente
/DLQWHUDFFLyQHQWUHHOLQGLYLGXR\ODorganización
(VWDVFXDWURYDULDEOHVEiVLFDVVRQDERUGDGDV /RV objetivos LQGLYLGXDOHV \ ORV objetivos
organizacionales
FRQ HVSHFLDO DWHQFLyQ VREUH VX LQWHUUHODFLyQ H
(OFDPELRRUJDQL]DFLRQDOGHEHVHUplaneado
interdependencia.
/DQHFHVLGDGGHSDUWLFLSDFLyQ\GHFRPSURmiso
Esta escuela se ocupó de aspectos tan diferenciados como:
(OLQFUHPHQWRGHODH¿FDFLD organizacional
D &RQFHSWRGHorganización
y del bienestar de la organización
E &RQFHSWRGHFXOWXUDRUJDQL]DFLRQDO
/D YDULHGDG GH PRGHORV \ estrategias del
F &RQFHSWRGHFDPELR
desarrollo organizacional
G &RQFHSWRGHGHVDUUROOR
(O desarrollo organizacional es una respuesta a los cambios.
H )DVHVGHODorganización
8Qobjetivo esencial de las organizaciones
I &UtWLFDVDODVestructuras FRQYHQFLRQDOHV
HVHOGHPHMRUDUODFDOLGDGGHYLGD
¿Qué es el desarrollo organizacional? En /DVorganizaciones son sistemas abiertos.
SULQFLSLRHVWRGRFDPELRSODQHDGR(OFRQFHSWR
Los autores más notables de esta corriente
de planeamiento organizacional tiene sus raíces
justamente en la idea de una organización y un VRQ (GJDUG 6FKHLQ 3DXO /DZUHQFH -D\ /RUVsistema social. El desarrollo de la organización FK/HODQG%UDGKROG5LFKDUG%HFNKDUG5REHUW
56 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
%ODNH-DQH0RXWRQ/DUU\*UHLQHU(ULF%HUQH
\:LOOLDP5HGGLQJ
7RGRV ORV DSRUWHV GH ORV DXWRUHV PHQFLRQDGRVGDGDVXFHUFDQtD\FRQWHPSRUDQHLGDGVRQ
de actual y permanente uso y aplicación en las
empresas modernas.
ESCUELA DEL ENFOQUE SISTÉMICO DE LA
ADMINISTRACIÓN
&RQHVWRVWUHVQXHYRVSULQFLSLRVODteoría general de los sistemas proporcionó el surgimiento
GHODFLEHUQpWLFDGHODLQYHVWLJDFLyQRSHUDFLRQDO
y terminó desembocando en la teoría general de
la administraciónGDQGRXQDQXHYDGLPHQVLyQ
a sus concepciones.
La cibernética es una ciencia UHODWLYDPHQWH
MRYHQ IXH FUHDGD SRU 1RUEHUW9LHQHU HQWUH ORV
DxRV\)XHMXVWDPHQWHHQODpSRFDHQ
TXH-RKDQQ9RQ1HXPDQQ\2VNDU0RUJHQVWHUQ
FUHDEDQ OD teoría de los juegos. SimulWiQHDPHQWH &ODXGH 6KDQQRQ \ :DUUHQ :HDYHU
FUHDEDQODteoría matemática de la información.
Los conceptos desarrollados por la cibernética son hoy ampliamente utilizados en la teoría
DGPLQLVWUDWLYD/DVQRFLRQHVGHsistemaUHWURDOLPHQWDFLyQ KRPHRVWDVLV FRPXQLFDFLyQ DXWRFRQWUROHWFVRQKR\SDUWHLQWHJUDQWHGHOOHQJXDje utilizado en la administración.
La cibernética es la ciencia de la comunicación y del control \D VHD HQ HO DQLPDO R HQ OD
PiTXLQD /D FRPXQLFDFLyQ HV OD TXH KDFH TXH
los sistemasVHDQLQWHJUDGRV\FRKHUHQWHV\HO
control HVHOTXHUHJXODVXFRPSRUWDPLHQWR
El campo de estudio de la cibernética son los
sistemasSRUORWDQWRVHHVWXGLDUiQORVHOHPHQWRVODVUHODFLRQHVHQWUHHOORV\ORVobjetivos.
(O ELyORJR DOHPiQ /XGYLJ 9RQ %HUWDODQII\
elaboró una teoríaLQWHUGLVFLSOLQDULDFDSD]GH
WUDVFHQGHU ORV SUREOHPDV H[FOXVLYRV GH FDGD
ciencia y de proporcionar principios y modelos
JHQHUDOHVSDUDWRGDVODVcienciasLQYROXFUDGDV
GH PRGR WDO TXH ORV GHVFXEULPLHQWRV HIHFWXDdos en cada ciencia pudieran ser utilizados por
todas las demás. Esta teoríaLQWHUGLVFLSOLQDULD
se denomina teoría general de los sistemas y
GHPXHVWUDHOLVRPRU¿VPRGHODVGLYHUVDVciencias SHUPLWH PD\RU DSUR[LPDFLyQ HQWUH VXV
IURQWHUDV\OOHQDORVHVSDFLRVYDFtRVHQWUHpVWDV
Dicha teoría es esencialmente totalizante: los
sistemas no pueden ser comprendidos plenaPHQWHVyORSRUHODQiOLVLVVHSDUDGR\H[FOXVLYR
de cada una de sus partes; se basa en la comprensión de la dependencia recíproca de todas
las disciplinas y de la necesidad de su integraFLyQ$VtODVGLYHUVDVUDPDVGHOFRQRFLPLHQWR
$WRGRHVWR¢TXpHVXQsistema"8Qsistema es:
empezaron a considerar sus objetos de estudio
‡8QFRQMXQWRGHHOHPHQWRV
como sistemas7DPELpQORKDKHFKRODadmi‡'LQiPLFDPHQWHUHODFLRQDGRV
nistración. Estos estudios han sido desarrolla‡)RUPDQGRXQDDFWLYLGDG
GRVHQWUH\
‡3DUDDOFDQ]DUXQobjetivo
&RPR \D KDEtDPRV YLVWR, la teoría general
‡2SHUDQGRVREUHGDWRVHQHUJtDPDWHULD
de la administraciónH[SHULPHQWyXQDJUDGXDO\ ‡3DUDSURYHHUinformaciónHQHUJtDPDWHULD
FUHFLHQWHDPSOLDFLyQGHOHQIRTXHGHVGHODySWLFD
clásicaSDVDQGRSRUODhumanísticaODneoclá3DUD6WDIIRUG%HHUORVsistemas cibernéticos
sica, la estructuralista y la del comportamiento presentan tres propiedades principales:
hasta el enfoque sistemático.
D 6RQH[FHVLYDPHQWHFRPSOHMRV
E 6RQSUREDELOtVWLFRV
(OHQIRTXHclásico IXHLQÀXLGRSRUWUHVSULQF 6RQDXWRUUHJXODGRV
cipios intelectuales dominantes:
Los sistemasVRQMHUiUTXLFRVRSLUDPLGDOHV
D (OUHGXFFLRQLVPR
HVGHFLUHVWiQFRQVWLWXLGRVSRUsistemas o subE (OSHQVDPLHQWRDQDOtWLFR
sistemas UHODFLRQDGRV HQWUH Vt SRU XQ proceso
F (OPHFDQLFLVPR
GHLQWHUDFFLyQ(OSURSLRXQLYHUVRHVXQsistema
FRQVWLWXLGRSRUXQDLQ¿QLGDGGHsistemas y subLa teoría general de los sistemas reemplaza sistemas íntimamente relacionados entre sí.
La cibernética da mucha importancia a los
a los principios mencionados:
D (QOXJDUGHUHGXFFLRQLVPRH[SDQVLRQLVPR modelos para la comprensión del funcionamienE (Q OXJDU GH SHQVDPLHQWR DQDOtWLFR SHQVD- to de los sistemas.
miento sintético.
8QPRGHORHVXQDUHSUHVHQWDFLyQVLPSOL¿FDF (QOXJDUGHOPHFDQLFLVPRWHOHRORJtD
da de alguna parte de la realidad.
2 - Historia de la administración general y sanitaria / 57
Los sistemasUHFLEHQHQWUDGDV inputs RLQVXPRVSDUDSRGHURSHUDUSURFHVDQGRRWUDQVIRUPDQGRHVDVHQWUDGDVHQVDOLGDV outputs /DVHQWUDGDV
pueden ser constituidas por uno o más de los siguientes ingredientes: informaciónHQHUJtD\PDWHULDOHV/DVVDOLGDVHQFDPELRVRQPX\GLYHUVDV
Ejemplos de las mismas pueden ser: información
OXFURSURGXFWRVVHUYLFLRVHLQFOXVREDVXUD
En la cibernética se suele usar el concepto
GH FDMD QHJUD black box (O FRQFHSWR GH FDMD
QHJUD VH UH¿HUH D XQ sistema cuyo interior no
SXHGHVHUGHVFXELHUWRFX\RVHOHPHQWRVLQWHUQRV
VRQ GHVFRQRFLGRV \ TXH VyOR SXHGH FRQRFHUVH
SRUIXHUD\DWUDYpVGHPDQLSXODFLRQHVH[WHUQDV
RGHREVHUYDFLyQH[WHUQD
Otro concepto fundamental en la teoría de
los sistemas es la retroalimentación. Se trata de
XQPHFDQLVPRPHGLDQWHHOFXDOXQDSDUWHGHOD
energía de salida de un sistema o de una máTXLQDUHWRUQDDODHQWUDGD/DUHWURDOLPHQWDFLyQ
VLUYHSDUDFRPSDUDUODPDQHUDFRPRXQsistema
funciona en relación con el patrón establecido
para su funcionamiento. Cuando ocurre alguna
GLIHUHQFLD GHVYtR HQWUHDPERVODUHWURDOLPHQWDFLyQVHHQFDUJDGHUHJXODUODHQWUDGDSDUDTXH
ODVDOLGDVHDSUR[LPHDOHVWiQGDUHVWDEOHFLGR
1
PERCEPCIÓN
DE LA SITUACIÓN
2
ANÁLISIS Y
DEFINICIÓN
DEL PROBLEMA
3
DEFINICIÓN DE
LOS OBJETIVOS
4
BÚSQUEDA DE
ALTERNATIVAS
DE SOLUCIÓN
5
EVALUACIÓN
Y COMPARACIÓN
DE ESAS
ALTERNATIVAS
6
ELECCIÓN
DE LA ALTERNATIVA
MÁS ADECUADA
/DUHWURDOLPHQWDFLyQVHFODVL¿FDHQ
D 5HWURDOLPHQWDFLyQSRVLWLYDTXHHVODDFFLyQ
HVWLPXODGRUDGHODVDOLGDTXHDFW~DVREUHOD
7
IMPLEMENTACIÓN
entrada del sistema.
DE LA ALTERNATIVA
ESCOGIDA
E 5HWURDOLPHQWDFLyQQHJDWLYDTXHHVODDFFLyQ
TXHIUHQDHLQKLEHODVDOLGD\TXHDFW~DVREUH
Cuadro 2.9: Etapas del proceso decisorio
la entrada del sistema.
La retroalimentación impone correcciones
en el sistema HQ HO VHQWLGR GH TXH DGHFXD VXV
HQWUDGDV\VDOLGDV\UHGXFHORVGHVYtRVRGLVFUHpancias.
Otro concepto muy importante de los sistemas HVODKRPHRVWDVLDTXHQDFHHQOD¿VLRORJtD
DQLPDO :DOWHU &DQQRQ DGRSWy HO WpUPLQR KRmeostasis para los sistemas biológicos. La hoPHRVWDVLDHVXQHTXLOLEULRGLQiPLFRREWHQLGRD
WUDYpV GH OD DXWRUUHJXODFLyQ HV GHFLU D WUDYpV
GHODXWRFRQWURO(VODFDSDFLGDGTXHWLHQHHOsistema SDUDPDQWHQHUFLHUWDVYDULDEOHVGHQWURGH
OtPLWHVDXQTXHORVHVWtPXORVGHOPHGLRH[WHUQR
IXHUFHQ D WDOHV YDULDEOHV D DVXPLU YDORUHV TXH
sobrepasan los límites de la normalidad.
/DKRPHRVWDVLVHVREWHQLGDDWUDYpVGHGLVSRVLWLYRVGHUHWURDOLPHQWDFLyQ feedback WDPELpQOODPDGRVVHUYRPHFDQLVPRV
Otro concepto fundamental de esta escuela
es el de la información. En el lenguaje diario la
idea de informaciónHVWiOLJDGDDODGHQRYHGDG
\XWLOLGDGSXHVinformación es el conocimiento
GLVSRQLEOH SDUD HO XVR LQPHGLDWR TXH SHUPLWH
orientar la acción al reducir el margen de incertidumbre.
(Q HVWD VRFLHGDG PRGHUQD WDQ FDPELDQWH H
LQFLHUWD OD LPSRUWDQFLD GH OD GLVSRQLELOLGDG GH
la informaciónDPSOLD\YDULDGDFUHFHSURSRUcionalmente con el aumento de la complejidad
de la propia sociedad.
Para comprender adecuadamente el concepto de
informaciónGHEHPRVWHQHUHQFXHQWDORVLJXLHQWH
'DWRHVXQUHJLVWURRDQRWDFLyQUHVSHFWRGH
un determinado hecho u ocurrencia.
58 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
Información: es un conjunto de datos con un
VLJQL¿FDGRHVGHFLUUHGXFHODLQFHUWLGXPEUH
respecto de algo o aumenta el conocimiento
respecto de algo.
&RPXQLFDFLyQFXDQGRXQDinformación se
WUDQVPLWHDDOJXLHQVLHQGRHQWRQFHVFRPSDUWLGD FRQ HVH DOJXLHQ 3DUD TXH KD\D FRPXQLFDFLyQHVQHFHVDULRTXHHOGHVWLQDWDULRGH
la información la reciba y la comprenda. La
información simplemente transmitida pero
no recibida no fue comunicada.
La teoría de la información es una rama de
ODPDWHPiWLFDDSOLFDGDTXHXWLOL]DHOFiOFXORGH
probabilidades. La actual teoría de la información VXUJH HQ GH¿QLWLYD FRQ ODV LQYHVWLJDFLRQHV
GH&ODXGH6KDQQRQ\:DUUHQ:HDYHUSDUDOD%HOO
7HOHSKRQH&RPSDQ\UHDOL]DGDVKDFLD
2WUR FRQFHSWR GH UHOHYDQFLD HV HO GH OD LQIRUPiWLFD FRQVLGHUDGD FRPR OD GLVFLSOLQD TXH
estudia el tratamiento racional y sistemático de
la información por medios automáticos.
$VRFLDGR D OD LQIRUPiWLFD VXUJH RWUR FRQFHSWR HO GH DXWRPDWL]DFLyQ TXH HV XQD VtQWHVLV GH XOWUDPHFDQL]DFLyQ VXSHUUDFLRQDOL]DFLyQ
procesamiento continuo y control automático.
Con la automatización surgieron las fábricas autodirigidas.
SULPDULDVRSULQFLSDOHVTXHPDQWLHQHQHVWUHFKD
relación entre sí. Son las siguientes:
D ,QJHVWLyQODVempresas hacen o compran materiales para procesarlos de alguna manera.
E 3URFHVDPLHQWRHQODempresaPHGLDQWHOD
SURGXFFLyQ ORV PDWHULDOHV VRQ SURFHVDGRV
habiendo cierta relación entre las entradas
\ODVVDOLGDV/DYHQWDHVHOHVWDGR¿QDOGHO
procesamiento.
F 5HDFFLyQ DO DPELHQWH WRGD empresa reacciona a su ambiente generando el cambio y
la adaptación.
G 3URYLVLyQGHODVSDUWHVORVSDUWLFLSDQWHVGH
la empresa son totalmente reemplazables.
H 5HJHQHUDFLyQ GH ODV SDUWHV ORV PLHPEURV
de la empresa SXHGHQ HQIHUPDUVH MXELODUVHGHVOLJDUVHRPRULU/DVPiTXLQDVSXHGHQ
YROYHUVHREVROHWDV
I Organización: la organización de las cinco
IXQFLRQHV GHVFULWDV UHTXLHUH XQ sistema de
comunicación para el control y la toma de
decisiones.
8QDRUJDQL]DFLyQHPSUHVDULDOHVXQsistema
DELHUWRSXHVXQDempresa es un sistema creado
SRUHOKRPEUHTXHPDQWLHQHXQDGLQiPLFDLQWHUDFFLyQFRQVXPHGLRDPELHQWH\DVHDFRQORV
FOLHQWHVORVSURYHHGRUHVORVFRPSHWLGRUHVODV
La teoría general de sistemas se fundamenta HQWLGDGHVVLQGLFDOHVORVyUJDQRVJXEHUQDPHQWDOHV\PXFKRVRWURVDJHQWHVH[WHUQRVLQÀX\H
HQWUHVSUHPLVDVEiVLFDVDVDEHU
VREUHHOPHGLRDPELHQWH\UHFLEHLQÀXHQFLDVGH
D /RVsistemasH[LVWHQGHQWURGHsistemas.
pVWH$GHPiVGHWRGRHVWRHVXQsistema inteE /RVsistemas son abiertos.
F /DVIXQFLRQHVGHXQsistema dependen de su JUDGRSRUGLYHUVDVSDUWHVUHODFLRQDGDVHQWUHVt
TXHWUDEDMDQHQDUPRQtDXQDVFRQODVRWUDVFRQ
estructura.
OD¿QDOLGDGGHDOFDQ]DUXQDVHULHGHobjetivos,
El concepto de sistema pasó a dominar las tanto de la organización como de sus particiciencias\SULQFLSDOPHQWHODadministración. Si pantes.
2WURVDXWRUHVGHHVWHPRYLPLHQWRTXHQRSRse habla de astronomía se piensa en el sistema
VRODU6LHOWHPDHV¿VLRORJtDVHSLHQVDHQHOsis- GHPRVLJQRUDUVRQ)UHPRQW.DVW\-DPHV5RtemaQHUYLRVRHQHOsistemaFLUFXODWRULRHWF/D VHQ]ZHLJ
De todas las teorías y escuelas presentasociología habla de un sistema social. La econoGDV KDVWD DKRUD OD teoría de los sistemas es
PtDGHXQsistema monetario.
8QDYHUL¿FDFLyQPX\LPSRUWDQWHGHHVWDHV- OD PHQRV FULWLFDGD WDO YH] SRUTXH D~Q QR KD
FXHOD HV TXH ODV teorías tradicionales de la or- WUDQVFXUULGRVX¿FLHQWHWLHPSRSDUDVXDQiOLVLV
ganizaciónKDQYLVWRDODorganización humana más profundo pues las obras más importantes
como a un sistema cerrado. Esa tendencia ha de esta teoríaVRQD~QUHFLHQWHV3RURWURODGR
OOHYDGRDQRFRQVLGHUDUORVGLIHUHQWHVDPELHQWHV WDPELpQGHEHPRVWHQHUHQFXHQWDTXHODSHUVorganizacionales y la naturaleza de la dependen- SHFWLYD sistémica parece estar de acuerdo con
FLDRUJDQL]DFLRQDOHQFXDQWRDODPELHQWH7DP- la preocupación estructural-funcionalista típipoco se había considerado la comprensión de los ca de las ciencias sociales de los países capitaprocesosGHUHWURDOLPHQWDFLyQTXHVRQHVHQFLD- listas de hoy.
OHV HQ OD VXSHUYLYHQFLD 7DO FRPR ORV RUJDQLV6tQWHVLVGHVXVLGHDV\WUDEDMRVPiVVLJQL¿PRV YLYRV ODV empresas tienen seis funciones FDWLYRV
2 - Historia de la administración general y sanitaria / 59
‡ 'HVDUUROODURQ PRGHORV PHWRGROyJLFRV WDOHV ‡([LVWHQFLHUWRVH[FHVRVHQODDSOLFDFLyQLQGLVcriminada de la técnica de los sistemasTXH
FRPRHODQDOyJLFRHOGHUDQJR\HOSURFHVDO
HQQDGDIDYRUHFHDOQLYHOPHWRGROyJLFRGHOD
DGDSWDWLYR
Administración.
‡ 'HVDUUROODURQ XQ HVIXHU]R VHPiQWLFR FRQ HO
propósito de dotar a todas las ciencias de un
Teorías\RtécnicasTXHVHDSOLFDQ\TXHLQOHQJXDMHFRP~QTXHSHUPLWDODXQLYHUVDOL]Dtegran la actual ciencia de la administración:
FLyQGHOPpWRGRFLHQWt¿FR
‡6XVPRGHORVDQDOyJLFRGHOUDQJR\SURFHVDO
‡6XGHVDUUROORVHPiQWLFR
Limitaciones de sus ideas y trabajos:
‡6XFRQFHSFLyQGHLQWHUUHODFLyQGHFRQMXQWRV
‡7RGDV ODV teorías y modelos se hallan en la
de funcionalidad y modularidad.
HWDSDGHSUXHED\H[SHULPHQWDFLyQ
3
PRINCIPOS DE ADMINISTRACIÓN GENERAL
Nélida Cosattini
CPN y Lic. en Administración (UBA). Docente universitaria
¿QUÉ ES LA ADMINISTRACIÓN?
En el capítulo anterior se planteó el aporte de las
LGHDV TXH GHVDUUROODURQ ORV GLIHUHQWHV DXWRUHV
DFHUFDGHOSHQVDPLHQWRDGPLQLVWUDWLYR(VWDVLGHDV
VRQJHQHUDGDVDOLQWHUSUHWDUODHYROXFLyQGHODDGPLQLVWUDFLyQ\SDUWHQGHOHQIRTXHFOiVLFRKDVWDHO
HQIRTXHVLVWpPLFR(QHOSUHVHQWHFDStWXORVHDERUGDUiXQDVHFXHQFLDGHWHPDVTXHSHUPLWDUHFRQRcer cuáles son las principales funciones adminisWUDWLYDVFRQFHELGDVGHQWURGHXQSURFHVRGLQiPLFR
\UHDOL]DGRDWUDYpVGHOVRFLRPiVLPSRUWDQWHGH
XQDRUJDQL]DFLyQTXHVRQODVSHUVRQDV
Muchos autores realizaron importantes conWULEXFLRQHVQRREVWDQWHFDGDXQDGHHOODVWLHQH
VXVSURSLDVOLPLWDFLRQHVFRPR\DVHKDYLVWRHQ
el capítulo anterior.
(VSURIXVDODELEOLRJUDItDTXH\DVHKDHVFULWR
DOUHVSHFWRQRREVWDQWHORVDGPLQLVWUDGRUHVVH
encuentran ante la responsabilidad de desarroOODUD~QPiV\HQIRUPDSHUPDQHQWHODVIXQFLRnes correspondientes a diferentes procesos de la
FLHQFLD\HODUWHTXHGHQRPLQDPRVDGPLQLVWUDción.
¢4XpHVODDGPLQLVWUDFLyQ"([LVWHQQXPHURVDVGH¿QLFLRQHVTXHSHUPLWHQGHVFLIUDUHQTXp
FRQVLVWHHVWDDFWLYLGDGKXPDQD
6H SXHGH GHFLU TXH OD DGPLQLVWUDFLyQ HV OD
gestión coordinada de los recursos onerosos y
HVFDVRVGHVDUUROODGDFRQH¿FDFLD\H¿FLHQFLD\
TXHSHUPLWHODREWHQFLyQGHORVREMHWLYRVSUHGHterminados.
+D\TXHGHWHQHUVHDFRQVLGHUDUDOJXQDVSDODEUDVFODYHVGHODGH¿QLFLyQDQWHGLFKD3RUHMHPSORHVIXQGDPHQWDOHOFRQFHSWRGHODFRRUGLQDFLyQ 6LJQL¿FD TXH SDUD SRGHU DGPLQLVWUDU VH
QHFHVLWDTXHWRGRVORVHOHPHQWRVFRPSUHQGLGRV
en dicha función trabajen en forma totalmente
VLQFURQL]DGD\HTXLOLEUDGD6HWUDWDGHXQDVLQtonía total. Es un formato muy semejante al de
ODRUTXHVWD¿ODUPyQLFDFRQVWLWXLGDSRUPXFKRV
SDUWLFLSDQWHV TXH DFW~DQ GH PDQHUD WRWDOPHQWH
LQWHJUDGD\TXHRIUHFHQVXSDUWLFLSDFLyQHQXQD
cantidad adecuada y en el momento oportuno.
(QWRQFHV OD UHIHUHQFLD QR HV RWUD FRVD TXH HO
WUDEDMRHQHTXLSR
2WUR SXQWR IXQGDPHQWDO GH HVWD GH¿QLFLyQ
HVTXHVHWUDEDMDFRQUHFXUVRV&XDQGRVHKDEOD
GHUHFXUVRVVHHVWiUH¿ULHQGRDHGL¿FLRVWHUUHQRVPiTXLQDVURGDGRVLQVWDODFLRQHVHTXLSRV\
WDPELpQDODVSHUVRQDVDXQTXHHVWHrecurso ha
FREUDGRHQHOSUHVHQWHODUHOHYDQFLDTXHVLHPSUH
GHELyWHQHUSHURTXHDKRUDODUHDOLGDGLPSRQH
DVt VXUJHQ ORV FRQFHSWRV GH FDSLWDO LQWHOHFWXDO
FDSLWDOVRFLDOUHVSRQVDELOLGDGVRFLDOHWF7DOHV
recursosVRQREYLDPHQWHHVFDVRVVREUHWRGRHQ
FXDQWRDFDOLGDGVHUH¿HUH$GHPiVVRQRQHURVRVHVGHFLUJHQHUDQFRVWRV
3RURWUDSDUWHHVLQHYLWDEOHDERUGDUORVFRQFHSWRV GH H¿FDFLD \ H¿FLHQFLD ([SUHVDGR HQ
XQDIRUPDVLPSOHH¿FDFLDVLJQL¿FDHOORJURGH
ORV REMHWLYRV OD REWHQFLyQ GH XQD PHWD ¿Q R
SURSyVLWRTXHVHKDEtD¿MDGRSUHYLDPHQWH&RQ
UHVSHFWRDODH¿FLHQFLDVHWUDWDGHTXHHOORJUR
GH ORV REMHWLYRV VH UHDOLFH XWLOL]DQGR OD PHQRU
FDQWLGDGGHUHFXUVRVSRVLEOHHQWUHORVTXHHVWi
HOWLHPSRFRPRUHFXUVRIXQGDPHQWDO\PDQWHniendo siempre la calidad estipulada.
4XHGDUtD OD ~OWLPD SDUWH GH OD GH¿QLFLyQ
+D\TXHORJUDUREMHWLYRV1DGLHSXHGHHQFDUDU
XQDWDUHDXQSUR\HFWRXQDDFWLYLGDGVLQRWLHQH
SUHYLDPHQWHHVWDEOHFLGRVXQRRYDULRV¿QHVDORJUDU3RUVXSXHVWRTXHHVWRV¿QHVVHHVWDEOHFHQ
antes de decidir una acción.
62 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
6H SXHGH GHFLU TXH pVWD HV XQD DGHFXDGD
LGHD FRQ UHVSHFWR D OR TXH VLJQL¿FD OD DGPLQLVWUDFLyQTXHHVGH¿QLWLYDPHQWHXQDFLHQFLD
SRUTXHHVXQFRQRFLPLHQWRVLVWHPDWL]DGRHODERUDGR PHGLDQWH REVHUYDFLRQHV UD]RQDPLHQtos y pruebas organizadas a partir de un método. La ciencia utiliza de diferentes métodos y
WpFQLFDVSDUDODDGTXLVLFLyQ\RUJDQL]DFLyQGH
FRQRFLPLHQWRV VREUH OD HVWUXFWXUD GH XQ FRQMXQWRGHKHFKRVREMHWLYRV\DFFHVLEOHVDYDULRV
REVHUYDGRUHV/DDSOLFDFLyQGHHVRVPpWRGRV\
conocimientos conduce a la generación de más
FRQRFLPLHQWRREMHWLYRHQIRUPDGHSUHGLFFLRQHVFRQFUHWDVFXDQWLWDWLYDV\FRPSUREDEOHVUHIHULGDV D KHFKRV REVHUYDEOHV SDVDGRV SUHVHQtes y futuros. Con frecuencia esas predicciones
pueden formularse mediante razonamientos y
HVWUXFWXUDUVH FRPR UHJODV R OH\HV XQLYHUVDOHV
TXHGDQFXHQWDGHOFRPSRUWDPLHQWRGHXQVLVtema y predicen cómo actuará dicho sistema en
determinadas circunstancias.
La administración está compuesta de técniFDV 'LFKDV WpFQLFDV VRQ ODV KHUUDPLHQWDV TXH
HVWiQDGLVSRVLFLyQGHODGPLQLVWUDGRUHQLPSRUWDQWHFDQWLGDG\TXHOHD\XGDQDGHVHPSHxDUVXV
DFWLYLGDGHV
3RURWURODGRKDVXUJLGRXQDODUJDGLVFXVLyQ
sobre el tema de si la administración es un arte
R QR 'HVGH XQ SXQWR GH YLVWD IRUPDO \ DEVROXWDPHQWH FRQFHSWXDO WRPDQGR HQ FXHQWD ORV
HOHPHQWRVDQWHULRUPHQWHH[SXHVWRVODDGPLQLVWUDFLyQQRVHUtDXQDUWH1RREVWDQWHODQHFHVLGDGGHODPH]FODGHKDELOLGDGHVTXHVHUHTXLHUHQ
para ejercer una buena administración no desFDUWDODSRVLELOLGDGGHTXHVHDXQDUWH\TXHGHVGHODFUHDWLYLGDGLQGLYLGXDOGHORVDGPLQLVWUDGRUHV\GHODVSHUVRQDVHQJHQHUDOTXHIRUPDQOD
RUJDQL]DFLyQVHRULJLQHQQXHYDVSURSXHVWDVTXH
luego se podrían estructurar en la aplicación de
QXHYDVWpFQLFDVTXHSRGUtDQDPSOLDURPRGL¿FDU
HOUHSHUWRULRH[LVWHQWH
LAS ORGANIZACIONES
$KRUDSURSRQHPRVRWUDSUHJXQWDPX\UHOHYDQte: ¿dónde se implementa la administración? La
administración se implementa en las organizaciones.
8QDRUJDQL]DFLyQHVXQFRQMXQWRGHSHUVRQDV
TXH PDQHMDQ UHFXUVRV TXH SRVHHQ YDORUHV HQ
FRP~Q\TXHWLHQHQREMHWLYRVSUHGHWHUPLQDGRV
compartidos.
6HSXHGHREVHUYDUTXHQRKD\RUJDQL]DFLyQ
SRVLEOHVLQSHUVRQDVSRUORTXHODRUJDQL]DFLyQ
es un elemento netamente social. Por otra parWH XQD RUJDQL]DFLyQ QR SXHGH SUHVFLQGLU GH OD
WHFQRORJtDTXHQHFHVLWDSDUDVXGHVDUUROOR8QD
RUJDQL]DFLyQGHEHUiVHUGLQiPLFD\WHQGUiTXH
VHU REVHUYDGD EDMR HO FRQFHSWR GH XQ VLVWHPD
DELHUWR(VWRVLJQL¿FDTXHWRGDVODVRUJDQL]DFLRQHVLQWHUDFW~DQFRQVXVFRQWH[WRVTXHGHELHUDQ
siempre estar referenciados a un marco ético.
8QDRUJDQL]DFLyQSXHGHWHQHUGLVWLQWRV¿QHV
5HVXOWDDVtTXHSXHGHKDEHURUJDQL]DFLRQHVUHOLJLRVDVRUJDQL]DFLRQHVHGXFDWLYDVRUJDQL]DFLRQHV VDQLWDULDV XQ KRVSLWDO SRU HMHPSOR SXHGH
WHQHUHOSURSyVLWRIXQGDPHQWDOGHRIUHFHUVHUYLFLRVPpGLFRVGHDOWDFDOLGDGDODFRPXQLGDGHV
GHFLUTXHVXVREMHWLYRVVHRULHQWDQKDFLDODSURYLVLyQGHHVDDVLVWHQFLD RUJDQL]DFLRQHVGHSRUWLYDVRUJDQL]DFLRQHVFRQRVLQ¿QHVGHOXFURHO
(VWDGRHWF7RGDVHVWDVRUJDQL]DFLRQHVGHVHPSHxDUiQGLVWLQWDVDFWLYLGDGHV\WHQGUiQGLIHUHQtes tamaños y distintas formas de propiedad. Se
REVHUYDTXHH[LVWHQQXPHURVDVRUJDQL]DFLRQHV\
TXHVRODPHQWHDOJXQDVGHHOODVSRVHHQ¿QHVGH
OXFUR&RQUHVSHFWRDHVWHREMHWLYRODJDQDQFLD
\DQRHVXQ~QLFRREMHWLYR+R\VHFRQFHSWXDOL]D
como un subproducto de un trabajo bien logrado
SDUDHOXVXDULRHOWUDEDMDGRU\ORVDFFLRQLVWDV VL
ORVKXELHUH WRGRGHQWURGHXQPDUFRGHUHVSRQVDELOLGDGVRFLDO\pWLFDpVWDHVXQDQXHYDIRUPD
GHSHQVDPLHQWRXQDQXHYD ¿ORVRItD(VWDVRUJDnizaciones se denominan empresas.2EVHUYDQGR
\D HVSHFt¿FDPHQWH DO PXQGR GH ODV HPSUHVDV
VH QRWDUi TXH H[LVWHQ HPSUHVDV TXH SURGXFHQ
SURGXFWRV WDQJLEOHV R LQWDQJLEOHV VHUYLFLRV \ WDPELpQ HPSUHVDV TXH SXHGHQ VHU PLFURHPSUHQGLPLHQWRV SHTXHxDV HPSUHVDV PHGLDQDV
y grandes. En cuanto a la propiedad podrán ser
SULYDGDVPL[WDV\HVWDWDOHV
Las funciones básicas del proceso admiQLVWUDWLYR PHGLDQWH HO FXDO OD DGPLQLVWUDFLyQ
VH GHVHPSHxD HQ VXV WDUHDV FRWLGLDQDV VRQ HO
SODQHDPLHQWRODRUJDQL]DFLyQODGLUHFFLyQ\HO
control.
1. El planeamiento
La primera función de la administración es el
planeamiento3DUDTXHHOHVIXHU]RGHXQJUXSRVHDH¿FD]VXVFRPSRQHQWHVGHEHQVDEHUTXp
se espera de ellos. De esto se ocupa la función
de planeamiento. El planeamiento abarca el desarrollo sistemático de las acciones necesarias
SDUDODVHOHFFLyQGHREMHWLYRV\ODVIRUPDVSDUD
3 - Principios de administración general / 63
alcanzarlos. Se necesitará tomar decisiones
SURFHVR SUHYLR HV GHFLU HOHJLU HQWUH FXUVRV
GH DFFLyQ SRVLEOHV GH ORV IXWXURV DOWHUQDWLYRV
TXH VH HVWiQ DQDOL]DQGR WHQLHQGR HQ FXHQWD
HO ULHVJR DVRFLDGR GH FDGD DOWHUQDWLYD HO FXDO
puede orientar la decisión hacia una alternatiYDDSDUHQWHPHQWHPHQRVFRQYHQLHQWHSHURTXH
WLHQHXQULHVJRDVRFLDGRTXHHOHPSUHVDULRHVWi
dispuesto a afrontar.
(QFDGDXQRGHORVREMHWLYRVHOHJLGRVVXE\DFHQ SUHPLVDV TXH MXVWL¿FDQ FDGD RSFLyQ 7DOHV
SUHPLVDV GHEHQ HVWDU ELHQ FODUL¿FDGDV )LQDOPHQWH FRPR D¿UPDQ .RRQW] \ 2¶'RQQHOO HO
propósito de la planeación es facilitar el logro
de los proyectos y de las metas de la empresa.
El planeamiento y el control son inseparaEOHVVRQGRVIDVHVGHXQPLVPRSURFHVRSXHV
ORVSODQHVSURSRUFLRQDQORVHVWiQGDUHVUHTXHULdos para el control. Los administradores deben
EXVFDUXQHTXLOLEULRHQWUHHOWLHPSRGHVWLQDGRDO
planeamiento y el tiempo utilizado para organizar y controlar.
Tipos de planes
8Q SODQ SXHGH DEDUFDU FXDOTXLHU FXUVR GH
DFFLyQIXWXURORTXHGHPXHVWUDFRQFODULGDG
TXH ORV SODQHV VRQ YDULDGRV 6H SXHGHQ FODsificar en:
1) Propósitos o misiones:LGHQWL¿FDQODIXQFLyQ
RWDUHDEiVLFDGHXQDHPSUHVDRGHFXDOTXLHU
SDUWH GH HOOD &XDOTXLHU FODVH GH RSHUDFLyQ
RUJDQL]DGD SDUD WHQHU DOJ~Q VLJQL¿FDGR
debe poseer propósitos o misiones. En cada
VLVWHPDVRFLDOODVHPSUHVDVWLHQHQXQDIXQFLyQRWDUHDEiVLFDGH¿QLGD
2) Objetivos: ORVREMHWLYRVRPHWDVVRQORV¿QHVKDFLDORVTXHVHGLULJHODDFWLYLGDGVRQ
ORVUHVXOWDGRVDORJUDU$XQTXHORVREMHWLYRV
GHODHPSUHVDVRQVXSODQEiVLFRXQGHSDUWDPHQWRFXDOTXLHUDSXHGHWHQHUWDPELpQVXV
SURSLRVREMHWLYRV3RUVXSXHVWRTXHVXVPHWDVFRQWULEXLUiQDOORJURGHORVREMHWLYRVGH
la empresa.
3) Estrategias: GXUDQWH PXFKR WLHPSR HQ HO
campo militar se utilizó la palabra estrategias
SDUD UHIHULUVH D SODQHV GLVHxDGRV WRPDQGR
HQFXHQWDORTXHSXGLHUDKDFHUHODGYHUVDULR
/DV HVWUDWHJLDV DSDUHFHQ VLHPSUH TXH KD\D
DOJXQDDFWLYLGDGFRPSHWLWLYD/DVHVWUDWHJLDV
no son solamente aplicables al ámbito de una
HPSUHVDVLQRWDPELpQDODVXQLGDGHVGHQHJRFLRTXHpVWDSRVHH\DODVGHRWURVQHJRFLRVDVtFRPRWDPELpQDORVclustersTXHVRQ
FRQFHQWUDFLRQHV JHRJUi¿FDV GH HPSUHVDV H
LQVWLWXFLRQHVLQWHUFRQHFWDGDVTXHDFW~DQHQ
un determinado campo.
4) Políticas:VRQWDPELpQSODQHVHQHOVHQWLGR
GHTXHVRQGHFODUDFLRQHVRLQWHUSUHWDFLRQHV
JHQHUDOHVTXHJXtDQHOSHQVDPLHQWR\ODVDFFLRQHV/DVSROtWLFDVGH¿QHQXQiUHDGHQWUR
GHODTXHVHYDDWRPDUXQDGHFLVLyQ\DVHJXUDQTXHpVWDVHDFRQVLVWHQWHFRQXQREMHWLYR\
FRQWULEX\DDOORJURGHOPLVPR([LVWHQSROtWLFDVHQWRGRVORVQLYHOHVGHODVRUJDQL]DFLRQHV TXH YDUtDQ GHVGH SROtWLFDV LPSRUWDQWHV
GHODFRPSDxtDDSROtWLFDVUHOHYDQWHVGHORV
GHSDUWDPHQWRV\SROtWLFDVVHFXQGDULDVDSOLFDEOHVDORVVHJPHQWRVPiVSHTXHxRVGHOD
organización.
+D\ PXFKRV WLSRV GH SROtWLFDV 3XHVWR TXH
las políticas son guías para la toma de deciVLRQHV VH GHVSUHQGH TXH GHEHQ WHQHU FLHUWD
ÀH[LELOLGDGSXHVGHORFRQWUDULRVHUtDQQRUmas o reglas.
/DWDUHDPiVGLItFLOHVORJUDUTXHODVSROtWLFDV
VHDQVX¿FLHQWHPHQWHFRQVLVWHQWHVHLQWHJUDGDVSDUDFXPSOLUFRQORVREMHWLYRVGHODHPpresa.
5) Procedimientos: son guías para la acción
PiV TXH SDUD HO SHQVDPLHQWR \ GHWDOODQ OD
IRUPDH[DFWDHQTXHVHGHEHQOOHYDUDFDER
FLHUWDVDFWLYLGDGHV'LFKDVDFWLYLGDGHVVHGHVDUUROODQ FRQ IUHFXHQFLD HQ IRUPD WUDQVYHUVDOLPSOLFDQGRODSDUWLFLSDFLyQGHGLIHUHQWHV
departamentos de la organización.
6) Reglas o Normas: H[SOLFDQ FODUDPHQWH ODV
DFFLRQHV UHTXHULGDV R ODV DFFLRQHV TXH QR
VH GHEHQ OOHYDU D FDER &RQ IUHFXHQFLD VH
confunden las reglas con las políticas o los
SURFHGLPLHQWRV/DVUHJODVQRSHUPLWHQÀH[LELOLGDGHQVXDSOLFDFLyQ
7) Programas:VRQXQFRQMXQWRGHPHWDVSROtWLFDVSURFHGLPLHQWRVUHJODVDVLJQDFLRQHV
GHWDUHDVSDVRVDVHJXLUUHFXUVRVDHPSOHDU
\ RWURV HOHPHQWRV QHFHVDULRV SDUD OOHYDU D
cabo un determinado curso de acción. Por lo
JHQHUDOHVWiQUHVSDOGDGRVSRUSUHVXSXHVWRV
(OSURJUDPDRULJLQDOSXHGHUHTXHULUPXFKRV
subprogramas de respaldo.
8) Presupuestos: son una importante herraPLHQWD GH JHVWLyQ TXH QRV PXHVWUD ORV UHVXOWDGRV HVSHUDGRV H[SUHVDGRV HQ WpUPLQRV
QXPpULFRV FXDQWLWDWLYRV HQ IXQFLyQ GH OD
SUR\HFFLyQ GH ORV HVWXGLRV SUHYLRV UHDOL]DGRV/RVSUHVXSXHVWRVVHSXHGHQH[SUHVDUHQ
WpUPLQRV HFRQyPLFRV ¿QDQFLHURV GH KRUDV
64 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
GHWUDEDMRXQLGDGHVGHSURGXFWRKRUDVPi- Etapas de la planeación
TXLQD R FXDOTXLHU RWUR WpUPLQR PHGLEOH QX- /DSODQHDFLyQEiVLFDPHQWHUHTXLHUH
9LVXDOL]DUODVRSRUWXQLGDGHV
méricamente. Ejemplos de distintos presu (VWDEOHFHU FODUDPHQWH ORV REMHWLYRV SDUD
puestos son el presupuesto de gastos; el pretoda la empresa y para cada unidad de trabasupuesto de gastos de capital; el presupuesto
jo subordinado
GHHIHFWLYRHWF
(VWDEOHFHUGLIXQGLU\REWHQHUFRQVHQVRSDUD
Los presupuestos son esencialmente disposila utilización de premisas
WLYRVGHFRQWURO\FRQVWLWX\HQXQDLPSRUWDQWH
%XVFDU \ H[DPLQDU FXUVRV DOWHUQDWLYRV GH
IXHQWHSDUDXQVLVWHPDGHJHVWLyQ8QSUHVXacción
SXHVWRVHSRQHHQHMHFXFLyQ\DPHGLGDTXH
VHYDUHDOL]DQGRGHEHFRPSDUDUVHFRQORTXH (YDOXDU ORV FXUVRV DOWHUQDWLYRV GH DFFLyQ
determinando sus fortalezas y debilidades
UHDOPHQWHVHHVWiORJUDQGRSDUDDQDOL]DUORV
GHVYtRVFRQUHVSHFWRDOSUHVXSXHVWRRULJLQDO 6HOHFFLRQDU XQ FXUVR GH DFFLyQ eVWH HV HO
momento real de la toma de decisiones.
\ HYDOXDU ODV FRQVHFXHQFLDV SDUD OD HPSUH )RUPXODFLyQGHSODQHVGHULYDGRVSDUDUHVsa. Los presupuestos también suelen acompaldar el plan básico
SDxDUDORVSURJUDPDV7RGRVORVSURJUDPDV
UHTXLHUHQHOXVRGHUHFXUVRVTXHGHEHQVHU (OSDVR¿QDOSDUDGDUVLJQL¿FDGRDORVGLVWLQWRV
SODQHVHVVXVWHQWDUORVDWUDYpVGHSUHVXSXHVWRV
H[SUHVDGRVHQHOSUHVXSXHVWR
SER CONSCIENTES
DE LA OPORTUNIDAD
De acuerdo con:
- El mercado
- Competencia
- Lo que desean los clientes
- Nuestras fuerzas
- Nuestras debilidades
ESTABLECIMIENTO DE
OBJETIVOS O METAS
Dónde se quiere estar,
qué se quiere lograr y cuándo
CONSIDERACIÓN DE LAS
PREMISAS DE PLANEACIÓN
¿En qué ambiente –interno o
externo– operarán nuestros
planes?
IDENTIFICACIÓN DE
ALTERNATIVAS
¿Cuáles son las alternativas
más prometedoras para cumplir
nuestros objetivos?
Cuadro 3.1: Pasos de la planeación
COMPARACIÓN DE
ALTERNATIVAS A LA LUZ DE
LAS METAS DESEADAS
¿Cuál alternativa proporcionará
la mejor posibilidad de cumplir
las metas al costo más bajo y
con la utilidad más alta?
SELECCIÓN DE
UNA ALTERNATIVA
Seleccionar el curso de acción
que se seguirá
ELABORACIÓN DE
PLANES DE APOYO
Como los planes para:
- Comprar equipo
- Comprar materiales
- Contratar y capacitar
- Desarrollar un nuevo producto
EXPRESIÓN NUMÉRICA
DE LOS PLANES MEDIANTE
LA PREPARACIÓN
DE PRESUPUESTOS
Desarrollar presupuestos como:
- Volumen y precio de ventas
- Gastos de operación necesarios
para los planes
- Gastos de capital para equipo
3 - Principios de administración general / 65
Horizonte de planeamiento
/RVSODQHVSXHGHQVHUGHFRUWRPHGLDQRRODUJR
SOD]RVHJ~QHOKRUL]RQWHGHWLHPSRFRQTXHVH
conciban. El gran desafío consiste en lograr la
coordinación e integración de todos esos planes.
7DPELpQSXHGHQUHDOL]DUVHSODQHVGH~QLFDYH]
SDUDSUR\HFWRVHVSHFt¿FRV
Establecimiento de premisas
8QR GH ORV DVSHFWRV HVHQFLDOHV \ TXH FRQ IUHcuencia se pasa por alto en el planeamiento efecWLYR \ FRRUGLQDGR HV HVWDEOHFHU ODV SUHPLVDV
TXHFRQVLVWHHQGHWHUPLQDUFRQHODFXHUGRGHORV
JHUHQWHV\SODQL¿FDGRUHVODXWLOL]DFLyQGHVXSRsiciones críticas consistentes e indispensables
SDUDORVSODQHVTXHVHDQDOL]DQ/DVSUHPLVDVGH
SODQHDFLyQVHGH¿QHQFRPRHODPELHQWHSUHYLVWRHQHOTXHVHHVSHUDTXHRSHUHQORVSODQHV
2. La organización
La segunda función de la administración es la
RUJDQL]DFLyQ TXH WLHQH FRPSRQHQWHV PX\ GLYHUVRV\HVSHFLDOHV2UJDQL]DUHQWUHRWUDVFRVDV
abarca:
D /DDVLJQDFLyQGHORVGLYHUVRVUHFXUVRVH[LVtentes
E 'LYLVLyQGHOWUDEDMR\FUHDFLyQGHODHVWUXFtura organizacional
F &RRUGLQDFLyQ\GLVHxRRUJDQL]DFLRQDO
G (VWDEOHFHU GH GyQGH SURYLHQH OD DXWRULGDG
y los principios de delegación y descentralización
H )LMDUODGRWDFLyQGHSHUVRQDO\JHQHUDUXQD
gestión de los recursos humanos
I (VWDEOHFHUODVUHJODVSDUDODDGPLQLVWUDFLyQ
del cambio y el desarrollo organizacional
J $GPLQLVWUDFLyQGHOFRQÀLFWRRUJDQL]DFLRQDO
\GHODFUHDWLYLGDG
La palabra organización en su segunda
DFHSFLyQLPSOLFDHOSURFHVRGHRUJDQL]DUTXH
HVODIRUPDHQTXHHOWUDEDMRVHFRPSRQHGLVtribuye y asigna entre los miembros de la orgaQL]DFLyQGHPRGRTXHVHORJUHQFRQH¿FLHQFLD
sus metas.
especializará en un determinado aspecto de su
tarea general.
Ventajas de la especialización en el trabajo
/DHVSHFLDOL]DFLyQHQHOWUDEDMRKDGDGRFRPR
FRQVHFXHQFLD HO DXPHQWR GH OD SURGXFWLYLGDG
1
Como dice Adam Smith ³OD JUDQ YHQWDMD GH
ODGLYLVLyQGHOWUDEDMRFRQVLVWHHQTXHDOGLYLGLU
ODWDUHDWRWDOHQRSHUDFLRQHVSHTXHxDVVHQFLOODV
H LQGLYLGXDOHV HQ ODV TXH SXHGH HVSHFLDOL]DUVH
FDGD WUDEDMDGRU OD SURGXFWLYLGDG WRWDO VH PXOWLSOLFDUi JHRPpWULFDPHQWH´ (O DUJXPHQWR TXH
VRVWLHQH HO HQXQFLDGR DQWHULRU HV TXH QLQJXQD
persona es físicamente capaz de efectuar todas
las operaciones de las tareas más complejas. Es
DVt TXH ODV WDUHDV FRUUHVSRQGLHQWHV D HVD RSHUDFLyQ FRPSOHMD GHEHUiQ GLYLGLUVH \ UHSDUWLUVH
entre distintas personas.
'H¿QLPRVOD3URGXFWLYLGDGFRPRODUHODFLyQ
SURGXFWRVLQVXPRVHQXQSHUtRGRHVSHFt¿FRFRQ
la calidad estipulada. Como se trata de un coFLHQWH OD PHMRUD GH OD SURGXFWLYLGDG VH ORJUD
incrementando los productos con los mismos inVXPRVUHGXFLHQGRORVLQVXPRVSHURPDQWHQLHQdo los mismos productos o incrementando los
SURGXFWRVDODYH]TXHVHUHGXFHQORVLQVXPRV
Preocupaciones acerca de la especialización
([LVWHQHVFULWRUHVTXHKLFLHURQIXHUWHVREMHFLRQHVUHVSHFWRGHOLPSDFWRTXHODHVSHFLDOL]DFLyQ
WHQtD HQ HO WUDEDMDGRU .DUO 0DU[ \ )ULHGULFK
(QJHOVTXLHQHVHVFULELHURQVXVREUDVDPHGLDGRVGHOVLJOR;,;SHQVDEDQTXHD~QODGLYLVLyQ
más general del trabajo era fuente de alienación
\HVFODYLWXG(QODDFWXDOLGDGVHXWLOL]DFRQXQ
FULWHULRPX\ÀH[LEOHTXHSHUPLWHREWHQHUORVEHQH¿FLRV GH OD SURGXFWLYLGDG GHQWUR GH XQ iUHD
GHWHUPLQDGDFRQFHELGDFRQFULWHULRVTXHVXVWHQtan la participación de las personas con mayor
grado de libertad.
Diseño del trabajo y del puesto
3DUDSRGHUGLYLGLUODVWDUHDVHVSUHFLVRVHSDUDUODV\GH¿QLUODV/RSULPHURTXHKD\TXHKDFHUHV
establecer:
D /DSURIXQGLGDGGHOWUDEDMRHVGHFLUHOJUDLa división del trabajo
GR HQ TXH XQ LQGLYLGXR SXHGH FRQWURODU VX
Al ir aumentando la carga de trabajo de una emtrabajo.
SUHVDRGHSDUWDPHQWRVHFRQWUDWDUiQPiVSHUVRE (ODOFDQFH RiPELWR GHOWUDEDMRTXHVHHQQDV\HOWUDEDMRVHGLYLGLUiHQWUHHOORV'LYLGLUHO
tiende por el número de operaciones diferentrabajo consiste en asignar determinadas tareas
WHVTXHUHTXLHUHXQWUDEDMRHQSDUWLFXODU\OD
DGHWHUPLQDGDVSHUVRQDV&RQHVWRORTXHVHORIUHFXHQFLD FRQ TXH SXHGH UHSHWLUVH HO FLFOR
JUDHVODHVSHFLDOL]DFLyQ\DTXHFDGDSHUVRQDVH
del mismo.
66 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
Agrandamiento y enriquecimiento del trabajo
/RVWUDEDMRVPX\HVSHFLDOL]DGRVDQLYHORSHUDWLYRVRQFDXVDGHLQVDWLVIDFFLyQSDUDTXLHQ
GHEH UHDOL]DUORV SRU OR TXH VH KD SURFXUDGR
encontrar las maneras de hacer más satisfactorios los trabajos rutinarios. Estos intentos
caen en dos categorías en general: agrandaPLHQWR\HQULTXHFLPLHQWRGHOWUDEDMR(OSULPHUR SURYLHQH GHO SHQVDPLHQWR GH ORV LQJHQLHURV LQGXVWULDOHV (O VHJXQGR GH OD WHRUtD
PRWLYDFLRQDO
/Dampliación del alcance del trabajo disPLQX\HODLQVDWLVIDFFLyQDXPHQWDQGRHODOFDQFH GHO PLVPR 3RU HMHPSOR GRV R PiV
WUDEDMRV SXHGHQ LQWHJUDUVH HQ XQR VROR GLPHQVLyQKRUL]RQWDO (O enriquecimiento del trabajo aumenta la
SURIXQGLGDG GH pVWH GLPHQVLyQ YHUWLFDO HVGHFLUVHUHVSRQVDELOL]DGHORVUHVXOWDGRV
obtenidos en la etapa anterior de su propio
trabajo.
Organización y estructura organizacional
Es importante reiterar la relación entre la
estrategia y la estructura organizacional. AlIUHG &KDQGOHU XWLOL]D OD H[SUHVLyQ ³OD HVWUXFWXUD VLJXH D OD HVWUDWHJLD´ OR TXH TXLHUH GHFLUTXHODPLVLyQ\ODVPHWDVJOREDOHVGHXQD
organización ayudarán a conformar su diseño
estructural.
7DPELpQODHVWUXFWXUDWLHQHRWUDVUHODFLRQHV
FRPRSRUHMHPSORFRQODWHFQRORJtDFRQODVSHUVRQDV\FRQHOWDPDxRGHODRUJDQL]DFLyQFRQOD
DQWLJHGDGGHODPLVPDHWF/DGHSDUWDPHQWDOL]DFLyQSRUVXSDUWHHVHODJUXSDPLHQWRGHORV
elementos correspondientes a las tareas en forPDKRPRJpQHD7LHQHHOREMHWLYRGHGLYLGLUODV
WDUHDV\FRPELQDUODVHQIRUPDOyJLFDVLQSHUGHU
GH YLVWD ODV YHQWDMDV GH OD SROLYDOHQFLD GH ODV
SHUVRQDVSDUDTXHHOÀXMRGHWUDEDMRGHSHQGDGH
un sistema y no de una persona.
El organigrama
$ PHGLGD TXH FUHFH XQD FRPSDxtD SXHGH DXmentar el número de unidades y –si la tecnología no soluciona el incremento de personal
QHFHVDULR± VH OH DJUHJDUiQ QXHYRV HVWUDWRV GH
VXSHUYLVLyQ &DVL WRGDV ODV HVWUXFWXUDV RUJDQLzacionales son demasiado complejas para desFULELUVHYHUEDOPHQWH3DUDPRVWUDUODHVWUXFWXUD
FRQWDPRVHQWUHRWUDVFRQODWpFQLFDGHOGLVHxR
GH XQ RUJDQLJUDPD TXH PRVWUDUi JUi¿FDPHQWH
ODVIXQFLRQHVGHSDUWDPHQWRVRSRVLFLRQHVGHOD
organización y cómo están relacionados entre sí
GHVGHHOSXQWRGHYLVWDMHUiUTXLFR
Se entenderá entonces a la organización como
HOSURFHVRSRUHOTXHODHVWUXFWXUDVHDGHFXDD
ORVREMHWLYRVUHFXUVRV\DPELHQWHHQHOTXHVH
desempeña. El diseño de la estructura es una
LPSRUWDQWHKHUUDPLHQWDGHJHVWLyQTXHWLHQHXQD
GL¿FXOWDGSURSLDODGHHVWDUUHODFLRQDGDFRQHO
poder en la organización. Ésa es la razón por
ODTXHQRWRGDVODVRUJDQL]DFLRQHVWLHQHQODHVWUXFWXUDPiVFRQYHQLHQWHVLQRTXHWLHQHQODTXH
SURYLQR GH DFXHUGRV QHJRFLDGRV /D HVWUXFWXUD
organizacional se puede analizar a partir de los Estructura formal e informal de la organización
cinco elementos siguientes:
Los departamentos pueden estructurarse formal (VSHFLDOL]DFLyQGHDFWLYLGDGHV
mente de tres maneras:
(VWDQGDUL]DFLyQGHDFWLYLGDGHV
a) La organización por funciones o funcional
&RRUGLQDFLyQGHDFWLYLGDGHV
TXH UH~QH HQ XQ GHSDUWDPHQWR D WRGRV ORV
&HQWUDOL]DFLyQ \ GHVFHQWUDOL]DFLyQ GH OD
TXHUHDOL]DQXQDDFWLYLGDGRYDULDVDFWLYLGDtoma de decisiones
GHVUHODFLRQDGDVHQWUHVt6XJUDQYHQWDMDHV
7DPDxRGHODXQLGDGGHWUDEDMR
TXHIDFLOLWDODVXSHUYLVLyQ
PRESIDENTE
VICEPRESIDENTE
Producción
VICEPRESIDENTE
Mercadotecnia
VICEPRESIDENTE
Finanzas
Cuadro 3.2: Organigrama funcional de una compañía manufacturera
VICEPRESIDENTE
Recursos humanos
3 - Principios de administración general / 67
PRESIDENTE
VICEPRESIDENTE
Investigación y
desarrollo
VICEPRESIDENTE
Mercadotecnia
GERENTE GENERAL
Productos
farmaceúticos
VICEPRESIDENTE
Producción
GERENTE GENERAL
Productos de
patente
VICEPRESIDENTE
Finanzas
GERENTE GENERAL
Productos de
atención personal
Cuadro 3.3: Organigrama por producto/mercado de una compañía manufacturera: división por producto
PRESIDENTE
PRESIDENTE
Mercadotecnia
VICEPRESIDENTE
Finanzas
VICEPRESIDENTE
América del
Norte
VICEPRESIDENTE
Producción
VICEPRESIDENTE
América Latina y
Lejano Oriente
VICEPRESIDENTE
Recursos humanos
VICEPRESIDENTE
Europa, África
y Medio Oriente
Cuadro 3.4: Organigrama por producto/mercado para una compañía manufacturera: división por zona
greográfica
b) La organización por producto o mercado
VHHQDXWRULGDGSDUDODVDFWLYLGDGHV\HVWiQfrecuentemente denominada organización
GDUHVSURIHVLRQDOHVGHVXVXQLGDGHVSHURVH
SRUGLYLVLyQ5H~QHHQXQDXQLGDGGHWUDEDMR
FUHDQ HTXLSRV GH SUR\HFWRV VHJ~Q VH QHFHDWRGRVORVTXHLQWHUYLHQHQHQODJHQHUDFLyQ
VLWHSDUDSRQHUHQSUiFWLFDSURJUDPDVHVSH\HOPDUNHWLQJGHXQSURGXFWRRVHUYLFLRRD
Ft¿FRV'HYDULRVGHSDUWDPHQWRVIXQFLRQDOHV
ORVTXHVHKDOODQHQFLHUWDUHJLyQJHRJUi¿FD
VHVHOHFFLRQDQORVPLHPEURVGHOHTXLSRTXH
R D ORV TXH WUDWDQ FRQ GHWHUPLQDGR WLSR GH
estarán subordinados a un gerente de proyecFOLHQWHV UHIHULGRV D XQ PHUFDGR HVSHFt¿FR
WRUHVSRQVDEOHSRUORVUHVXOWDGRVGHOWUDEDMR
Esta organización es muy frecuente en emGHOHTXLSR
SUHVDV TXH \D KDQ ORJUDGR XQ IXHUWH FUHFLPLHQWR\SRUORWDQWRKDQDXPHQWDGRVXWDLas relaciones dentro de una organización no
maño y multiplicado la cantidad de produc- VHOLPLWDQDODVR¿FLDOHVTXHHVWiQLQFOXLGDVHQ
WRVQHFHVLWDQGRDVtQXHYRVWLSRVGHFRQWURO los organigramas formales. Según lo analizado
HQODHYROXFLyQGHOSHQVDPLHQWRHQDGPLQLVWUDF La organización matricialGRQGHFRH[LVWHQ FLyQORVJHUHQWHVFRQRFHQODH[LVWHQFLDGHXQD
simultáneamente dos tipos de diseño. Los RUJDQL]DFLyQLQIRUPDOTXHFRH[LVWHDOODGRGHOD
departamentos funcionales permanentes po- IRUPDO\HVODTXHVHFUHDSRUODVQHFHVLGDGHVGH
68 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
GENERAL TECHNICS CORP
DIVISIÓN DE
PRODUCTOS
AUTOMOTRICES
DIVISIÓN DE
PRODUCTOS
ELÉCTRICOS
DIVISIÓN DE
PRODUCTOS
AEROESPACIALES
DIVISIÓN DE
PRODUCTOS
QUÍMICOS
Enlace
de mercado
Asignación de
recursos
Ayuda funcional de soporte a los proyectos
MATERIAL
INGENIERÍA
INSTALACIONES
Y
E
DE
PRODUCCIÓN INVESTIGACIÓN ADQUISICIONES
PERSONAL
Y
SEGURIDAD
PROYECTO DE
UN SIMULADOR
DE VUELO
Grupo de
producción
Grupo de
ingeniería
Grupo de
materiales
Grupo de
personal
Grupo de
contabilidad
PROYECTO DE
MÓDULO
ORBITAL
Grupo de
producción
Grupo de
ingeniería
Grupo de
materiales
Grupo de
personal
Grupo de
contabilidad
PROYECTO
DE VIAJE
SOLAR
Grupo de
producción
Grupo de
ingeniería
Grupo de
materiales
Grupo de
personal
Grupo de
contabilidad
PROYECTOS
CLIENTES
Y
CONTROL
Flujo de ejecución del trabajo
Cuadro 3.5: Organización matricial –División aeroespacial– (tomado de Stoner y Wankel)
pertenencia social y la defensa de los intereses
HQFRP~QTXHWLHQHQODVSHUVRQDV
Coordinación
/D FRRUGLQDFLyQ HV HO SURFHVR TXH LQWHJUD ORV
REMHWLYRV \ DFWLYLGDGHV GH XQLGDGHV LQGHSHQGLHQWHVGHXQDRUJDQL]DFLyQD¿QGHFRQVHJXLU
TXH VH ORJUHQ FRQ H¿FLHQFLD ODV PHWDV RUJDQL]DFLRQDOHV 6LQ OD FRRUGLQDFLyQ ORV LQGLYLGXRV
\GHSDUWDPHQWRVSHUGHUtDQGHYLVWDVXVIXQFLR-
nes en el seno de la organización y empezarían
DEXVFDUVXVLQWHUHVHVHVSHFt¿FRVDFRVWDGHODV
metas más generales de la organización.
Tramo de gerencia
El tramo de gerencia se llama también tramo de
FRQWURO\SXHGHGH¿QLUVHVLPSOHPHQWHFRPRHO
Q~PHURGHVXERUGLQDGRVTXHUHSRUWDQGLUHFWDPHQWHDXQJHUHQWHeVWHHVXQWHPDTXHVHKD
GHEDWLGR DPSOLDPHQWH \ VX HQIRTXH PRGHUQR
3 - Principios de administración general / 69
(PSUHQGHGRU
- Se ordenan los
recursos.
- Abundan las ideas.
- Se inician las
DFWLYLGDGHV
emprendedoras.
- Se necesitan poca
planeación y
coordinación.
- Se constituye un
nicho.
8Qemprendedor
primario tiene
poder.
ETAPAS Y SUS CARACTERÍSTICAS
)RUPDOL]DFLyQ\
2. Colectividad
control
- La estructura y la
- Se formalizan las
comunicación son
reglas.
informales.
- La estructura es
- Hay un sentido de ser
estable.
XQWRGRFROHFWLYR
- Se hace hincapié
- Los empleados
HQODH¿FLHQFLD\
trabajan largas horas.
mantenimiento.
- Los empleados tienen
- La organización
un sentido de misión.
se torna más
/DLQQRYDFLyQ
FRQVHUYDGRUD
continúa.
- Se institucionalizan
- Los empleados
los procesos.
se sienten muy
comprometidos.
4. Perfeccionamiento
de estructura
- Se perfecciona la
estructura.
- Se realiza la
descentralización.
- El dominio se
amplía.
- Se hacen
adaptaciones.
6HUHQXHYDOD
organización.
Tabla 3.1: Modelo integrante de los ciclos de la vida de la organización
DSDUHFLy FRQ OD UHYROXFLyQ LQGXVWULDO FXDQGR
VHWUDWyFRQPD\RUSUHFLVLyQHOQ~PHURPi[LPRGHVXERUGLQDGRVTXHXQJHUHQWHSRGtDVXSHUYLVDU
Si un tramo es demasiado amplio o reduciGR LQÀX\H HQ OD SURGXFWLYLGDG \ HQ ORV FRVWRV
(QWRQFHVODVHOHFFLyQGHOWUDPRDSURSLDGREULQdará la oportunidad de mejorar el desempeño
RUJDQL]DFLRQDO(QYH]GHEXVFDUHOWUDPRXQLYHUVDOPHQWH FRUUHFWR ORV LQYHVWLJDGRUHV FRQtemporáneos han intentado determinar el tramo
de gerencia más apropiado para cada situación
en particular.
Ciclo de vida de las organizaciones
([LVWHQYDULRVPRGHORVDOUHVSHFWR(OPiVUD]RQDEOHGHHOORVSURSRQHFXDWURHWDSDV
(PSUHQGHGRUD
'HH[SDQVLyQ
'HHVWUXFWXUDFLyQ
'HFRPSOHMLGDG
(OFUHFLPLHQWRGHPDVLDGRYHOR]GHXQDRUJDQL]DFLyQ SUHVHQWD DOJXQRV LQFRQYHQLHQWHV 3RU
ejemplo:
D /DV GHFLVLRQHV GHEHQ WRPDUVH FRQ PD\RU
rapidez.
E /DVH[LJHQFLDVGHWUDEDMRGHORVLQGLYLGXRV
crecen más rápidamente.
Diseño organizacional,
F +D\TXHDWHQGHUQHFHVLGDGHVHVSHFLDOHVGH
ambiente externo y estructura
reclutamiento y adiestramiento.
El diseño de una organización es un proceso conG /DVSHUVRQDVGHEHQDIURQWDUHOFDPELRFRQVWLQXR SRUTXH ORV DPELHQWHV HPSUHVDV \ HVWUDtante.
WHJLDV FDPELDQ LQHYLWDEOHPHQWH FRQ HO WLHPSR
H (VWiQPX\OLPLWDGRVORVUHFXUVRVKXPDQRV
ante ellos podrá ser necesario realizar grandes
\¿QDQFLHURV
FDPELRVHQODHVWUXFWXUDRUJDQL]DFLRQDO\VHJXUDPHQWHVHQHFHVLWDUiQFDPELRVPiVSHTXHxRV
(OFLFORGHYLGDGHXQDRUJDQL]DFLyQSXHGH
con mayor frecuencia.
La esencia de una buena estructura organi- FRPSDUDUVHFRQHOGHOVHUKXPDQR7DQWRODRU]DFLRQDO HV VX DGHFXDFLyQ R FRQFRUGDQFLD QR JDQL]DFLyQFRPRHOVHUKXPDQRQDFHQFUHFHQ
VyORFRQODHVWUDWHJLD\HODPELHQWHH[WHUQRVLQR PDGXUDQWLHQHQUHWURFHVRV\SHUtRGRVGHUHYLWDtambién con el ambiente interno de la empresa. OL]DFLyQ3DUDDPERVODVFRQGLFLRQHVGXUDQWHHO
La estructura debe estar adaptada al am- nacimiento y las primeras etapas tienen un efecbiente. Hay posibilidades de encontrarse con un to importante en el desarrollo posterior.
6LELHQKD\VHPHMDQ]DVH[LVWHQSRUORPHDPELHQWHHVWDEOHXQDPELHQWHOHYHPHQWHFDPELDQWHRXQDPELHQWHWXUEXOHQWR(VQDWXUDOTXH QRVGRVGLIHUHQFLDVIXQGDPHQWDOHVHQWUHHOFLFOR
los cambios estructurales sean proporcionales a GHYLGDGHODVRUJDQL]DFLRQHV\HOGHOKRPEUH
/D PXHUWH HV LQHYLWDEOH SDUD HO VHU KXPDla frecuencia e intensidad de los cambios en los
QR PLHQWUDV TXH XQD RUJDQL]DFLyQ SRGUtD
DPELHQWHVH[WHUQRV
70 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
superar la generación humana por medio del
UHFDPELR JHQHUDFLRQDO TXH VLJXH ODV RSHUDciones de la empresa.
/DVHWDSDVGHGHVDUUROORGHODYLGDKXPDQD
VRQEDVWDQWHSUHGHFLEOHVHQFDPELRODGXUDción de las etapas de una organización son
PX\YDULDEOHV
Influencia, poder y autoridad
6HGH¿QHDODLQÀXHQFLDFRPRODFDSDFLGDGGH
HMHUFHUXQDDFFLyQTXHHQIRUPDGLUHFWDRLQGLUHFWDRFDVLRQHXQFDPELRGHFRPSRUWDPLHQWRR
actitud en otra persona o grupo.
/DLQÀXHQFLDSXHGHVHUSRVLWLYDVLVHORJUD
HOUHVXOWDGRHVSHUDGR\VHUiQHJDWLYDVLDSHVDU
GHKDEHUODHMHUFLGRQRVHSURGXFHGLFKRUHVXOtado.
6HGH¿QHHOSRGHUFRPRODFDSDFLGDGSRWHQFLDOGHHMHUFHUXQDLQÀXHQFLDSRVLWLYDGHQWURGH
XQFRQWH[WRMHUiUTXLFR
La autoridad formal es un tipo de poder otorgado por la organización. Se funda en el reconocimiento de la legitimidad o legalidad de los
LQWHQWRVGHHMHUFHUODLQÀXHQFLDHQHOPDUFRGHO
cargo asignado.
Hay dos teorías fundamentales sobre el origen de la autoridad formal en las organizacioQHV OD SHUVSHFWLYD FOiVLFD \ OD SHUVSHFWLYD GH
organización.
/DSHUVSHFWLYDFOiVLFDVXSRQHTXHODDXWRULGDGVHRULJLQDHQDOJ~QQLYHOPX\DOWRGHOD
VRFLHGDG 'LRV OD EXURFUDFLD \ TXH OXHJR VH
WUDQVPLWH OHJtWLPDPHQWH GH XQ QLYHO D RWUR
(QHVWDSHUVSHFWLYDORVJHUHQWHVWLHQHQHOGHrecho de impartir órdenes legítimas y los subordinados tienen la obligación de obedecer.
(VWD SHUVSHFWLYD HV QRUPDWLYD \ SDUFLDOPHQWH
GHVFULSWLYD
/DSHUVSHFWLYDGHDFHSWDFLyQDWULEX\HODEDVH
GHODDXWRULGDGDOTXHUHFLEHODLQÀXHQFLD\QR
DOTXHODHMHUFH(OSXQWRIXQGDPHQWDOHVHOTXH
HVWLPDTXHHOUHFHSWRUHVTXLHQGHEHREHGHFHUR
QR3RUFRQVLJXLHQWHHQODSHUVSHFWLYDGHDFHSWDFLyQHVHOUHFHSWRU\QRHOTXHHPLWHODRUGHQ
TXLHQGHWHUPLQDVLODDXWRULGDGHVWiSUHVHQWHHQ
una ley u orden en particular.
8QDH[DJHUDFLyQGHHVWD~OWLPDSHUVSHFWLYD
SRGUtDOOHYDUDODVRUJDQL]DFLRQHVDODLQVXERUGLnación y al caos.
(OSRGHUQRSURYLHQHVLPSOHPHQWHGHOQLYHO
TXHODSHUVRQDRFXSDGHQWURGHODMHUDUTXtDRUJDQL]DFLRQDO-RKQ)UHQFK\%HUWUDP5DYHQGLVWLQguen cinco fuentes del poder:
D (OSRGHUGHrecompensa por cumplir órdenes
u otras disposiciones.
E (O SRGHU coercitivo. Es la capacidad para
FDVWLJDU DO RWUR SRU QR FXPSOLU FRQ ODV yUdenes.
F (OSRGHUlegítimoTXHH[LVWHFXDQGRXQVXERUGLQDGRRLQÀXHQFLDGRUHFRQRFHTXHHOLQÀXHQFLDGRUWLHQHXQGHUHFKRRODOHJLWLPLGDG
GHHMHUFHULQÀXHQFLD
G (O SRGHU GH experto. Se basa en la idea o
FUHHQFLDGHTXHHOLQÀXHQFLDGRUSRVHHDOJXQD SHULFLD R FRQRFLPLHQWR GH OD TXH HO VXbordinado carece.
H (OSRGHUGHreferencia. Se basa en el deseo
GHO LQÀXHQFLDGR GH LGHQWL¿FDUVH FRQ HO TXH
HMHUFH OD LQÀXHQFLD R ELHQ GH LPLWDUOR SRU
DGKHVLyQDYDORUHVVXSHULRUHV
Autoridad de línea y de staff
/DDXWRULGDGIRUPDOHVGHFLUODDXWRULGDGOHJtWLPDDVRFLDGDDODSRVLFLyQRUJDQL]DFLRQDOSURYLHQHGHOKHFKRGHTXHORVVXERUGLQDGRVDFHSWDQ
TXHHVFRQYHQLHQWH\GHVHDEOHVHJXLUODVyUGHQHV
GHORVVXSHULRUHVHQODMHUDUTXtDRUJDQL]DFLRQDO
2WUDDFHSFLyQGHODSDODEUDDXWRULGDGVLUYHSDUD
GLVWLQJXLU HQWUH OR TXH FRQ IUHFXHQFLD VH OODPD
autoridad de línea y autoridad staff.
7RGDRUJDQL]DFLyQH[LVWHFRQHOSURSyVLWRGH
conseguir determinadas metas. Los gerentes de
OtQHDSXHGHQGH¿QLUVHFRPRDTXpOORVTXHWLHQHQ
la responsabilidad directa de alcanzar esas metas. La autoridad de línea está representada por
la cadena estándar de mando.
&XDQGRXQDRUJDQL]DFLyQHVSHTXHxDWRGDV
las posiciones pueden ser funciones de línea; las
IXQFLRQHVVWDIIVHDJUHJDQDPHGLGDTXHFUHFH\
VHDGYLHUWHODXWLOLGDGGHFRQWUDWDUDHVSHFLDOLVWDVSDUDTXHD\XGHQDORVPLHPEURVGHOtQHDHQ
la ejecución de sus tareas.
(OSHUVRQDOVWDIILQFOX\HDLQGLYLGXRV\JUXSRVGHODRUJDQL]DFLyQTXHSUHVWDQVHUYLFLRV\
asesoran al personal de línea. El staff no es una
LQQRYDFLyQ UHFLHQWH (VWH WLSR GH SHUVRQDO KD
VLGRXWLOL]DGRDWUDYpVGHODKLVWRULDHQGLIHUHQtes circunstancias.
/DVSRVLFLRQHVVWDIIGL¿HUHQGHODVGHOtQHD
por su fuente de poder. Los gerentes de línea
SRVHHQ DXWRULGDG IRUPDO SRGHU OHJtWLPR SDUD
RUGHQDU D RWURV OR TXH GHEHQ KDFHU WDPELpQ
PXFKRSRGHUGHSUHPLR\SRGHUFRHUFLWLYRSRU
ODUHODFLyQMHUiUTXLFDFRQVXVVXERUGLQDGRV
Los miembros del personal staff carecen de
autoridad formal para dar órdenes y se supone
3 - Principios de administración general / 71
TXHQRWLHQHQSRGHUGHUHFRPSHQVDQLFRHUFLWL- Barreras para una efectiva delegación
YR3RUHOFRQWUDULRGDQFRQVHMRV\RULHQWDFLyQ D 5HVLVWHQFLDDGHOHJDUODDXWRULGDGJHQHUDOPHQWHYDDFRPSDxDGDSRUODLGHDGHTXHGH\FRQHOORHMHUFHQIXQGDPHQWDOPHQWHHOSRGHU
legar es ceder poder y eso es de difícil acepGHH[SHUWR
WDFLyQSDUDORVQLYHOHVVXSHULRUHV
E 5HVLVWHQFLDDDFHSWDUODGHOHJDFLyQVHGHEH
Delegación
D OD LQVHJXULGDG GH ORV VXERUGLQDGRV TXH
La delegación es la asignación de una autoridad
TXLHUHQ HYLWDU QXHYDV UHVSRQVDELOLGDGHV \
IRUPDODRWUDSHUVRQDSDUDTXHOOHYHDFDERGHmayores riesgos en las tareas.
WHUPLQDGDVDFWLYLGDGHV/DGHOHJDFLyQGHORVVXperiores a los subordinados es necesaria para el
/D GHOHJDFLyQ H¿FLHQWH UHTXLHUH TXH ORV
EXHQIXQFLRQDPLHQWRGHFXDOTXLHURUJDQL]DFLyQ
pues ningún superior puede realizar personal- subordinados reciban una amplia cuota de liPHQWHHQIRUPDFRPSOHWDWRGDVODVDFWLYLGDGHV EHUWDG FRQ HO DSR\R GH WRGD OD FDSDFLWDFLyQ
necesaria para poder desempeñarse en forma
necesarias para operar una organización.
La delegación presenta una situación muy competente.
especial en cuanto a la responsabilidad. La resSRQVDELOLGDG GHO VXSHULRU SHUPDQHFH LQWDFWD Centralización y descentralización
\DTXHpOUHVSRQGHUiVLHPSUH\HQ~OWLPRPR- La delegación es el proceso de asignar autoridad
PHQWR SRU OR UHDOL]DGR /D UHVSRQVDELOLGDG HV GHXQQLYHOJHUHQFLDODOVLJXLHQWHQLYHOPiVEDMR
LQGHOHJDEOH/RTXHSURGXFHODGHOHJDFLyQHVOD Los conceptos de descentralización y centralizaJHQHUDFLyQGHXQDQXHYDUHVSRQVDELOLGDGGHOVX- FLyQGHVLJQDQHOJUDGRHQTXHODDXWRULGDG\OD
bordinado hacia el superior con respecto a los GHFLVLyQKDQVLGRWUDQVPLWLGDVDQLYHOHVLQIHULRUHV GHVFHQWUDOL]DFLyQ R KDQ VLGR FRQVHUYDGDV
resultados logrados con la tarea delegada.
(V PX\ LPSRUWDQWH TXH D ORV VXERUGLQDGRV HQHOQLYHOPiVDOWRGHODRUJDQL]DFLyQ FHQWUDTXHUHFLEHQODVWDUHDVGHOHJDGDVVHOHVRWRUJXH OL]DFLyQ /DVYHQWDMDVGHODGHVFHQWUDOL]DFLyQVRQVHVX¿FLHQWHDXWRULGDGSDUDTXHODVUHDOLFHQ
/D GHOHJDFLyQ H[FHSWR HQ RUJDQL]DFLRQHV mejantes a las de la delegación: los gerentes se
SHTXHxDVHVLPSUHVFLQGLEOH\SURGXFHQXPHUR- liberan de parte de su carga de trabajo y consiVDV YHQWDMDV DO OLEHUDU WLHPSR D ORV VXSHULRUHV JXHQ PiV WLHPSR SDUD OD WRPD GH GHFLVLRQHV
SDUDTXHVHGHGLTXHQDRWUDVWDUHDVGHPD\RUUH- SDUDSUR\HFWDUODFDSDFLWDFLyQTXHQHFHVLWDQODV
OHYDQFLD$O PLVPR WLHPSR VH ORJUDUi TXH ORV personas y para considerar las acciones tácticas
VXERUGLQDGRVSDUWLFLSHQPiVDFWLYDPHQWHHQHO y el cumplimiento de las estratégicas propias
GHVDUUROOR GH ODV WDUHDV OR TXH FRQVWLWX\H XQD de su cargo.
IXHQWHGHPRWLYDFLyQ
PLANEACIÓN DE
RECURSOS HUMANOS
RECLUTAMIENTO
SELECCIÓN
ADIESTRAMIENTO
Y DESARROLLO
INTRODUCCIÓN
Y ORIENTACIÓN
EVALUACIÓN DEL
DESEMPEÑO
TRANSFERENCIAS
SEPARACIONES
Cuadro 3.6: Proceso de dotación de personal en la organizaciones
72 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
El proceso de formación
de la dotación de personal
La organización y los gerentes deben adaptarse
D FDPELRV GH OD GRWDFLyQ GH SHUVRQDO D WUDYpV
GHO WLHPSR FRQ PD\RU R PHQRU IUHFXHQFLD VHJ~QHOWLSRGHRUJDQL]DFLyQ\HOPHUFDGRHQTXH
se encuentre.
El proceso de dotación de personal puede
considerarse como un procedimiento constanWH\JUDGXDOFRQHOTXHVHSUHWHQGHTXHODRUganización tenga siempre a las personas idóQHDVHQHOSXHVWRDGHFXDGR\HQHOPRPHQWR
oportuno.
La correcta dotación de personal incluye la
necesidad de efectuar ciertos pasos. Ellos son:
3ODQHDPLHQWRGHORVUHFXUVRVKXPDQRV
5HFOXWDPLHQWR
6HOHFFLyQ
,QGXFFLyQ\RULHQWDFLyQ
$GLHVWUDPLHQWR\GHVDUUROOR
(YDOXDFLyQGHOGHVHPSHxR
7UDQVIHUHQFLDV
3URPRFLRQHV
6HSDUDFLyQ
(V REYLR TXH SDUD SRGHU WRPDU GHFLVLRQHV
UHVSHFWR GH OD GRWDFLyQ GH SHUVRQDO VH GHEHQ
SODQHDUH¿FLHQWHPHQWHORVUHFXUVRVKXPDQRV
Los pasos de la planeación de los recursos
KXPDQRVVRQ
3ODQHDUODVQHFHVLGDGHVIXWXUDV
3ODQHDUHOHTXLOLEULRIXWXUR
3ODQHDUHOUHFOXWDPLHQWRODVHOHFFLyQ\ORV
despidos
3ODQHDUHOGHVDUUROOR
8Q SXQWR PX\ LPSRUWDQWH SDUD HO EXHQ
desempeño del personal es tener claramente
preparada la descripción de los puestos. La descripción de un puesto ayudará a establecer los
UHTXLVLWRV TXH GLFKR SXHVWR GHPDQGH \ SRU OR
WDQWRIDFLOLWDUiODVHOHFFLyQGHOFDQGLGDWRSUHIHrible para ocupar cada puesto.
/D VHOHFFLyQ GH SHUVRQDO DEDUFD YDULRV SDsos:
/DVROLFLWXG
(QWUHYLVWDGHVHOHFFLyQLQLFLDO
3UXHEDVGHGHVWUH]D\FDSDFLGDG
,QYHVWLJDFLyQGHUHIHUHQFLDV
(QWUHYLVWDGHVHOHFFLyQHQSURIXQGLGDG
([DPHQItVLFR
2IHUWDGHHPSOHRVRODPHQWHSDUDHOFDVRGH
TXH HO FDQGLGDWR KD\D SDVDGR H[LWRVDPHQWH
los pasos anteriores
La inducción y la orientación son muy imSRUWDQWHVSXHVD\XGDQDODSHUVRQDTXHLQJUHVD
a la organización a adaptarse mejor a su posición de trabajo.
3DUD TXH XQD HPSUHVD IXQFLRQH DUPyQLFDPHQWH HV LPSUHVFLQGLEOH TXH H[LVWDQ HQ HOOD
SODQHVGHDGLHVWUDPLHQWRFDSDFLWDFLyQ\DSUHQdizaje dirigidos a todos sus miembros.
2WUD DFWLYLGDG UHOHYDQWH FRQ UHVSHFWR D OD
IXQFLyQGHSHUVRQDOHVODHYDOXDFLyQGHGHVHPpeño. Es una de las tareas más importantes y
más complejas de los gerentes. No siempre es
fácil juzgar con precisión el desempeño de un
VXERUGLQDGR\DGHPiVUHVXOWDLQFOXVRPiVGLItcil comunicar ese juicio en una forma construcWLYDFXDQGRVHHVWiHQSUHVHQFLDGHHYDOXDFLRQHV
QHJDWLYDV
Las organizaciones y el cambio
Las organizaciones deben ajustarse a los distinWRV\FDPELDQWHVDPELHQWHVHQTXHRSHUDQ/DV
YDULDFLRQHVFRQWLQXDVHQHODPELHQWHGHPDQGDUiQ DMXVWHV IXWXURV HQ HO GLVHxR GH OD HPSUHVD
DXQTXHpVWDHVWpELHQGLVHxDGD$GPLQLVWUDUELHQ
dicho desafío es imprescindible para seguir opeUDQGR\DGHPiVSXHGHVHUXQUHTXLVLWRHVHQFLDO
SDUDODVXSHUYLYHQFLDGHODVRUJDQL]DFLRQHV
$QWHODSUHVHQFLDGHOFDPELRVHPDQL¿HVWD
muy rápidamente la inmediata posibilidad de
OD H[LVWHQFLD GH OD UHVLVWHQFLD DO FDPELR eVWD
SUHVHQWDPXFKDVFDXVDVTXHSXHGHQGHEHUVHDO
PLHGRODLJQRUDQFLDODFRPRGLGDGODGL¿FXOWDG
HQ PRGL¿FDU KiELWRV \ FRVWXPEUHV HWF \ TXH
pueden impedir la implementación de los camELRVUHTXHULGRV(VPX\QHFHVDULRLGHQWL¿FDUORV
PRWLYRVGHODUHVLVWHQFLDDOFDPELRSDUDSRGHU
reorientarla hacia el cumplimiento de los objetiYRVGHODHPSUHVD
La mejor manera de enfrentar los sucesiYRV FDPELRV HV KDFHUOR SRU PHGLR GH FDPELRV
SODQHDGRV PHGLDQWH HO HQIRTXH GHO 'HVDUUROOR
2UJDQL]DFLRQDO TXH LPSOLFD DGHPiV TXH HO
desarrollo de la organización dependerá del deVDUUROORGHODVSHUVRQDVTXHODIRUPDQ
(O FDPELR SRVHH LQQXPHUDEOHV IXHU]DV TXH
ORLPSXOVDQ([LVWHQODVIXHU]DVH[WHUQDV WHFQRORJtDVKRFNVHFRQyPLFRVFRPSHWHQFLDWHQGHQFLDV VRFLDOHV SROtWLFD PXQGLDO HWF \ WDPELpQ
ODVIXHU]DVLQWHUQDVSURSLDVGHODRUJDQL]DFLyQ
3 - Principios de administración general / 73
3RURWURODGRHVPX\LPSRUWDQWHODIXQFLyQ
GH OLGHUD]JR SDUD ORJUDU XQ FDPELR DGHFXDGR
3RUORWDQWRHVQHFHVDULRTXHH[LVWDXQDJHQWH
GHO FDPELR TXH HV XQ LQGLYLGXR HQFDUJDGR GH
asumir el papel de líder en la administración del
proceso de cambio.
(Q GLFKR SURFHVR GH FDPELR YDQ D LQWHUYHQLUIXHU]DVTXHORLPSXOVDUiQ\RWUDVGHVHQWLGR
FRQWUDULRTXHEXVFDUiQIUHQDUOR3XHGHSUHVHQWDUVHHQIRUPDLPSOtFLWDLQPHGLDWDRGLIHULGD\
SURYHQLUGHFXDOTXLHUQLYHOGHODRUJDQL]DFLyQ
3DUD LPSOHPHQWDU \ FRQVROLGDU HO FDPELR
.XUW/HZLQSURSXVRWUHVHWDSDVTXHVRQODVVLguientes:
'HVFRQJHODU
&DPELDU
5HFRQJHODU
'HVDUUROOR GH ORV UHFXUVRV LQWHUQRV SURYHnientes del desarrollo organizacional
$GPLQLVWUDFLyQH¿FD]GHOSURJUDPDGHGHsarrollo organizacional
0HGLFLyQGHORVUHVXOWDGRV
Cultura de la organización
7RGDRUJDQL]DFLyQWLHQHXQDFXOWXUD6LJXLHQGR
D9LMD\6DWKHODFXOWXUDHVHO³FRQMXQWRGHLGHDV
LPSRUWDQWHV D PHQXGR QR H[SUHVDGDV TXH
FRPSDUWHQ ORV PLHPEURV GH XQD FRPXQLGDG´
(VWDV LGHDV VH FRPSRQHQ GH QRUPDV YDORUHV
KiELWRV DFWLWXGHV ULWRV \ FUHHQFLDV /D FXOWXUD
FRUSRUDWLYDHVSDUWHLQWHJUDOGHODYLGDHQODVRUganizaciones y tiene importantes consecuencias
para la acción gerencial.
8QDFXOWXUDRUJDQL]DFLRQDOIXHUWH\DPSOLDPHQWH UHFRQRFLGD VXHOH FLWDUVH FRPR XQ JUDQ
<D VH KD PHQFLRQDGR OD LPSRUWDQFLD TXH PRWLYRGHp[LWRGHODVPHMRUHVFRPSDxtDV
SXHGHWHQHUODUHVLVWHQFLDDOFDPELR(QWRQFHV
DKRUD VH GHEHQ HQXPHUDU ODV DFFLRQHV TXH VH El conflicto organizacional
Como las organizaciones están integradas por
pueden tomar para superarla. Éstas son:
JUXSRV QXPHURVRV GH SHUVRQDV HO WHPD GHO
(GXFDFLyQ\FRPXQLFDFLyQ
FRQÀLFWRHVLQHYLWDEOHHQHOODV(OFRQÀLFWRRU 3DUWLFLSDFLyQHLQWHUYHQFLyQDFWLYD
ganizacional es un desacuerdo entre dos o más
)DFLOLWDFLyQ\VRSRUWH
HQWLGDGHVVRFLDOHVTXHSXHGHQVHUGRVSHUVRQDV
1HJRFLDFLyQ\DFHSWDFLyQ
PLHPEURV R JUXSRV GH XQD HPSUHVD HWF GHEL 0DQLSXODFLyQ\FRRSWDFLyQ
GR DO KHFKR GH TXH KDQ GH FRPSDUWLU UHFXUVRV
&RHUFLyQH[SOtFLWDHLPSOtFLWD
HVFDVRVRUHDOL]DUDFWLYLGDGHVFRQMXQWDVTXHORV
/RV FDPELRV HQ XQD RUJDQL]DFLyQ DIHFWDQ SXHGDQOOHYDUDTXHVHWUDEHHOFRQÀLFWRTXHHVWi
EiVLFDPHQWHDFXDWURDVSHFWRVFUtWLFRVTXHVRQ en proceso.
(O FRQFHSWR GH FRQÀLFWR VH RSRQH DO GH
/DHVWUXFWXUD
FRRSHUDFLyQTXHVHSUHVHQWDFXDQGRGRVRPiV
/DWHFQRORJtD
personas trabajan juntas para obtener metas
/DFXOWXUD
compartidas.
/RVSURFHVRV
(OFRQÀLFWRHQSULQFLSLRSXHGHVHULQQHFH/DVFRQGLFLRQHVSDUDHOp[LWRGHORVSURJUD- VDULR\SHUMXGLFLDOSDUDODRUJDQL]DFLyQDXQTXH
mas de desarrollo organizacional son:
~OWLPDPHQWHVHKDGHWHFWDGRTXHORVFRQÀLFWRV
5HFRQRFLPLHQWRSRUSDUWHGHODGLUHFFLyQ DYHFHVVRQXQDEXHQDIXHQWHSDUDHQFRQWUDUVRGHTXHODRUJDQL]DFLyQWLHQHSUREOHPDV
OXFLRQHVQXHYDV\FUHDWLYDVDORVSUREOHPDV3RU
&RQWDUFRQHODVHVRUDPLHQWRGHXQH[SHUWR ORWDQWRPiVTXHVXSULPLU\UHVROYHUORVFRQÀLFen ciencias del comportamiento como con- WRVVHWUDWDGHVDEHUJHVWLRQDUORV\DYHFHVHVWLsultor
PXODUORVSDUDDXPHQWDUDOPi[LPRVXVDVSHFWRV
$SR\R\SDUWLFLSDFLyQGHVGHHOSULQFLSLRGH EHQp¿FRV
los gerentes
(V IUHFXHQWH REVHUYDU TXH GHVSXpV GH XQ
3DUWLFLSDFLyQGHORVOtGHUHVGHOJUXSRGHWUD- FRQÀLFWR DSDUHFHQ VLWXDFLRQHV TXH KD\ TXH
bajo
afrontar:
2EWHQFLyQGHp[LWRVLQLFLDOHV
8QDPD\RUFRKHVLyQ
,QVWUXLUDODVSHUVRQDVFRQUHVSHFWRDO'H 6XUJLPLHQWRGHOtGHUHV
sarrollo Organizacional
'LVWRUVLyQGHODVSHUFHSFLRQHV
5HFRQRFHUODVFXDOLGDGHVGHORVJHUHQWHV
$XPHQWRGHORVHVWHUHRWLSRVQHJDWLYRV
3DUWLFLSDFLyQGHORVJHUHQWHVGHUHFXUVRVKX 6HOHFFLyQGHUHSUHVHQWDQWHVIXHUWHV
manos
$SDULFLyQGHSUHMXLFLRV
74 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
La creatividad organizacional
SHUVLVWHQFLD GH XQ FRPSRUWDPLHQWR TXH SXHGH
SRWHQFLDU XQD FRQGXFWD H[LVWHQWH PRGL¿FDUOD
GHVDFWLYDUODRFUHDUXQDFRQGXFWDQXHYD
Las teorías más difundidas son las de MasORZ+HU]EHUJ\0F*UHJRU(OHQIRTXHFRQWHPporáneo se estructura en base a tres tipos de teoUtDVDVDEHU
D 7HRUtDGHOFRQWHQLGRWLHQHHQFXHQWDEiVLFDPHQWHODVQHFHVLGDGHVKXPDQDV\VXUHODFLyQFRQODVGHODRUJDQL]DFLyQSDUDGHVDUURllar las acciones necesarias para coordinarlas
DUPyQLFDPHQWH GHVHR GH VDWLVIDFHU QHFHVLGDGHVGHDOLPHQWRDPLVWDGUHFRQRFLPLHQWR
ORJUR E 7HRUtD GH ORV SURFHVRV VH EDVD HQ FRPprender los procesos de pensamiento de las
personas en función de la satisfacción de sus
QHFHVLGDGHV TXH LQÀX\HQ HQ VX FRPSRUWDmiento.
F 7HRUtD GHO UHIRU]DPLHQWR R UHFRPSHQVDV
TXH VDWLVIDFHQ QHFHVLGDGHV LQVWUtQVHFDV VDWLVIDFFLyQ GHO WUDEDMR UHDOL]DGR R H[WUtQVH3. La dirección
FDV SURSRUFLRQDGDVSRUHOPHGLRHQHOTXH
La tercera función esencial de la administración
DFW~DQ \ TXH QR VRQ motivantes VLQR TXH
es la dirección/DGLUHFFLyQHVODIXQFLyQTXH
disminuyen el nivel de insatisfacción. Por
relaciona más directamente a los gerentes con
HMHPSORXQDXPHQWRHQODUHPXQHUDFLyQGH
sus subordinados. La dirección consiste en traXQ WUDEDMR TXH intrínsecamente es de poco
EDMDUFRQRWURV\DVHJXUDUODH¿FDFLDGHODRUJDLQWHUpVSDUDODSHUVRQDTXHORUHDOL]D
nización. Puede ser realizada con una mezcla de
SRGHU IRUPDO FXDQWR PHQRV PHMRU SRUTXH GD
/DPRWLYDFLyQHVWiHVWUHFKDPHQWHYLQFXODGD
VyOR OD RSRUWXQLGDG SDUD REHGHFHU \ FRQ OLGH- FRQODVLWXDFLyQGHOWUDEDMR3RUORWDQWRLQÀXUD]JR FXDQWRPiVPHMRUSRUTXHJHQHUDPRWL- \HQ HQ HOOD ODV SROtWLFDV UHIHUHQWHV DO SHUVRQDO
YDFLyQHQODVSHUVRQDV el sistema de recompensas y la cultura organi/RV WHPDV TXH FRPSUHQGHQ D OD GLUHFFLyQ zacional.
son:
0RWLYDFLyQGHVHPSHxR\VDWLVIDFFLyQ
Liderazgo
/LGHUD]JR
(VPX\GLItFLOGH¿QLUHOVLJQL¿FDGRGHXQOtGHU
*UXSRV\FRPLWpV
+D\ SUiFWLFDPHQWH WDQWDV GH¿QLFLRQHV GH OLGH &RPXQLFDFLyQ LQWHUSHUVRQDO \ RUJDQL]D- UD]JRFRPRSHUVRQDVTXHKDQWUDWDGRGHGH¿QLU
cional
el concepto. El liderazgo gerencial es el proceso
&DUUHUDVRUJDQL]DFLRQDOHV\GHVDUUROORLQGL- GHGLULJLUHLQÀXLUSRVLWLYDPHQWHHQODVDFWLYLGDYLGXDO
des de los miembros del grupo relacionado con
ODVWDUHDVSURGXFLHQGRXQDDGKHVLyQQDWXUDOKDMotivación
FLDODVSURSXHVWDVGHOOtGHU+D\DTXtWUHVFRQVH/DPRWLYDFLyQHVODIXHU]DTXHFDXVDFDQDOL]D cuencias importantes:
y sostiene el comportamiento del ser humano.
(O OLGHUD]JR GHEH LQFOXLU D RWUDV SHUVRQDV
8QDFDUDFWHUtVWLFDIXQGDPHQWDOGHODVSHUVRQDV
los subordinados o seguidores.
HVTXHVRQVHUHVFRPSOHMRVTXHVHGHVHQYXHOYHQ (O OLGHUD]JR VXSRQH XQD GLVWULEXFLyQ GHVHQXQiPELWRFRQWLQJHQWH\VXVPRWLYDFLRQHVQR
igual del poder entre líderes y miembros del
VLHPSUH VRQ IiFLOHV GH GHVFXEULU ([LVWHQ PXgrupo.
FKDV WHRUtDV DFHUFD GH OD PRWLYDFLyQ \ DOJXQDV $GHPiVGHSRGHUGDUyUGHQHVRLQVWUXFFLRGH HOODV GL¿HUHQ HQWUH Vt 3RGUtD GHFLUVH TXH OD
QHVDVXVVHJXLGRUHVORVOtGHUHVWLHQHQSRU
PRWLYDFLyQHVHOVXUJLPLHQWRGHXQDGLUHFFLyQ\
VREUHWRGRFRQGLFLRQHVSDUDLQÀXLUHQHOORV
/D FUHDWLYLGDG HV OD FDSDFLGDG SUHVHQWH HQ ORV
LQGLYLGXRV TXH VH GHGLFDQ D GHVDUUROODU LGHDV
QXHYDV\RULJLQDOHV/DFUHDWLYLGDGVHHVWLPXOD
PXFKRPiVHQXQDDWPyVIHUDGHWROHUDQFLDTXH
DOLHQWHODH[SORUDFLyQGHQXHYDVLGHDV\IRUPDV
GH KDFHU ODV FRVDV DFHSWDQGR ORV HUURUHV OyJLFRV TXH SXGLHUDQ SURGXFLUVH (Q HO SURFHVR GH
DSUHQGL]DMHFXDQGRVHWUDWDGHLPSOHPHQWDUXQD
LQQRYDFLyQHVWiLPSOtFLWDODSRVLELOLGDGGHOHUURU
FRPRFDUDFWHUtVWLFDLQKHUHQWHDHVHSURFHVR8Q
medio ambiente propicio para el desarrollo de la
FUHDWLYLGDGWLHQHODVVLJXLHQWHVFDUDFWHUtVWLFDV
/RJUDODDFHSWDFLyQGHOFDPELR
(VWLPXODQXHYDVLGHDV
3HUPLWHPiVLQWHUDFFLyQ
7ROHUDORVHUURUHV
(VWDEOHFH REMHWLYRV FODURV \ GHMD OLEHUWDG
para alcanzarlos.
2IUHFHUHFRQRFLPLHQWRVPRUDOHV\RPDWHriales.
3 - Principios de administración general / 75
HQ IRUPD SRVLWLYD SRU OD FRKHUHQFLD GH ODV
SURSXHVWDV UHODFLRQDGDV FRQ ORV REMHWLYRV
RUJDQL]DFLRQDOHV \ ORV LQGLYLGXDOHV GH ODV
personas.
Grupos formales
Son creados deliberadamente por los gerentes
y tienen la responsabilidad de ejecutar deterPLQDGDVWDUHDVSDUDD\XGDUDODRUJDQL]DFLyQD
FRQVHJXLU VXV PHWDV (O WLSR GH JUXSR IRUPDO
Numerosos autores se dedicaron a estudiar más destacado en la organización es el grupo de
ORV HVWLORV GHO OLGHUD]JR (QWUH HOORV VH SXHGH mando.
PHQFLRQDU D %ODNH 0RXWRQ /LFNHUW )LHGOHU
+HUVH\ \ %ODQFKDUG HVWXGLRV GH OD 8QLYHUVL- Grupos informales
GDGGH2KLR Ohio State University 0RGHORGH /RVJUXSRVLQIRUPDOHVVXUJHQFDGDYH]TXHODV
personas se reúnen e interactúan de manera per9URRPHWF
PDQHQWH SRU DOJ~Q JUDGR GH D¿QLGDG 3XHGHQ
IDYRUHFHUORVLQWHUHVHVGHODRUJDQL]DFLyQSHUR
Factores en la eficacia del liderazgo
+D\YDULRVIDFWRUHVHQODH¿FDFLDGHOOLGHUD]JR WDPELpQ D YHFHV SXHGHQ VHU QR IXQFLRQDOHV D
ORVREMHWLYRVRUJDQL]DFLRQDOHV
Se puede mencionar:
8Q LQGLFDGRU PX\ LPSRUWDQWH VREUH FXiQWD
D 3HUVRQDOLGDG GHO OtGHU VXV H[SHULHQFLDV \
LQÀXHQFLD WLHQH HO JUXSR SDUD FDGD XQR GH VXV
H[SHFWDWLYDV
E /DVH[SHFWDWLYDV\FRPSRUWDPLHQWRVGHORV miembros es la cohesión del grupo.
Los grupos son muy útiles para la solución
superiores
F &DUDFWHUtVWLFDV H[SHFWDWLYDV \ FRPSRUWD- GHSUREOHPDVSXHVSUHVHQWDQ
0D\RUFRQRFLPLHQWRHLQIRUPDFLyQ
mientos de los subordinados
G 1HFHVLGDGHVGHODWDUHD DFWLYLGDGHVSRFRR 0iVIRUPDVGHDERUGDUXQSUREOHPD
0D\RUDFHSWDFLyQGHODVVROXFLRQHV
PX\HVWUXFWXUDGDV
0HMRUFRPSUHQVLyQGHODVGHFLVLRQHV
H &XOWXUD\SROtWLFDVRUJDQL]DFLRQDOHV
I ([SHFWDWLYDV\FRPSRUWDPLHQWRVGHORVFR/RVLQFRQYHQLHQWHVTXHSRGUtDQSUHVHQWDUVH
legas
FXDQGRQRVHWUDEDMDHQHTXLSRVRQ
(O OLGHUD]JR VH FRQYLHUWH HQ XQ WHPD PX\ /DVGHFLVLRQHVSUHPDWXUDV
(OGRPLQLRLQGLYLGXDO
WUDVFHQGHQWHHQODDGPLQLVWUDFLyQ\ODVRUJDQL]DFLRQHVGHKR\\GHOIXWXUR6HSXHGHGHFLUTXH 2WUDVVROXFLRQHVFRQWUDULDV
6ROXFLRQHVSUHFRQFHELGDV
el líder es el facilitador para el buen desempexRGHORVLQGLYLGXRV\ORVJUXSRVGHWUDEDMR(V
PHGLDQWHXQOtGHUIXQFLRQDOTXHORVLQGLYLGXRV Tipos de grupos formales de trabajo
VH FRPXQLFDQ VH HQWUHQDQ DSUHQGHQ HMHFXWDQ Las organizaciones pueden contar con tres tipos
VXVWDUHDVVHPRWLYDQSDUWLFLSDQVHLGHQWL¿FDQ principales de grupos formales de trabajo. Ellos
\HQFRQVHFXHQFLDORJUDQXQPHMRUGHVHPSHxR VRQ ORV JUXSRV HVSHFLDOHV GH WUDEDMR R HTXLSRV
GH SUR\HFWRV ORV FRPLWpV SHUPDQHQWHV \ ORV
global.
FRQVHMRVMXQWDVRFRPLVLRQHV
Si bien los comités pueden generar decisioGrupos y comités
(O JUXSR SXHGH GH¿QLUVH FRPR GRV R PiV SHU- QHVGHPHMRUFDOLGDGHQDOJXQRVFDVRVWDPELpQ
VRQDV TXH LQWHUDFW~DQ HQWUH Vt TXH VH LQÀX\HQ producen acuerdos prematuros y mediocres
PXWXDPHQWH \ TXH WLHQHQ XQD PHWD HQ FRP~Q FUHDQGRXQDUHODFLyQFRVWREHQH¿FLRQHJDWLYD
(QJHQHUDOHQXQDRUJDQL]DFLyQH[LVWHQWUHVWLImportancia de la comunicación
pos de grupos:
)RUPDOHV grupos de mando FRQVWLWXLGRV 6HJ~Q&ODXGH)ODPHQWSRGHPRVFRQVLGHUDUORV
procesos de comunicación como herramientas
por gerentes y subordinados.
)RUPDOHV comités y grupos especiales de VRFLDOHV TXH SHUPLWHQ OD LQWHUDFFLyQ KXPDQD \
trabajo TXH VH IRUPDQ SDUD UHDOL]DU DFWLYL- TXHWLHQHQXQOXJDUUHOHYDQWHHQODDGPLQLVWUDFLyQ GH ODV RUJDQL]DFLRQHV SRUTXH FRQGLFLRQDQ
GDGHVHVSHFt¿FDVGHODRUJDQL]DFLyQ
,QIRUPDOHVTXHQDFHQHQODVRUJDQL]DFLRQHV VXH[LVWHQFLD\H¿FDFLD
8QDEXHQDFRPXQLFDFLyQHVPX\LPSRUWDQsin importar si los gerentes los desean y estite para los gerentes por dos razones. En primer
mulan o si no lo hacen.
OXJDU OD FRPXQLFDFLyQ HV HO SURFHVR PHGLDQWH
76 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
HOTXHVHFXPSOHQODVIXQFLRQHVJHUHQFLDOHVGH
SODQHDPLHQWRRUJDQL]DFLyQGLUHFFLyQ\FRQWURO
(QVHJXQGROXJDUODFRPXQLFDFLyQHVXQDDFWLYLGDGDODTXHORVJHUHQWHVGHGLFDQXQDDEUXPDdora cantidad de su tiempo.
El proceso de comunicación permite a los
JHUHQWHV OOHYDU D FDER ODV WDUHDV GH VX WUDEDMR
/DLQIRUPDFLyQGHEHVHUFRPXQLFDGDDVtFRPR
WDPELpQORVSODQHVODVUHVSRQVDELOLGDGHV\ODV
metas del grupo. Para posibilitar todas estas coPXQLFDFLRQHVH[LVWHQODPDQHUDRUDOODHVFULWD
\HQIRUPDFUHFLHQWHODHOHFWUyQLFD
Comunicación interpersonal
El modelo más simple del proceso de la comuniFDFLyQLQFOX\HXQHPLVRUXQPHQVDMHXQFDQDO
y un receptor. Este modelo indica cuatro elePHQWRVHVHQFLDOHVGHODFRPXQLFDFLyQ\VLIDOWD
DOJXQRGHHOORVQRVHUHDOL]DUi
El cuadro muestra un modelo mucho más
complejo del proceso de la comunicación.
(VDVtTXHSRGHPRVREVHUYDU
(PLVRU IXHQWH HVHOTXHLQLFLDODFRPXQLcación.
&RGL¿FDFLyQ FLIUDGR HVODWUDGXFFLyQHQ
XQDVHULHGHVtPERORVGHODLQIRUPDFLyQTXH
debe transmitirse.
0HQVDMHHVODIRUPDItVLFDHQODTXHHOHPLsor cifra la información.
&DQDOHVHOPpWRGRGHWUDQVPLVLyQGHOPHQsaje de una persona a otra.
5HFHSWRU HV TXLHQ SHUFLEH HO PHQVDMH GHO
emisor.
'HFRGL¿FDFLyQ GHVFLIUDGR HV HO SURFHVR
SRUHOTXHHOUHFHSWRULQWHUSUHWDHOPHQVDMH\
ORWUDGXFHHQLQIRUPDFLyQVLJQL¿FDWLYD
5XLGR HV FXDOTXLHU IDFWRU TXH SHUWXUED R
FRQIXQGHODFRPXQLFDFLyQRLQWHU¿HUHGHDOguna manera con ella.
5HWURDOLPHQWDFLyQ VH SXHGH GDU HQ IRUPD
GLUHFWDFRPRXQDVLPSOHFRQ¿UPDFLyQYHUEDOGHTXHHOPHQVDMHVHKDUHFLELGR$TXtHO
UHFHSWRUVHFRQYLHUWHDVXYH]HQHPLVRU
Nota: 6LQ UHWURDOLPHQWDFLyQ HVWDPRV HQ SUHsencia de un proceso de información y no de
comunicación.
Barreras para una efectiva comunicación
(VIUHFXHQWHHQFRQWUDUP~OWLSOHVIDFWRUHVTXHLQWHUYLHQHQDXQHQODFRPXQLFDFLyQPiVHOHPHQWDO
GHWRGDVDVDEHU
D 3HUFHSFLRQHVGLIHUHQWHVSRUH[SHULHQFLDVDQWHULRUHVHVWDWXVVRFLDOHWF
E 'LIHUHQFLDVGHOHQJXDMH\PDQHUDVGHH[SUHsarse
F 5XLGRV
G (PRWLYLGDGSRUFDXVDGHODSHUVRQDOLGDGGH
los diferentes interlocutores
H &RPXQLFDFLRQHV YHUEDO \ QR YHUEDO LQFRQgruentes
I 'HVFRQ¿DQ]D
J *HVWRVPtPLFDVPLUDGDVHWF
Nota:(QODVRUJDQL]DFLRQHVDVtFRPRHQRWURV
VLVWHPDVVRFLDOHVH[LVWHXQDIXHUWHYLQFXODción entre los fenómenos de comunicación
\ORVGHSRGHUGHWDOPRGRTXHSRUUD]RQHV
~QLFDPHQWH GLGiFWLFDV SXHGHQ MXVWL¿FDU GRV
estudios distintos.
Clasificación de las comunicaciones
/D FRPXQLFDFLyQ SXHGH VHU YHUWLFDO VLJXLHQGR
la dirección establecida por los organigramas.
7DPELpQ SXHGH VHU KRUL]RQWDO FXDQGR KD\ FRQH[LyQHQWUHGLYHUVRVVHFWRUHVGHOPLVPRQLYHO
(QODDFWXDOLGDGSRGHPRVGLVWLQJXLUFRPXQLFDFLRQHVGLDJRQDOHVRLQFOXVRFRQ¿JXUDQGRUHGHV
TXHVHSXHGHQH[SUHVDUPHGLDQWH¿JXUDVJHRPptricas. Cuando la comunicación sigue los cauces
naturales de la organización es formal. Cuando
Transmitir
EMISOR
(fuente)
Recibir
Codificación
Mensaje
Canal
Mensaje
Decodificación
RECEPTOR
Ruido
Retroalimentación
Cuadro 3.7: Comunicación interpersonal y organización
Transmitir
3 - Principios de administración general / 77
ODFRPXQLFDFLyQVHPDQL¿HVWDIXHUDGHODFDGHQD
de mando es informal.
([LVWHRWURWLSRGHFRPXQLFDFLRQHVVHJ~QHO
WLHPSRGHUHVSXHVWDGHTXHVHGLVSRQJDDVtSRGUtDPRVFODVL¿FDUODVHQ
a) Comunicación lateral: se da una orden y se
cumple inmediatamente sin posibilidad de
FRQWUDULDUOD (V EHQH¿FLRVD UHVSXHVWD UiSLGD HIHFWLYD HQ VLWXDFLRQHV GH HPHUJHQFLD
FXDQGR HO WLHPSR GH UHSXHVWD QR SHUPLWH
GLODFLRQHV SRU HMHPSOR XQD VDOD GH JXDUGLDGHXQKRVSLWDODQWHXQDHPHUJHQFLD \HV
SHUMXGLFLDO VL VH LPSOHPHQWD PDO SRUTXH HV
GHVPRWLYDQWHSDUDODVSHUVRQDV
b) Comunicación recíproca:H[LVWHRWURMXHJR
de poder entre los actores y tanto jefe como
VXERUGLQDGRV SXHGHQ UHÀH[LRQDU VREUH OD
GHFLVLyQ WRPDGD (V EHQH¿FLRVD FXDQGR HO
tiempo de respuesta permite recibir otras
RSLQLRQHV\HYHQWXDOPHQWHPRGL¿FDUODGHFLVLyQSURSXHVWDSRUXQHQIRTXHPiVH¿FD]R
H¿FLHQWH(VSHUMXGLFLDOVLHVWDPRVDQWHXQD
situación de emergencia donde no hay tiempo disponible para ningún tipo de análisis.
Ambos tipos de comunicaciones tienen sus
YHQWDMDV\DXQTXHODrecíproca es preferible en
XQSODQRSVLFROyJLFR\RSHUDWLYRHQODPD\RUtD
GHORVFDVRVQRKD\TXHGHVHVWLPDUHOUHFXUVRGH
ODFRPXQLFDFLyQODWHUDOUHVWULQJLGR±FRPR\DVH
H[SUHVDUD±DVLWXDFLRQHVFUtWLFDV
4. El control
SUHYLDPHQWHSDUDGHWHUPLQDUVLKD\GHVYLDFLRQHV \ PHGLU VX LPSRUWDQFLD \ SDUD WRPDU ODV
PHGLGDV WHQGLHQWHV D JDUDQWL]DU TXH WRGRV ORV
recursos de la empresa se utilicen de la forma
PiVH¿FD]\H¿FLHQWHSRVLEOHHQODREWHQFLyQGH
ORVREMHWLYRVRUJDQL]DFLRQDOHV´
Pasos del proceso de control
Se podrían citar los siguientes:
D(VWDEOHFHUPpWRGRV\FULWHULRVSDUDPHGLUHO
desempeño
b. Medir el desempeño
F¢&RUUHVSRQGHHOGHVHPSHxRDORVQLYHOHVHVtablecidos?
G7RPDUPHGLGDVFRUUHFWLYDV\D~QSUHYHQWLYDV
Factores organizacionales que
crean la necesidad del control
a. Los cambios
b. La complejidad
c. Los errores
d. La delegación
Es imprescindible establecer un grado coUUHFWRGHFRQWUROSXHVHOcontrol tiene a menuGR FRQQRWDFLRQHV QHJDWLYDV SRUTXH SDUHFH VHU
una amenaza contra la libertad y la autonomía
SHUVRQDO(QWRQFHVHVQHFHVDULRUHFRQRFHUTXH
XQFRQWUROH[FHVLYRGDxDUiDODRUJDQL]DFLyQ\D
VXVLQWHJUDQWHV/RVFRQWUROHVTXHDEUXPDQDORV
HPSOHDGRVGHVWUX\HQODPRWLYDFLyQLQKLEHQOD
FUHDWLYLGDG \ WHUPLQDQ SHUMXGLFDQGR HO GHVHPpeño organizacional.
$VtSXHVDOHVWDEOHFHUORVFRQWUROHVODWDUHD
GH ORV JHUHQWHV FRQVLVWH HQ HQFRQWUDU HO HTXLOLEULR DSURSLDGR HQWUH HO FRQWURO RUJDQL]DFLRQDO
\ODOLEHUWDGLQGLYLGXDO6LVHHMHUFHXQFRQWURO
H[FHVLYR ODV RUJDQL]DFLRQHV VH FRQYLHUWHQ HQ
OXJDUHV VRIRFDQWHV LQKLELGRUHV H LQVDWLVIDFWRULRV6LHOFRQWUROHVHVFDVRVHYXHOYHQFDyWLFDV
LQH¿FLHQWHVHLQH¿FDFHVSDUDREWHQHUVXVPHWDV
&RPR ODV RUJDQL]DFLRQHV ODV SHUVRQDV ORV
DPELHQWHV\ODWHFQRORJtDFDPELDQVLQFHVDUXQ
EXHQ VLVWHPD GH FRQWURO UHTXLHUH UHYLVLRQHV \
PRGL¿FDFLRQHVSHULyGLFDV
Ésta es la cuarta y última función de la adminisWUDFLyQGHQWURGHODHVWUXFWXUDEiVLFDSURSXHVWD
Se trata del control. No se concibe una buena
DGPLQLVWUDFLyQVLQXQFRQWUROH¿FD]/DFRPELQDFLyQGHREMHWLYRVELHQSODQHDGRVXQDRUJDQL]DFLyQ¿UPHXQDGLUHFFLyQFDSD]\IXHUWHPRWLYDFLyQWHQGUiQSRFDVSUREDELOLGDGHVGHp[LWRVL
no hay un sistema adecuado de control.
6LJXLHQGR D 'DIW0DUFLF XQD EXHQD GH¿nición de control gerencial es: “el proceso sisWHPiWLFR D WUDYpV GHO FXDO ORV DGPLQLVWUDGRUHV
UHJXODQ ODV DFWLYLGDGHV RUJDQL]DFLRQDOHV SDUD
KDFHUODV FRQVLVWHQWHV FRQ ODV H[SHFWDWLYDV HVWDEOHFLGDVHQORVSODQHVPHWDV\HVWiQGDUHVGH
GHVHPSHxR´
Tipos de métodos de control
6LJXLHQGR D 5REHUW 0RFNOHU ³HO FRQWURO 6LJXLHQGR D 'DUW0DUFLF ORV WLSRV GH FRQWURO
DGPLQLVWUDWLYRHVXQHVIXHU]RVLVWHPiWLFRSDUD pueden ser
¿MDU QLYHOHV GH GHVHPSHxR FRQ REMHWLYRV GH a. Preventivo: HV HO TXH VH FRQFHQWUD HQ ORV
SODQHDFLyQSDUDGLVHxDUORVVLVWHPDVGHUHWURDUHFXUVRVKXPDQRVPDWHULDOHV\¿QDQFLHURV
OLPHQWDFLyQGHODLQIRUPDFLyQSDUDFRPSDUDUHO
7DPELpQ UHFLEH HO QRPEUH GH FRQWURO preliGHVHPSHxR UHDO FRQ HVRV QLYHOHV GHWHUPLQDGRV
minar.
78 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
b. Control concurrente:HVHOTXHSHUPLWHYLJLlar a la organización durante la realización de
ORV SURFHVRV SDUD DVHJXUDUVH TXH VHDQ FRQsistentes con el estándar de cumplimiento de
dichos procesos.
c. Controles de retroalimentación:VRQORVTXHVH
realizan posteriormente al resultado de la acción. Si los procesos tienen tiempo de ciclos
EUHYHV ODV FRUUHFFLRQHV VRQ FDVL LQPHGLDWDV
\ VH HYLWDQ ODV FRQVHFXHQFLDV VHFXQGDULDV LQGHVHDEOHV8QHMHPSORGHHVWHWLSRGHFRQWURO
SXHGHVHUDWUDYpVGHLQIRUPDFLyQ¿QDQFLHUDHV
GHFLUTXHRSHUDFRQHOFRQWUROSUHVXSXHVWDULR
Puntos estratégicos de control
$GHPiVGHODViUHDVEiVLFDVGHGHVHPSHxRHV
importante determinar los puntos críticos del
sistema donde se realizará el monitoreo o se recogerá información. Si tales puntos estratégicos
GH FRQWURO SXHGHQ ORFDOL]DUVH VH UHGXFLUi GH
manera considerable la cantidad de información
TXHHVSUHFLVRUHXQLU\RHYDOXDU(OPpWRGRPiV
útil para seleccionar los puntos estratégicos de
control consiste en centrarse en los elementos
más importantes de una operación determinada.
Características de los
sistemas eficaces de control
/RV VLVWHPDV FRQ¿DEOHV \ H¿FDFHV GH FRQWURO
presentan ciertas características comunes. Ellas
son:
3UHFLVLyQ
2SRUWXQLGDG
2EMHWLYLGDG\WRWDOLGDG
&HQWUDOL]DFLyQ HQ SXQWRV HVWUDWpJLFRV GH
control
(FRQyPLFDPHQWHUHDOLVWD
2UJDQL]DFLRQDOPHQWHUHDOLVWD
&RRUGLQDFLyQ FRQ HO ÀXMR GH WUDEDMR GH OD
organización
)OH[LEOH
3UHVFULSWLYR\RSHUDFLRQDO
$FHSWDEOHSDUDWRGRVORVPLHPEURVGHODRUganización
Controles financieros
([LVWHQ YDULRV PpWRGRV ¿QDQFLHURV GH FRQWURO
TXHSXHGHQXVDUORVJHUHQWHV(MHPSORGHHOORV
SRGUtDQ VHU ORV SUHVXSXHVWRV \D PHQFLRQDGRV
ORV HVWDGRV ¿QDQFLHURV HO DQiOLVLV GH ODV UD]RQHVHODQiOLVLVGHOSXQWRGHHTXLOLEULR\ODVDXditorías.
Información y control
$SDUWHGHODtQWLPDUHODFLyQTXHWLHQHHOFRQWURO
FRQ HO SODQHDPLHQWR VXUJH WDPELpQ XQD QXHYD
UHODFLyQ GH LQVHSDUDELOLGDG TXH HV OD TXH SUHsenta el control con la información. Sin la inIRUPDFLyQQRKD\FRQWURO\DTXHHOFRQWUROVH
DEDVWHFH GH HOOD 3RU RWUD SDUWH ORV UHVXOWDGRV
del control deberán ser informados a todas las
áreas de la organización.
Es imprescindible generar un sistema de inIRUPDFLyQTXHÀX\DDORODUJRGHODRUJDQL]Dción. En este sistema de información se regisWUDUiQDOPDFHQDUiQUHODFLRQDUiQ\FRPSRQGUiQ
ODVGLVWLQWDVYDULDEOHVTXHH[SUHVHQHOGHVHPSHxRGHODHPSUHVDSDUDHPLWLUUHVXOWDGRVVLJQL¿FDWLYRVSDUDODWRPDGHGHFLVLRQHV
/RVVLVWHPDVGHLQIRUPDFLyQDTXtPHQFLRQDGRVVHYHQFDGDYH]PiVLQÀXHQFLDGRVSRUORV
DYDQFHVGHODWHFQRORJtD
)LQDOPHQWHHOPiVQXHYRGHORVFRQWUROHVHOTXH
SURYLHQHGHOD$GPLQLVWUDFLyQGHOD&DOLGDG7RWDO
Se trata de un esfuerzo para impulsar la caOLGDGHQWRGDODRUJDQL]DFLyQDWUDYpVGHODPHMRUD FRQWLQXD 6H YROYLy DWUDFWLYD HQ OD GpFDGD
GHOHQORV((88SRUODH[SHULHQFLDH[LWRVD
GHODVFRPSDxtDVMDSRQHVDVTXHREWHQtDQPD\RU
participación de mercado junto con la imagen
internacional de una alta calidad.
(VWH HQIRTXH VH OOHYy D FDER D WUDYpV GH ORV
FtUFXORV GH FDOLGDG HO benchmarking –proceso de
FRPSDUDFLyQ FRQ ORV SURGXFWRV R VHUYLFLRV GH ORV
mejores competidores del mercado para luego adapWDUORVDODRUJDQL]DFLyQ±HOsix sigma±TXHHQIDWL]D
XQDE~VTXHGDLQFHVDQWHGHXQDPHMRUFDOLGDGDOPiV
bajo costo– y la mejora continua ±TXHFRQVLVWHHQOD
LPSOHPHQWDFLyQGHJUDQFDQWLGDGSHTXHxDVPHMRUDV
HQWRGDODRUJDQL]DFLyQDODTXHFRQWULEX\HQODVSHUsonas en su propio lugar de trabajo.
7RGR HVWH HQIRTXH SRGUtD FXOPLQDU FRQ ORV
(VWiQGDUHV,QWHUQDFLRQDOHVGHOD&DOLGDGDWUDYpV GH 1RUPDV ,QWHUQDFLRQDOHV FRPR ODV ,62
HVWDEOHFLGR SRU ODInternacional Organization for Standarization HQ VX H[SUHVLyQ HQ
LQJOpV GHVGH \ FX\D ~OWLPD YHUVLyQ D~Q
YLJHQWHHQVHUHDOL]yHQHODxRH[FHSWROD,62GHUHFLHQWHDSDULFLyQ
(VGHFLUTXHDGHPiVGHODVKHUUDPLHQWDVWUDGLFLRQDOHV FRQWDPRV FRQ QXHYDV KHUUDPLHQWDV
FRPR ODV UHIHULGDV QRUPDV TXH WLHQHQ FDUiFWHU
XQLYHUVDO HV GHFLU QR H[LVWHQ RWUDV QRUPDV GH
PD\RUMHUDUTXtD\VXGHVDUUROORTXHGDIXHUDGHO
marco de análisis del presente capítulo.
4
FUNDAMENTOS DE ESTRUCTURA
Y DISEÑO ORGANIZACIONALES
TRASFONDO: UN OCÉANO DE ORGANIZACIONES
1XHVWUDYLGDFRWLGLDQDJLUDHQWRUQRDODVRUJDQLzaciones. Si bien en ocasiones su estatus ontolóJLFRHVYDJR\DEVWUDFWR±GHKHFKRSXHGHHVWDU
GLVSHUVR HQ GLIHUHQWHV XQLGDGHV ItVLFDV± QDGLH
SXHGH GXGDU GH VX H[LVWHQFLD HQ YLUWXG GH VXV
ORJURVRSURGXFWRV±HGL¿FLRVFDPLQRVFLUXJtDV
FDUGLRYDVFXODUHV YLDMHV DpUHRV R HVSDFLDOHV± \
GHODLQPHGLDWH]LQWXLWLYDFRQTXHVHDSDUHFHD
QXHVWUD H[SHULHQFLD ±WRGRV VDEHPRV OR TXH HV
WUDEDMDURHVWDUHQXQDRUJDQL]DFLyQ1RH[LVWH
prácticamente ningún aspecto del discurrir diario por fuera de ellas y hasta la noción misma
GHVRFLHGDGPRGHUQDVHEDVDHQHOKHFKRGHTXH
ORVLQGLYLGXRVWUDEDMDQ\FRRSHUDQHQFRQMXQWR
SDUDUHDOL]DUWDUHDVTXHVRQLPSRVLEOHVHQHOQLYHOLQGLYLGXDO7RGDVODVVRFLHGDGHVDWUDYpVGH
ORVWLHPSRVDFDEDQSRUFUHDU±DOGHFLUGH0DOLQRYVN\±DTXHOODVRUJDQL]DFLRQHV\HVWUXFWXUDV
necesarias para su funcionamiento.
8QD GH¿QLFLyQ VLPSOH GH RUJDQL]DFLyQ GLFH
TXH pVWD HV OD IRUPD HVWUXFWXUDGD GH UHJXODU HQ
XQJUXSRGHSHUVRQDVODVUHODFLRQHVGHSRGHUHQWHQGLGDVFRPRODKDELOLGDGSDUDKDFHUSUHYDOHFHU
ODSURSLDYROXQWDGFRQWUDODVUHVLVWHQFLDVGHVXV
PLHPEURVSDUDPHGLDQWHXQDFLHUWDFRQÀXHQFLD
GHLQWHUHVHVFRQVHJXLUHO¿QLQVWLWXFLRQDO6LELHQ
HO LQWHUpV SRU ODV RUJDQL]DFLRQHV HV VHPSLWHUQR
HOLQWHUpVHVSHFt¿FDPHQWHFLHQWt¿FRGDWDGHODVHJXQGDPLWDGGHOVLJOR;;WUDWDQGRGHGHOLPLWDU
TXpWHQtDQHQFRP~QPiVTXHTXpODVGLIHUHQFLD-
ED8QDGH¿QLFLyQPiVIRUPDO\FRPSOHWDHVTXH
se trata de sistemas sociotécnicos formados por
SHUVRQDV FRQ XQD HVWUXFWXUD GHOLEHUDGD OtPLWHV
SUHFLVRVTXHWLHQGHQDXQ¿Q
El hecho de estar formadas por personas no
HVPHQRU\DTXHHQ~OWLPDLQVWDQFLDHOp[LWRGH
FXDOTXLHUHPSUHVD KRVSLWDOHV\HPSUHVDVGHVDOXGLQFOXLGRV UDGLFDHQODFDSDFLGDGSDUDDWUDHU
PRWLYDU\UHWHQHUDODVSHUVRQDVDGHFXDGDV retention management RFRPRH[SUHVDHOFtQLFRGHFLU
de la tira cómica Dillbert³¢&UHHTXHVXHPSUHVD
GLVSRQGUiGHHPSOHDGRVGHRWUDFDOLGDGTXHORV
TXHHVWpGLVSXHVWRDSDJDU"´1RREVWDQWHHVWR
PXFKDVSHUVRQDVVLHQWHQTXHDO¿QDOGHOFDPLQR
ODVRUJDQL]DFLRQHVVHKDQOOHYDGRORPHMRUGHVX
YLGDVLQGDUOHVGHPDVLDGRDFDPELR1RHQRWURV
WpUPLQRV VLHPSUH TXHGDURQ FXHQWDV LPSDJDV
1LQJXQD HPSUHVD FRQWUDWD D XQ LQGLYLGXR SDUD
VDWLVIDFHUORVREMHWLYRVGHOLQGLYLGXRDODRUJDnización empresa la guía un único y egocéntrico
REMHWLYRUHQWDELOLGDG\FUHFLPLHQWRFRQWLQXR(O
LQGLYLGXRSRUVXSDUWHLQJUHVDFRQVXVSURSLRV
REMHWLYRV\pVWRVVRQSRUORJHQHUDOGLIHUHQWHVD
ORVGHODHPSUHVDWDPSRFRDOLQGLYLGXROHLQWHUHVDSRUORPHQRVDOSULQFLSLRHOREMHWLYRGHUHQWDbilidad y crecimiento continuo de la organización.
4XL]iVXFHGDPiVDGHODQWHRQXQFDWHQLHQGRpO
LQWHUHVHVPiVSURVDLFRVVHJXULGDGFUHFLPLHQWR
UHDOL]DFLyQ GLQHUR 6H WUDWD HQ WRGR FDVR GH XQ
PDWULPRQLRGHFRQYHQLHQFLDRGHXQDVXHUWHGH
FRQWUDWR SVLFROyJLFR 1RUPDOPHQWH FXDQGR OD
SHUVRQDHVUHFOXWDGDSRUXQDHPSUHVDHVVHOHF-
«QRLPSRUWDORTXHVHKDJD«VLHPSUHVHWHQGUiODVHQVDFLyQGHTXHDO¿QGHFXHQWDVODRUJDQL]DFLyQORGHVLOXsionó…
1
80 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
FLRQDGDHQIXQFLyQGHVXVDSWLWXGHVFDSDFLGDGHV
HWFpWHUD&DGDXQRGHHVWRVLQGLYLGXRVWLHQHVXV
SURSLDVH[SHFWDWLYDVSHUVRQDOHV\ODRUJDQL]DFLyQ
SRVHH RWUDV WDQWDV TXH GHEHQ DFRUGDUVH $ HVWD
combinación se la llama contrato psicológico
SRUTXHQRVHFRUUHVSRQGHFRQHOFRQWUDWRIRUPDO
HVFULWR(VPiVSUHFLVDPHQWHXQDFXHUGRLPSOtFLWRHQWUHODVSDUWHVSDUDTXHWDQWRHOWUDEDMDGRU
como la organización logren sus metas.
Contrato psicológico
(VWH FRQWUDWR FRQVLVWH EiVLFDPHQWH HQ TXH OD
HPSUHVDWLHQHTXHUHPXQHUDUGDUOHVHJXULGDG\
XQSXHVWRGHWUDEDMRDOHPSOHDGRPLHQWUDVTXH
él debe desempeñar sus tareas. Como la motiYDFLyQGHODSHUVRQDWLHQHTXHYHUFRQHOHIHFWR
GHHVWDUHODFLyQFRQWUDFWXDOHVHVHQFLDOTXHVH
FRQR]FDQODVH[SHFWDWLYDVGHXQR\GHRWUR(O
FRQWUDWRDGHPiVWLHQHTXHVHUGLQiPLFR\DTXH
ODVH[SHFWDWLYDVGHORVHPSOHDGRVYDQYDULDQGR
con el tiempo. La complejidad y la operatoria
GH OD HVWUXFWXUD GH QHFHVLGDGHV GH ORV LQGLYLGXRVKDFHQTXHHVHDFXHUGRWHQJDTXHUHQRYDUVH
FRQVWDQWHPHQWH\QRVRODPHQWHGHXQODGRWDPELpQODVHPSUHVDVYDQFDPELDQGRVXVH[SHFWDWLYDVFRQUHVSHFWRDVXVHPSOHDGRVHQIXQFLyQGH
las necesidades organizacionales. “Llegar a un
DFXHUGR´VLJQL¿FDTXHVHQHJRFLDQ\FXHVWLRQDQ
ODVH[SHFWDWLYDVGHPDQHUDSHUPDQHQWH(VSUHFLVRWHQHUHQFXHQWDTXHPXFKDVYHFHVDOJXQRV
RWURVIDFWRUHVVRQORVTXHHVWiQLQÀX\HQGRHQOD
situación en estudio entre el trabajador y la orJDQL]DFLyQ7DQWRXQRFRPRRWUDVHHQFXHQWUDQ
HQXQFRQWH[WRHQXQSDtVTXHSRVHHFXOWXUDYDORUHVFRVWXPEUHVSURSLDVXQDVLWXDFLyQVRFLDO\
HFRQyPLFDGHWHUPLQDGDTXHVHSRQHQHQMXHJR
FXDQGRHVSUHFLVRHVWXGLDUODPRWLYDFLyQ(ODGPLQLVWUDGRUHQFRQVHFXHQFLDQRSXHGHGHMDUGH
FRQWHPSODU HVWDV YDULDEOHV FXDQGR UHVXHOYH GH
TXpIRUPDGHVHPSHxDUVHSDUDPRWLYDU\DGPLQLVWUDUDVXJHQWH$VtFRPRFDGDLQGLYLGXRWLHQH
VXSHUVRQDOLGDGFDGDHPSUHVDSRVHHODVX\DVX
FXOWXUD\FDGDSDtVDVXYH]VXSURSLDFXOWXUD\
FDUDFWHUtVWLFDV /DV WHRUtDV VREUH OD PRWLYDFLyQ
no son aplicables sin adecuarlas a estas particuODULGDGHVUHDOHV3DUDHODQiOLVLVGHODPRWLYDFLyQ
GH ODV SHUVRQDV HQ HO WUDEDMR HV SUHFLVR WHQHU
SUHVHQWHTXHLQWHUDFW~DQODVFDUDFWHUtVWLFDVSDUWLFXODUHVGHODSHUVRQD\VXHQWRUQRIRUPDGRSRU
ODHPSUHVD\HOSDtV/DFXOWXUDDUJHQWLQDGHQWUR
GHXQFRQWH[WRRFFLGHQWDOQRVHFDUDFWHUL]DSRU
tender al trabajo grupal y a la toma de decisiones
SRUFRQVHQVR(OLQFHQWLYRTXHVHSURSRQJDHQ
XQDFXOWXUDGHHVWDVFDUDFWHUtVWLFDVTXHEXVTXH
TXHORVLQGLYLGXRVWUDEDMHQHQJUXSRWHQGUiTXH
FRQWHPSODUHVWHKHFKRSDUDHODERUDULQFHQWLYRV
WDQFUHDWLYRVTXHPXHYDQDODSHUVRQDDDFWXDU
de esa manera.
¿Cuáles son las necesidades inmediatas a saWLVIDFHU"6HJ~Q$EUDKDP0DVORZVHSXHGHQRUganizar en una pirámide de prioridades (véase en
otra parte de esta obra)0DVORZSRVWXODEDTXH
ODVSULPHUDVTXHXQDSHUVRQDGHPDQGDVDWLVIDFHUVRQODV¿VLROyJLFDV8QDYH]TXHVHKDGDGR
FXPSOLPLHQWRDHOODVVHQWLUiRWUDVQHFHVLGDGHV
GHVHJXULGDGTXHVRQVXSHULRUHVDODVTXHVHJXLUiQODVVRFLDOHV\VXFHVLYDPHQWHODVGHHVWLPD\
DXWRUUHDOL]DFLyQ(VSUHFLVRDFODUDUTXHODVDWLVIDFFLyQGHFDGDXQRGHORVQLYHOHVQRVHHQFXHQWUDFRPSOHWDHQHOPRPHQWRHQTXHFRPLHQ]DQD
surgir las necesidades del inmediato superior. La
H[SOLFDFLyQGHODVQHFHVLGDGHVQRVHDJRWDVLPSOHPHQWH HQXQFLDQGR TXH D WRGDV ODV SHUVRQDV
OHVFRUUHVSRQGHHVWDMHUDUTXtDRXELFDQGRHQTXp
QLYHOGHODSLUiPLGHVHHQFXHQWUDQ$OJXQDVYHFHVORVLQGLYLGXRVUHFRUUHQHVWRVHVWUDWRVFRQXQ
orden distinto a pesar de no haber satisfecho por
completo las necesidades básicas. Esto último
QR RFXUUH VyOR HQ FDVRV DLVODGRV \ DVt OD SLUiPLGHGH0DVORZHVXQDKHUUDPLHQWD~WLOSHURQR
VX¿FLHQWHSDUDDJRWDUODH[SOLFDFLyQGHODPRWLYDFLyQ KXPDQD (más y mejor sobre incentivos,
en el capítulo sobre gestión de RRHH).
$OJXQDVYHFHV\DODOX]GHODUD]yQQRSRGHPRVH[SOLFDUQRVSRUTXpXQLQGLYLGXRQRDFHSWDDGTXLULUPiVUHVSRQVDELOLGDGHVHQXQSXHVWR
QXHYRGHWUDEDMRTXHOREHQH¿FLDUtDFRQXQDXPHQWRGHVDODULRRSRUTXpDOJ~QRWURHPSOHDGR
SUH¿HUHTXHGDUVHHQXQDHPSUHVDGRQGHJDQDXQ
VXHOGRPHQRUTXHHQRWUD\DVHDSDUDQRSHUGHU
su entorno cómodo de camaradería o por miedo
a cambiar y perder una estabilidad o seguridad a
IXWXURGHLQJUHVRV2WUDVYHFHVXQDSHUVRQDSUH¿HUH QR FDPELDU GH HPSUHVD SRUTXH OD FXOWXUD
de esta organización la hace sentir bien. No poGHPRVJHQHUDOL]DU\GHFLUTXHVLHPSUHHOGLQHUR
VLUYHSDUDH[SOLFDURSUHGHFLUWRGDVODVHOHFFLRnes de las personas. La relación de cada uno con
HOGLQHURXRWURREMHWLYRHVGLYHUVD\ODPRWLYDción por satisfacer las necesidades no tiene un
RUGHQ¿MRSDUDWRGRVORVVHUHVKXPDQRV
6HJ~Q0F*UHJRUODDFWLWXGTXHPDQL¿HVWDQ
ORVJHUHQWHVKDFLDORVHPSOHDGRVHVORTXHGHWHUPLQDODPDQHUDHQODTXHHVWDEOHFHQFyPRPRWLYDUORV(VWDDFWLWXGRPDQHUDGHSHQVDUDFHUFDGH
4 - Fundamentos de estructura y diseño organizacionales / 81
los empleados se separa en dos teorías básicas:
;H<$TXpOORVTXHSLHQVDQTXHORVLQGLYLGXRV
tienden a buscar hacer el menor esfuerzo posiEOHHQHOWUDEDMRREWHQHUODPD\RUUHPXQHUDFLyQ
SRVLEOHHVSHUDQDSHUFLELPLHQWRVRFDVWLJRVSDUD
LQFUHPHQWDUODSURGXFWLYLGDG\HQFRQVHFXHQFLD
GHEHQVHUFRQWURODGRVGHFHUFDVRQORVTXHHVWiQ
VLJXLHQGRODWHRUtD;(QFDPELRDTXpOORVTXH
WLHQHQXQDSUHGLVSRVLFLyQDSHQVDUTXHORVLQGLYLGXRVHVWiQPRWLYDGRVSDUDPHMRUDUVXWUDEDMR
SRU Vt PLVPRV WUDWDQ GH DXPHQWDU OD SURGXFWLYLGDGPXFKDVYHFHVVLQLQFHQWLYRVHFRQyPLFRV
HVSHFt¿FRV\QRSUHFLVDQXQFRQWUROHVWUHFKRGH
ODWDUHDTXHUHDOL]DQSHUWHQHFHQDODWHRUtD<
Postulados de la teoría X
Para casi todas las personas el trabajo es desagradable.
- La mayoría de la gente carece de ambiciones
\SUH¿HUHQRDGTXLULUUHVSRQVDELOLGDGHV
/DPD\RUtDGHODVSHUVRQDVQRWLHQHFUHDWLYLdad para hacer sus tareas.
6yORVHORVSXHGHPRWLYDUSDUDVDWLVIDFHUODV
QHFHVLGDGHV¿VLROyJLFDV\GHVHJXULGDG
- La mayoría debe ser controlada estrechamente.
Postulados de la teoría Y
/DVSHUVRQDVGHQWURGHXQDRUJDQL]DFLyQSXHGHQUHVROYHUHOWUDEDMRFRQFUHDWLYLGDG
0XFKDVYHFHVVHFRQWURODQDVtPLVPRV
/DPRWLYDFLyQSXHGHGLULJLUVHDODVQHFHVLGDGHVPiVDOWDV\QRVRODPHQWHDODV¿VLROyJLcas o de seguridad.
- A la mayoría de las personas le gusta trabajar
\HVWiPRWLYDGDSDUDKDFHUVXWDUHDFDGDYH]
mejor.
/DVGL¿FXOWDGHVTXHSODQWHDEDQODVWHRUtDVGH
0F*UHJRUWLHQHQTXHYHUFRQTXHVRODPHQWHVH
HVSHFL¿FDED OD DFWLWXG GHO DGPLQLVWUDGRU KDFLD
ORVHPSOHDGRV\DHOORHVSUHFLVRLQFRUSRUDUOH
otros aspectos relacionados con una situación
HVSHFt¿FDWRPDGDFRPRHVSDFLRGHYDULDEOHVTXH
GHEHQVHUDUWLFXODGDV6LODWDUHDSRUHMHPSORHV
de por sí rutinaria y los empleados en su mayoría
WLHQHQODVQHFHVLGDGHVSULPHUDVLQVDWLVIHFKDVHV
PX\SUREDEOHTXHVHJ~QORVSULQFLSLRVGHODWHRUtD;VHDSUHFLVRDGPLQLVWUDUFRQXQDGLUHFFLyQ
¿UPH \ DXWRULWDULD FRQ XQD PRWLYDFLyQ EDVDGD
HQLQFHQWLYRVPRQHWDULRV&XDQGRDOJXQRGHHV
Más tarde se agregó en su obra la teoría Z.
WRVIDFWRUHVFDPELHHVSRVLEOHTXHVHDQHFHVDULR
analizar otra manera de dirigir a los empleados
SDUDTXHSXHGDQPHMRUDUVXWDUHDFRQXQDFXRWD
GHFUHDWLYLGDGSHUVRQDORODLPSOHPHQWDFLyQGH
RWURVLQFHQWLYRV
(O LQYHVWLJDGRU GH +DUYDUG &KULV $UJ\ULV
±PX\ FLWDGR HQ HVWH WH[WR HQ GLIHUHQWHV WHPDV
\D TXH VX REUD DEDUFD PXFKRV DVSHFWRV GH OD
GLQiPLFD\FRPSRUWDPLHQWRRUJDQL]DFLRQDOHV±
cuyos primeros trabajos fueron publicados en
ORVFRPHQ]ySRULGHQWL¿FDUGRVWLSRVGHLQGLYLGXR ORV LQPDGXURV \ ORV PDGXURV 6HxDOy
las características de las personas inmaduras:
SDVLYLGDGGHSHQGHQFLDSRFDVPDQHUDVGHFRPSRUWDUVH GH REMHWLYRV VXSHU¿FLDOHV \ SHUVSHFWLYDV D FRUWR SOD]R EXVFDQ RFXSDU SRVLFLRQHV
de subordinación y poseen poca conciencia del
\R 3RU HO FRQWUDULR ODV PDGXUDV VRQ DFWLYDV
LQGHSHQGLHQWHV FDSDFHV GH GHVSOHJDU PXFKRV
FRPSRUWDPLHQWRV WLHQHQ REMHWLYRV SUHFLVRV \
SHUVSHFWLYDVDODUJRSOD]REXVFDQSRVLFLRQHVGH
igualdad o superioridad y poseen conciencia y
FRQWUROGHO\R$UJ\ULVSRVWXOyTXHODRUJDQL]DFLyQIRUPDOGHODVHPSUHVDVTXHWLHQGHDODHVSHFLDOL]DFLyQHQODWDUHDXQOLGHUD]JRPiVDXWRULWDULR \ FRQWUROHV HVWULFWRV OOHYD QRUPDOPHQWH
DTXHORVHPSOHDGRVQRHYROXFLRQHQ\WLHQGDQD
mantener las características propias de un indiYLGXRLQPDGXUR
4XL]iVODLGHDPiVDSURSLDGDVHDTXHHOWUDEDMRWLHQHTXHVHUVLJQL¿FDWLYR\SDUDTXHHOOR
VHSURGX]FDHOHPSOHDGRWLHQHTXHSHUFLELUTXH
SDUWLFLSDHQODLGHQWL¿FDFLyQ\ODUHVROXFLyQGH
ORVSUREOHPDV\SXHGHDGHPiVLQWHUYHQLUHQOD
RUJDQL]DFLyQSODQL¿FDFLyQ\FRQWUROGHVXDFWLYLGDGDVtVHVHQWLUiPRWLYDGRSHUFLELUiVXVSURSLRVORJURV\ODHPSUHVDDOFDQ]DUiVXVREMHWLYRV
(V QHFHVDULR DFODUDU TXH QR SXHGH DVHJXUDUVH
TXHHQWRGRVORVFDVRVORVHPSOHDGRVDTXLHQHV
VHPRWLYDSDUDTXHDGTXLHUDQPiVUHVSRQVDELOLGDGHVDFHSWHQHOWHPDVHVLHQWDQDJXVWR\GHVempeñen sus funciones participando más en las
GHFLVLRQHVTXHDWDxHQDVXWDUHD
Retomando la categorización de las neceVLGDGHV GH 0DVORZ )UHGHULFN +HU]EHUJ SVLFyORJR \ FRQVXOWRU HVWDGRXQLGHQVH HIHFWXy LQYHVWLJDFLRQHVSDUDHVWXGLDUODPRWLYDFLyQHQHO
WUDEDMR6XDSRUWHFRQVLVWLyHQVHSDUDUDTXHOORV
IDFWRUHVDPELHQWDOHVRFRQGLFLRQHVODERUDOHVGH
DTXHOORVRWURVIDFWRUHVTXHSRGtDQPRWLYDUDORV
82 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
LQGLYLGXRV$ORVSULPHURVORVGHQRPLQyIDFWRUHVGHKLJLHQHRKLJLpQLFRV\DTXHHUDQLPSRUWDQWHVSDUDTXHODSHUVRQDQRWUDEDMDUDLQVDWLVIHFKDSHURQRVHUYtDQSDUDPRWLYDUODDPHMRUDUVX
desempeño. El término factores higiénicos proYLHQHGHXQDDQDORJtDFRQODPHGLFLQDHQGRQGH
XQDEXHQDKLJLHQHSUHYLHQHHQIHUPHGDGHVSHUR
normalmente no mejora la salud. Herzberg estaEOHFLyDVtTXHVRQORVIDFWRUHVPRWLYDGRUHVORV
TXHKDFHQTXHHOLQGLYLGXREXVTXHSURGXFLUPiV
RLQYROXFUDUVHHQPD\RUPHGLGDFRQHOWUDEDMR
/D QDWXUDOH]D KXPDQD HV WDQ FRPSOHMD TXH
QRVRODPHQWHLQWHUYLHQHQODVQHFHVLGDGHV\PRWLYDFLRQHVHQHODQiOLVLVVLQRTXHWDPELpQKD\
TXH WHQHU HQ FXHQWD RWUDV FLUFXQVWDQFLDV FRPR
ODVH[SHULHQFLDVTXHWXYRHOLQGLYLGXRDORODUJR
GHVXYLGDVXVH[SHFWDWLYDV\ODHGDGTXHWLHQH
Este modelo tan actual e integral es sin embargo
bastante complicado de aplicar. Es más simple
FRQVLGHUDUTXpWLSRGHLQFHQWLYRVRPRWLYDGRUHV
son los adecuados para un conjunto de personas
TXHHVWpQHQHOPLVPRQLYHOGHODSLUiPLGHGH
0DVORZ SRU HMHPSOR \ JHQHUDOL]DUOR D WRGRV
ellos por igual sin distinciones. Es preciso tener
HQFXHQWDRWUDVYDULDEOHVFRPRODVH[SHFWDWLYDV
GHFDGDXQRSDUDTXHUHDOPHQWHVHDQHIHFWLYRV
ORV PRWLYDGRUHV (V LQGLVSHQVDEOH SRU HOOR KDFHUDOJXQDVYHFHVXQDHQFXHVWDDORVLQGLYLGXRV
y contemplar la circunstancia en particular de
cada uno. Esto implica elaborar un buen diagnóstico del caso y ser sensible a las diferencias
LQGLYLGXDOHVVHJ~QVXVSDUWLFXODULGDGHV
En la conocida obra de Arthur Miller Death of
a Salesman La muerte de un viajante VHWUDWDOD
WUiJLFDYLGDGH:LOO\/RPDQYLDMDQWHGHFRPHUFLRSRUDxRVGHODFDVD:DJQHU$ORVVHVHQWD
DxRV VLHQWH TXH OD YLGD GH ORV FDPLQRV HV PXcho para él. Después de numerosas dudas decide
VROLFLWDU XQ SXHVWR HQ OD FDVD FHQWUDO HQ 1XHYD
<RUN/DIDPLOLD\DVHKDHPDQFLSDGR\VXVSURpias necesidades económicas son modestas. ConItD HQ TXH OD :DJQHU HQFRQWUDUi XQ KXHFR SDUD
pO$OVXUJLUODFXHVWLyQFRQ+RZDUG:DJQHUKLMR
GHOIXQGDGRUGHODHPSUHVDVLQHPEDUJR:LOO\
HVUXGDPHQWHWUDWDGR+RZDUGWLHQHSRFRWLHPSR
SDUDDWHQGHUHOGHOLFDGRDVXQWRGH:LOO\:LOO\OH
UHFXHUGDHOWLHPSRTXHOOHYDGHGLFDGRDOD¿UPD
FACTORES
DE HIGIENE-MOTIVACIÓN
DE HERZBERG
Necesidades
de
autorrealización
Motivacionales
JERARQUÍA
DE NECESIDADES
DE MASLOW
Necesidades
de ego
(autoestima)
Realización
Reconocimiento
Estatus
Relaciones interpersonales
Supervisión
Colegas y subordinadas
Higiénicos
Necesidades
sociales
Necesidades
de seguridad
El trabajo en sí
Responsabilidad
Progreso
Crecimiento
Necesidades
fisiológicas
Cuadro 4.1: Comparación entre las ideas de Maslow y las de Herzberg
Supervisión técnica
Políticas administrativas
y empresariales
Estabilidad en el cargo
Condiciones físicas
de trabajo
Salario
Vida personal
4 - Fundamentos de estructura y diseño organizacionales / 83
VXFHUUDGDDVRFLDFLyQFRQHOSDGUHGH+RZDUG\
ODVSURPHVDVTXHOHIXHURQKHFKDVSHURQDGDGH
HVWRKDFHHIHFWRHQ+RZDUG(QHOODSVRGHXQRV
pocos minutos y en una atmósfera de alta fuerza
GUDPiWLFD /RPDQ VH HQFRQWUDUi VXJLULHQGR TXH
VXVXHOGRSRGUtDUHGXFLUVH\DTXHVXVQHFHVLGDGHV
VHFXEUHQFRQSRFR+RZDUGHVWiLQFyPRGRFRQ
ODVV~SOLFDVGH/RPDQ\GHVSXpVGHYDULRVLQWHQWRVGHTXHUHUWHUPLQDUDFDEDFDWHJyULFDPHQWHOD
FRQYHUVDFLyQ GLFLpQGROH D :LOO\ TXH OD :DJQHU
\D QR QHFHVLWD PiV GH pO \ OR GHVSLGH /RPDQ
está hecho añicos. Se siente como una cáscara de
QDUDQMDYDFtD/DFRPSDxtDVHKDcomido treinta
\FXDWURDxRVGHVXYLGDFRPRVLKXELHUDVLGRXQD
QDUDQMD\DKRUDWLUDODFiVFDUDDOFDPLQR/RPDQ
acaba suicidándose.
La obra de Miller presenta una metáfora soEUHODIRUPDHQTXHODVRUJDQL]DFLRQHVDPHQXGR
FRQVXPHQ\H[SORWDQDVXVHPSOHDGRVWRPDQGR
\XWLOL]DQGRORTXHQHFHVLWDQGHHOORV\DUURMDQGR
IXHUDHOUHVWR3RUVXSXHVWRTXHKD\DOJXQDVH[FHSFLRQHVSHURODPD\RUtDGHWUDEDMDGRUHV\GH
GLUHFWLYRVHQWRGRVORVQLYHOHVGHODRUJDQL]DFLyQ
HQFXHQWUDQTXHKDQVDFUL¿FDGRVXVDOXG\VXYLGD
personal en los altares de las organizaciones. La
KLVWRULDGH/RPDQVLELHQH[WUHPDHQVXGHVHQODFHQRORHVWDQWRHQVXFRQWHQLGR(QHOPXQGR
GHKR\PXFKDVSHUVRQDVWDQWRDQLYHOLQGLYLGXDO
FRPRGHFROHFWLYLGDGHVHQWHUDVVHVLHQWHQXWLOL]DGDV \ ³«FRPR XQD FiVFDUD GH QDUDQMD YDFtD
DUURMDGDDODFDOOH«´FXDQGRKDQGHMDGRGHVHU
QHFHVDULDVDODVRUJDQL]DFLRQHVTXHVHUYtDQ
/DRUJDQL]DFLyQWLHQHOtPLWHVSHUR¢FXiOHVVRQ"
La pertenencia como miembro parece una caracteUtVWLFDTXHHVWDEOHFHORVOtPLWHVTXHDVtYHQGUtDQ
GH¿QLGRVSRUORVTXHR¿FLDOPHQWHVRQPLHPEURV
GHODHPSUHVDRLQVWLWXFLyQSHUR¢TXpHVR¿FLDOmente? Quizá la pertenencia esté dada por el hecho de cobrar una remuneración directamente de la
RUJDQL]DFLyQRVHUSDVLEOHGHVDQFLRQHVSRUSDUWH
GHHOODHQFXDOTXLHUFDVRORVOtPLWHVVRQGLIXVRV\
SXHGHSHQVDUVHHQGLYHUVRVJUDGRVGHSHUWHQHQFLD
plasmados incluso legalmente por la relación de
GHSHQGHQFLDRGLYHUVRWLSRGHFRQWUDWRV QyWHQVH
SRUHMHPSORORVJLURVHO³HV´GH&RFD&RODRHO
³HVWiWUDEDMDQGR´SDUD&RFD&ROD Organizaciones sistémicas
$ORODUJRGHODKLVWRULDGHODDGPLQLVWUDFLyQGLIHUHQWHV DXWRUHV KDQ GH¿QLGR D OD RUJDQL]DFLyQ
FRPR XQ VLVWHPD DO KDEODU GHO HQIRTXH GH VLVWHPDV SRGHPRV UHIHULUQRV D PXFKDV FRVDV SRU
HMHPSORDXQQXHYRSDUDGLJPDFLHQWt¿FRDXQD
teoría acerca de las organizaciones o a una metoGRORJtD&RQVLGHUDGRFRPRXQQXHYRSDUDGLJPD
FLHQWt¿FRHQFRQWUDPRVVXDQWHFHGHQWHDSDUWLUGH
ORV WUDEDMRV GH9RQ %HUWDODQII\ FX\DV LGHDV WRPDQIRUPDHQFXDQGRMXQWRD%RXOGLQJ5Dpaport y Gherard constituyen la Society for General Systems Theory(QHOPLVPRVHQWLGR:LHQHUGLRRULJHQDODFLEHUQpWLFDFRPRFLHQFLDTXH
EULQGDFRQH[LyQDODVGHPiVFLHQFLDVEDViQGRVH
HQODLGHDGHTXHORVVHUHVYLYRVRODVPiTXLQDV
son esencialmente sistemas de procesamiento de
PHQVDMHVDWUDYpVGHSURFHVRVPHFiQLFRV¿VLROyJLFRVSVLFROyJLFRVRFRPELQDFLRQHVGHHOORV
7DPELpQSRGHPRVHQWHQGHUHOHQIRTXHVLVWpPLFRFRPRXQDWHRUtDGHODRUJDQL]DFLyQSRVWHrior al modelo formal y al organicista. El modelo
IRUPDOFRQFLEHDODRUJDQL]DFLyQFRQYLVLyQPHFDQLFLVWDUHVFDWDQGRHQHOODXQDUHDOLGDGVLPSOL¿FDGDGRQGHODWUDPDGHUHODFLRQHVUHVSRQGHDO
mecanismo causa-efecto. La realidad social se
analiza como la realidad físico-natural. CoinciGHFRQHOHQIRTXHFOiVLFRFHQWUDGREiVLFDPHQWH
HQODGLYLVLyQGHWDUHDVSRUHVSHFLDOLGDGHV\OD
estructuración de la organización de acuerdo
con ciertos principios FLHQWt¿FRV. Dentro de este
HQIRTXHHQFRQWUDPRVDXWRUHVFRPR7D\ORU\)D\RO\WDPELpQD:HEHUFRQVXPRGHOREXURFUitico basado en la formalización del comportamiento para lograr el control del mismo.
(Q VH IRUPXOy OD OtQHD WHyULFD OODPDGD
de los sistemas sociotécnicos 7ULVW\%UDPIRUWK
TXHH[SOLFDTXHXQVLVWHPDGHSURGXFFLyQ
UHTXLHUHXQDRUJDQL]DFLyQWHFQROyJLFD HTXLSRV\
SURFHVRV \XQDRUJDQL]DFLyQGHOWUDEDMRTXHUHODFLRQDDODVSHUVRQDVTXHUHDOL]DQODVDFWLYLGDGHV
dentro del sistema. Con el concepto de sistema
VRFLRWpFQLFR HVWRV LQYHVWLJDGRUHV PDQLIHVWDURQ
TXHORVUHTXHULPLHQWRVWHFQROyJLFRVSRQHQOtPLtes a las posibles maneras de organizar el trabaMRSHURWDPELpQODIRUPDHQTXHpVWHVHRUJDQLza presenta dimensiones sociales y psicológicas
LQGHSHQGLHQWHVGHODWHFQRORJtD3RVWHULRUPHQWH
el concepto de sistema sociotécnico fue complementado con el de sistema abierto (PHU\\7ULVW
y .DW] \ .DKQ (Q HOORV HOinput de
HQHUJtD\ODFRQYHUVLyQHQHQHUJtDSRVWHULRUGHVDOLGDOOHYDQDWUDQVDFFLRQHVHQWUHODRUJDQL]DFLyQ\
VXPHGLRDPELHQWH8QRGHORVHUURUHVGHODWHRUtD
DFHUFDGHODVRUJDQL]DFLRQHVHVQRUHFRQRFHUTXH
las mismas dependen continuamente de los insu-
84 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
PRVLQFRUSRUDGRVGHODPELHQWH\TXHHOLQÀXMR
permanente de materiales y energía humana no
es una constante. Ackoff H[SUHVyTXHORV
VLVWHPDVRUJDQL]DWLYRVHVWiQRULHQWDGRVWHOHROyJLFDPHQWH\TXHHQODVHPSUHVDVORVREMHWLYRVVH
WUDGXFHQ HQ LQGLFDGRUHV TXH SUHWHQGHQ PHGLU OD
FUHDFLyQGHULTXH]DJHQHUDGDHQHOODV
(Q FXDOTXLHU FDVR OR VLVWpPLFR VH UH¿HUH D
cierto grado de relaciones de interdependencia
HQWUH ORV FRPSRQHQWHV GH OD RUJDQL]DFLyQ DGPLWLpQGRVH TXH HVWDV partes organizacionales
±VHDQORTXHIXHVHQ±LQWHUDFFLRQDQHQWUHVtSDUD
DOFDQ]DU ORV REMHWLYRV HPSUHVDULDOHV VLHQGR OD
suma e interrelación de partes de un sistema
DOJR GLYHUVR \ VXSHUDGRU SDUD OD WHRUtD VLVWpPLFDORFUXFLDOHVMXVWDPHQWHHOHPHUJHQWHTXH
SRVHHHOVLVWHPD\QRVXVFRPSRQHQWHVDLVODGRV
SRUHMHPSORODVSDUWHVGHXQDYLyQVXHOWDVVRQ
FKDWDUUD\DOMXQWDUVHIRUPDQXQDYLyQTXHYXHOD
DWULEXWR QRYHGRVR \ FDUDFWHUtVWLFR GHO VLVWHPD
TXHQRSRVHtDQODVSDUWHV 2WUDVGRVFDUDFWHUtV-
ticas interesantes de los sistemas son el holisPR \ OD VLQHUJLD KROLVPR TXLHUH GHFLU TXH XQ
sistema debe considerarse como un todo; los
FDPELRV HQ FXDOTXLHU SDUWH GHO VLVWHPD WLHQHQ
repercusión en la totalidad del mismo. Sinergia
KDFHUHIHUHQFLDDTXHODLQWHUDFFLyQGHODVSDUWHV
HVPiVTXHVXVLPSOHVXPD
La teoría distingue además entre sistemas
DELHUWRV \ FHUUDGRV /RV FHUUDGRV VRQ ORV TXH
VH DXWRFRQVHUYDQ \ QR UHFLEHQ HQHUJtD R UHFXUVRV H[WHUQRV VL H[LVWHQ SXHGH SHQVDUVH HQ XQ
UHORM FRPR HMHPSOR SXHV VH FDUDFWHUL]D SRU VX
regularidad y consecuente capacidad de predicFLyQ SHUR FRQ UHVHUYDV \D TXH FRPR KDFH QRWDU:LOHQVN\ QR VDEHPRV TXp SRGUtD SDVDUOH D
ODPDTXLQDULDHQXQDFiPDUDDJUDGRVEDMR
FHUR (OPRGHORGHHQIRTXHHVWUDWpJLFRGHVLVWHPDVLGHQWL¿FDODH[LVWHQFLDGHYDULRVHOHPHQWRV
FODYH HQ ODV RUJDQL]DFLRQHV ¢&XiOHV VRQ HVWRV
IDFWRUHV FUtWLFRV GHO FRQWH[WR RUJDQL]DWLYR" 6H
denominan factores de contingencia a estas con-
ORGANIZACIONES
Desde siempre, la humanidad contó con organizaciones
pero su conocimiento científico es casi totalmente
producto de la segunda mitad del siglo XX.
APRECIAR EL COMPONENTE HUMANO
ES CRUCIAL, EL ÉXITO DE TODA EMPRESA
RADICA EN QUE SEA CAPAZ DE
ATRAER, MOTIVAR Y RETENER
A LAS PERSONAS ADECUADAS.
ATRAER
MOTIVAR
RETENER
SISTEMA SOCIOTÉCNICO
FORMADO POR PERSONAS
QUE TIENE UNA ESTRUCTURA
DELIBERADA, TIENDE A UN FIN,
TIENE LÍMITES PRECISOS.
Al principio pareció importante definir qué
TENÍAN EN COMÚN LAS ORGANIZACIONES, más allá
de sus funciones específicas.
ESTRUCTURA DELIBERADA
ESPECIALIZACIÓN
Y DIVISIÓN
DEL TRABAJO
En las dos últimas décadas fue un
avance importante entender que
una teoría de la organización
NO PUEDE SEPARARSE
de una teoría del AMBIENTE
en el que opera.
LÍMITES DE LA ORGANIZACIÓN
¿Quién está adentro y quién afuera?
¿Hasta dónde se extiende la organización?
JERARQUÍA
DE
AUTORIDAD
AMBIENTE ES:
- MERCADO
- CLIENTES
- TECNOLOGÍA
- INSTITUCIONES FINANCIERAS
DE LAS QUE DEPENDE
CUANDO LAS PERSONAS
TRABAJAN JUNTAS ES
NECESARIO CONSIDERAR
UNA SERIE DE ASPECTOS.
EL ORGANIGRAMA REPRESENTA
LA ESTRUCTURA (ANATOMÍA)
ORGANIZACIONAL.
DIFERENCIACIÓN
DIVISIÓN
DEL TRABAJO
INTEGRACIÓN
COORDINACIÓN Y CONTROL
DEL TRABAJO
UNA CUESTIÓN DE LÍMITES
Los límites vienen definidos por aquellos que pertenecen
oficialmente a la organización.
¿Y esto que significa?
- Diferentes grados de pertenencia
- Relación de dependencia
- Honorarios
- El hecho de pagar las remuneraciones
- O poder imponer castigos
ADAM SMITH Y
LOS ALFILERES
MUESTRA LAS RELACIONES DE AUTORIDAD,
LOS CANALES DE COMUNICACIÓN FORMALES,
LOS EQUIPOS DE TRABAJO FORMALES,
LAS LÍNEAS FORMALES DE RESPONSABILIDAD.
Cuadro 4.2: Características clave de las organizaciones
:LOHQVN\$Política de Negocios%XHQRV$LUHV(G0DFFKL FLWDQGRD3RSSHU.Conocimiento objetivo
0DGULG7HFQRV 4 - Fundamentos de estructura y diseño organizacionales / 85
GLFLRQHVHQWUHODVTXHVHFXHQWDQODVPHWDVRUJDQL]DWLYDV HO DPELHQWH H[WHUQR OD WHFQRORJtD HO
WDPDxRODFXOWXUDHPSUHVDULDO/DGLUHFFLyQGHEH
HOHJLUHVWUXFWXUDVRUJDQL]DWLYDVTXHSHUPLWDQUHVSRQGHUFRQH¿FLHQFLDDODVVLWXDFLRQHVDODVTXHOD
HPSUHVDGHEHHQIUHQWDUVHSRUWDQWRGHEHLQWHQWDU
PD[LPL]DUODDGHFXDFLyQHQWUHODHVWUXFWXUDHVFRJLGD\HOFRQWH[WRHQHOTXHVHHQFXHQWUDODRUJDQL]DFLyQ/DHVWUXFWXUDRUJDQL]DWLYDGHVFULEHODV
UHODFLRQHV LQWHUQDV OD GLYLVLyQ GHO WUDEDMR \ ORV
PHGLRVH[LVWHQWHVSDUDFRRUGLQDUODVDFWLYLGDGHV
de la empresa. La elección de la estructura debe
VHUFRQWLQJHQWH GHSHQGLHQWH GHOFRQWH[WRHQHO
TXH VH KDOOD OD RUJDQL]DFLyQ \ VXHOH GHFLUVH HQ
HVWHVHQWLGRTXHQRKD\XQD~QLFDIRUPDPHMRUGH
HVWUXFWXUDU\RUJDQL]DUXQDHPSUHVDVLQRTXHOD
HVWUXFWXUDPiVDGHFXDGDGHSHQGHUiGHOFRQWH[WR
HQHOTXHRSHUDODRUJDQL]DFLyQ
Metáforas de la organización
(Q VX H[FHOHQWH OLEUR4 Morgan considera la
HYROXFLyQGHORVPRGHORVWHyULFRVGHODRUJDQL]DFLyQ D WUDYpV GH ODV TXH pO OODPD metáforas
8QHPSOHDGRGHEHUHFLELUyUGHQHVVyORGHXQ~QLFR
superior.
/DOtQHDGHDXWRULGDGGHVXSHULRUDVXERUGLQDGRYDGHVGH
ENCADENAMIENTO ESCALAR
el tope superior hasta el más bajo de la organización; esta
FDGHQDTXHUHVXOWDGHOSULQFLSLRGHODXQLGDGGHPDQGR
deberá usarse como un canal para las comunicaciones y las
tomas de decisión.
El número de personas dependiendo de un superior no
DISPERSIÓN DEL CONTROL
debe ser demasiado grande para no crear problemas de
comunicaciones y coordinación.
(OSHUVRQDOGHVWDIISURSRUFLRQDUiYDOLRVRVVHUYLFLRVGH
STAFF Y LÍNEA
FRQVXOWDSHURGHEHWHQHUFXLGDGRGHQRYLRODUODOtQHDGH
autoridad.
'HEHVHUSRWHQFLDGDHQWRGRVORVQLYHOHVGHOD
INICIATIVA
organización.
(OGLUHFWLYRGHEHWHQHUFRPRPHWDHOFRQVHJXLUXQJUDGRGH
DIVISIÓN DEL TRABAJO
HVSHFLDOL]DFLyQGHWHUPLQDGRSDUDORJUDUORVREMHWLYRVGHOD
RUJDQL]DFLyQGHXQDIRUPDH¿FLHQWH
Debe ponerse especial atención en el derecho de dar
AUTORIDAD Y RESPONSABILIDAD
yUGHQHV\H[LJLUREHGLHQFLDGHEHUiFRQVHJXLUVHXQ
HTXLOLEULRDSURSLDGRHQWUHDXWRULGDG\UHVSRQVDELOLGDG
Carece de sentido responsabilizar a alguien de un trabajo
DOTXHQRVHOHKDGDGRODDSURSLDGDDXWRULGDGSDUDHMHFXWDU
tal responsabilidad.
CENTRALIZACIÓN (DE LA AUTORIDAD) 6LHPSUHSUHVHQWHHQDOJ~QJUDGRGHELHQGRYDULDUpVWHSDUD
optimizar el empleo de las facultades del personal.
2EHGLHQFLDDSOLFDFLyQHQHUJtDFRPSRUWDPLHQWRVHxDOHV
DISCIPLINA
de respeto de acuerdo con los usos y costumbres
SUBORDINACIÓN DE LOS INTERESES $WUDYpVGHOD¿UPH]DGHODHMHPSODULGDGGHORVDFXHUGRV
\GHXQDFRQVWDQWHVXSHUYLVLyQ
INDIVIDUALES A LOS GENERALES
%DVDGDHQODFRQVLGHUDFLyQ\HQODMXVWLFLDVHDQLPDUiDO
EQUIDAD
personal en sus deberes y en la justa renumeración.
Para facilitar el desarrollo de las habilidades
ESTABILIDAD DE LA
OCUPACIÓN DEL PERSONAL
Para facilitar la armonía como una base de fuerza
ESPÍRITU COLECTIVO
UNIDAD DE MANDO
Tabla 4.1: Principios de la teoría clásica de la dirección (tomado de Morgan)
0RUJDQ*Imágenes de la organización$OIDRPHJD0p[LFR')
4
86 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
ORGANIZACIONES:
ENTIDAD SOCIAL
ORIENTADA AL LOGRO DE METAS
DELIBERADAMENTE
ESTRUCTURADA
LÍMITES O FRONTERAS
IDENTIFICABLES
ADAM SMITH
DIVIDE Y REINARAS
LA DIVISIÓN Y ESPECIALIZACIÓN
DEL TRABAJO AUMENTABA
ENORMEMENTE
LA PRODUCCIÓN
MAX WEBER Y
BUROCRACIA COMO
FORMA DE
ORGANIZACIÓN IDEAL
HENRY FAYOL - TEORÍA
CLÁSICA DE LA
ORGANIZACIÓN
Diseñaron la organización
como una máquina
Unidad de mando
Encadenamiento escalar
Staff y línea
Iniciativa
División del trabajo
Autoridad y responsabilidad
Disciplina
Subordinación de intereses
individuales de los genetales
FREDERICK TAYLOR
Y LA DIRECCIÓN CIENTÍFICA
LIMITACIONES DE LA METÁFORA:
se crean organizaciones que pueden tener
dificultades para adaptarse
al cambio de circunstancias
pueden generar burocracias sin límites
tiene efectos deshumanizadores y
embrutecedores sobre los empleados,
limitando su creatividad
crea organizaciones rígidas, sólo aptas
para dar una respuesta univoca, sin flexibilidad
Algunas organizaciones han
tenido un éxito espectacular
empleando el modelo mecanicista
porque las condiciones eran óptimas,
por ejemplo MC DONALD, que es un
paradigma en la adopción de los
principios de Taylor
LA ORGANIZACIÓN CÓMO MÁQUINA
El RESULTADO a nivel
humano ha sido obvio.
Para mucha gente la línea
de montaje es
simplemente alienante
PRINCIPIOS MUY SIMPLES:
Delegar toda responsabilidad de la
organización del trabajo al directivo
Usar métodos científicos para determinar
el modo más eficiente de hacer el trabajo
Seleccionar la mejor persona
para realizar el trabajo
Instruir al trabajador
Controlar el rendimiento
El efecto de la dirección
científica de Taylor en
el mundo del trabajo
ha sido impresionante,
incrementando varias
veces la producción
Cuadro 4.3: Metáfora de la organización maquinal
HVWRHVH[SUHVLRQHVTXHWUDVODGDQHOVHQWLGRUHDO
DXQR¿JXUDGR\TXHXVDGDVLQLFLDOPHQWHSDUD
HPEHOOHFHUHOGHFLUOOHJDQDLPSUHJQDUQXHVWUDV
WHRUtDV \ H[SOLFDFLRQHV GH OD YLGD RUJDQL]DFLRQDO LPSOLFDQGR XQ PRGR GH YHU \ XQ PRGR GH
SHQVDU GH PDQHUD GLVWLQWLYD SHUR WDPELpQ UHVWULFWLYD$VtDOGHFLU³HVWHKRPEUHHVXQOHyQ´
TXHUHPRVSRQHUGHPDQL¿HVWRVXVFXDOLGDGHVGH
EUDYXUDIXHU]DRYDORUSHURDOPLVPRWLHPSR
GHMDPRVHQXQFRQRGHVRPEUDHOKHFKRGHTXH
esa misma persona podría ser al mismo tiempo
XQUHFOXVRXQDVHVLQRVHULDORXQGHPRQLR$Vt
las organizaciones pueden entenderse de muchas
maneras diferentes y la mayoría son ideas dadas
SRU VXSXHVWR PHWDIyULFDV D~Q FXDQGR SXHGDQ
no ser reconocidas como tales. Comienza con
ODEXURFUDFLDPHFiQLFDVLJXHFRQODFRQVLGHUDción de las organizaciones como organismos y
pasa por un sinnúmero de estadios intermedios
FXOWXUDVFiUFHOHVSVtTXLFDVVLVWHPDVSROtWLFRV SDUDOOHJDUDXQQLYHOGHDXWRRUJDQL]DFLyQHQHO
TXHLQFOX\HODFDSDFLGDGGHDXWRUJDQL]DU\DX-
togenerar conocimiento. Mencionaremos con
algún detalle las tres principales.
La organización maquinal VHJ~Q OD PHWiIRUDGH0RUJDQSDUWHGHODWHRUtDFOiVLFDGHOD
RUJDQL]DFLyQ )D\RO0RRQH\8UZLFN \VHEDVD
en unos cuantos principios YHU7DEOD DOJXQRVGHORVFXDOHVVRQYLRODGRVHQRUJDQL]DFLRQHV
matriciales como el hospital.
(QWUHVXVFXOWRUHVWLHQHHVSHFLDOUHQRPEUH)UHGHULFN7D\ORUSLRQHURGHORTXHKR\FRQRFHPRV
FRPR'LUHFFLyQ&LHQWt¿FD(OLPSDFWRGHOWD\ORULVPR EDVDGR HQ XQRV FXDQWRV SULQFLSLRV5 HQ HO
mundo del trabajo ha sido enorme. ParadójicamenWHDVXPXHUWHHQ7D\ORUHUDFRQRFLGRFRPR
el peor enemigo del trabajador7D\ORUDERJySRU
HOHVWXGLRGHWLHPSRVDFWLYLGDGHV\VXPpWRGRHQFXHQWUD DPSOLD DSOLFDFLyQ HQ FRQWH[WRV ODERUDOHV
HQORVTXHHOWUDEDMRHVWiRUJDQL]DGRKDVWDHQVXV
PtQLPRVGHWDOOHVORTXHKD\TXHKDFHUORKDFHHO
Q~FOHRRSHUDWLYR PDQRGHREUD \ORTXHKD\TXH
'HOHJDUODUHVSRQVDELOLGDGGHOWUDEDMRDOGLUHFWLYR 8VDUPpWRGRVFLHQWt¿FRVSDUDGHWHUPLQDUHOPRGRPiVH¿ciente de realizar el trabajo; * Seleccionar la mejor persona para realizar el trabajo analizado; * Instruir al trabajador
SDUDKDFHUHOWUDEDMRH¿FLHQWHPHQWH\ &RQWURODUHOUHQGLPLHQWRGHOWUDEDMDGRU
5
4 - Fundamentos de estructura y diseño organizacionales / 87
ABRAHAM MASLOW y su
teoría de las necesidades
el ser humano está motivado
por una jerarquía
de necesidades: fisiológicas,
de seguridad, sociales,
de autoestima y autorrealización
Identificación documentada
de una ORGANIZACIÓN
INFORMAL basada en la
camaradería de los grupos
Conceptualizaciones como
sistemas abiertos, con personas
con necesidades a cumplir.
Como diversas especies aptas
cada una para diferentes
entornos o ambientes.
VENTAJAS Y LIMITACIONES DE LA
METÁFORA ORGÁNICA:
- énfasis dado a las relaciones interpersonales
y al entorno
- acentúan la idea de sistemas abiertos
- atención a las necesidades que deben
ser satisfechas
- identificación de las especies de organización
- destaca que la organización efectiva es
CONTINGENTE O DEPENDIENTE DEL ENTORNO
DESVENTAJAS:
- las organizaciones no son en verdad
unidades funcionales sino separadas
FORMAS SIMPLES
Y ADHOCRACIAS
ENTORNOS
INESTABLES
BUROCRACIA
MECÁNICA Y FORMA
DIVISIONARIA
ENTORNOS ESTABLES
VARIEDAD DE
ESPECIES
ORGANIZATIVAS
Sabemos que los empleados
trabajan bien cuando
están motivados por las
tareas que realizan
Surgió una nueva teoría basada
en la idea de que los
individuos y grupos, como los
organismos, trabajan más
eficazmente cuando sus
necesidades están
satisfechas
Estudios HAWTHORNE, años 20 y 30 ELTON MAYO en la
Planta Hawthorne de Chicago de la
WESTERN ELECTRIC COMPANY (WEC like WACO)
Psicólogos como Argyris,
Herzberg y Mc Gregor
Desarrolladas en incontables formas
estas ideas proporcionaron un
poderoso marco para el desarrollo
de los RECURSOS HUMANOS
Se vio al empleado como un
recurso de posibilidades variables
que podría contribuir en riqueza y
variedad de formas a la organización
si se le daba una oportunidad
Considerando a la organización como
un sistema abierto se centra la
atención en una serie de puntos:
primero, hacer hincapié en el
ENTORNO EN EL QUE LA
ORGANIZACIÓN EXISTE
ORGANIZACIONES
MATRICIALES
ADHOCRACIAS
EN DEFINITIVA
No hay un modelo óptimo
de organización. La forma
apropiada depende de la clase
de tarea o entorno con el que
se está considerando
¿Qué especies tienen éxito y bajo qué condiciones?
Se ha dedicado mucha atención al
estudio del ENTORNO ACTIVO,
definido por las relaciones con los
CLIENTES, COMPETIDORES,
PROVEEDORES, SINDICATOS,
ADMINISTRACIÓN, ETC., como
del más amplio entorno
contextual o general
Cuadro 4.4: Metáfora de la organización como organismo
SHQVDU OR KDFHQ RWURV HVWUDWRV RUJDQL]DWLYRV 0F
'RQDOGSRUHMHPSORHVXQWtSLFRFDVRGHXQDRUJDQL]DFLyQWD\ORULVWD /DIyUPXODPHFDQLFLVWDWD\ORULVWDWLHQHYDULDVOLPLWDFLRQHVFRPRSRUHMHPSOR
GL¿FXOWDGHVSDUDDGDSWDUVHUiSLGD\H¿FLHQWHPHQWH
DOHQWRUQRODFUHDFLyQGHEXURFUDFLDVRburopatías
GHSURSRUFLRQHVJLJDQWHVFDV\VREUHWRGRHOWUDWR
deshumanizado y embrutecedor a los empleados.
A posteriori Morgan considera la irrupción
de la metáfora orgánicaTXHYHDODRUJDQL]DFLyQFRPRXQVLVWHPDYLYRSOHQDGHQHFHVLGDGHV
VRFLDOHV (Q FRQWUD GHO WHFQLFLVPR WD\ORULDQR
el organicismo considera la contribución motiYDFLRQDO GHO HPSOHDGR FRPR YLWDO SDUD OD UHDOL]DFLyQGHODVWDUHDV/RVHVWXGLRV+DZWKRUQH
GHOD:HVWHUQ(OHFWULFGH&KLFDJRVRQHOSLODU
fundacional y casi el epítome de esta óptica. El
interludio+DZWKRUQHSXHGHFRQVLGHUDUVHFRPR
una caja de sorpresas en más de un sentido –se
comentan detalladamente en el capítulo sobre
DGPLQLVWUDFLyQGH55++)XHURQGLULJLGRVHQWUHORVDxRV\SRU(OWRQ0D\RHQODSODQWD
+DZWKRUQH GH OD:HVWHUQ (OHFWULF GH &KLFDJR
XQD HPSUHVD PRQXPHQWDO TXH HUD FDVL XQD SHTXHxDFLXGDG/RVHVWXGLRVVHFHQWUDURQLQLFLDOPHQWHHQODLQYHVWLJDFLyQGHODUHODFLyQHQWUHODV
condiciones de trabajo y la incidencia de fatiga
\ DEXUULPLHQWR HQWUH ORV WUDEDMDGRUHV SHUR VXSHUDURQDPSOLDPHQWHHVDSHUVSHFWLYDLQLFLDOHQfocando muchos otros aspectos de la situación
ODERUDOFRPRODVDFWLWXGHV\SUHRFXSDFLRQHVGH
los trabajadores y los factores del entorno social
fuera del trabajo. Los estudios son famosos por:
,GHQWL¿FDUODLPSRUWDQFLDGHODVQHFHVLGDGHV
sociales en el mundo del trabajo y el modo en
TXHORVJUXSRVODERUDOHVSXHGHQVDWLVIDFHUHVWDV
QHFHVLGDGHVUHVWULQJLHQGRODSURGXFFLyQ\(O
UHFRQRFLPLHQWRGHTXHXQDRUJDQL]DFLyQLQIRUPDOEDVDGDHQWUHRWUDVFRVDVHQODFDPDUDGHUtD
GHORVJUXSRVSRGtDH[LVWLUDORODUJRGHODRUJDQL]DFLyQ(QGH¿QLWLYD+DZWKRUQHGHPRVWUy
88 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
Toma de decisiones y sistemas
de racionalidad limitada
UDUWRGDVODVRSFLRQHV\DTXHQRWHQHPRVWRGRHO
tiempo –ni toda la información–; y * para poder
SUHGHFLU<DTXHODVRUJDQL]DFLRQHVVyORSXHGHQ
GDUVROXFLRQHVDSUR[LPDGDVSimon6 propuso el
FDOL¿FDWLYRGHlimitada a la racionalidad en ellas
6LPRQ /DVEDVHVGHWDOUDFLRQDOLGDGOLmitada son:
‡&DSDFLGDGGHSHUFHSFLyQVHOHFWLYDQXHVWUDV
SHUFHSFLRQHVVHYHQ¿OWUDGDVSRUQXHVWURVLQWHUHVHV\YDORUHV
‡ +DELOLGDG GH FRPSXWDFLyQ OLPLWDGD QXHVWUD
capacidad para realizar operaciones mentaOHVHVEDVWDQWHOLPLWDGDHVSHFLDOPHQWHFXDQdo los datos son probabilísticos.
‡0HPRULDOLPLWDGDODPHPRULDGHWUDEDMRWLHQHXQDFDSDFLGDGOLPLWDGDQRQRVDVHJXUDOD
¿GHOLGDGGHUHSURGXFFLyQUHFRQVWUXLPRVORV
recuerdos imprimiéndoles una cierta lógica
HOOODPDGRSRUQRVRWURVEfecto Piaget 0RUJDQ FRQVLGHUD VLJXLHQGR ODV LGHDV GH 6LPRQ TXH ODV RUJDQL]DFLRQHV QXQFD SXHGHQ VHU
FRPSOHWDPHQWH UDFLRQDOHV SRUTXH ORV FRPSRnentes tienen limitadas capacidades de procesamiento de la información. Las personas en las
organizaciones actúan con base en información
LQFRPSOHWD\VyORHVSRVLEOHH[SORUDUXQQ~PHUR
OLPLWDGRGHSRVLELOLGDGHVRDOWHUQDWLYDVUHODFLRnadas a las decisiones a tomar.
$VXPLPRVTXHODIRUPDGHSURFHGHUOODPDGD
racional/lógica nos asegura una cierta bondad
de procedimiento. La lógica aristotélico-tomisWDEDVHGHODWUDGLFLyQORJLFLVWDRFFLGHQWDOSDVD
por ser una especie de buena forma HQ OyJLFD
KDFLHQGRFDVRRPLVRGHODVRWUDVOyJLFDVFRPR
la lógica difusa o fuzzy logic 5HFXpUGHVH TXH
las computadoras no funcionan como los cereEURVHOrazonar de una computadora sigue sienGRHVW~SLGR\DTXHQRSXHGHPDQHMDUDVHUFLRQHV
YDJDVLQFLHUWDV\MXLFLRVGHYDORURFRPSDUDFLRQHV XQSRFRPiVIUtRDOJRPiVMRYHQ /DLQWHOLJHQFLDKXPDQDGHKHFKRQRIXQFLRQDFRPR
SUHVFULEHODOyJLFD\DTXHXQDJUDQFRPSOHMLGDG
HQOXJDUGHHVWLPXODUODODSDUDOL]DUtDSRUORTXH
parte de la información del ambiente debe ser
desechada sin analizar. Esto abre paso a la neFHVLGDGGHODKHXUtVWLFDDOJRDVtFRPRXQDWDMR
lógico o de razonamiento y emisión de juicios.
¢3RUTXpQHFHVLWDPRVODKHXUtVWLFD" SDUDUHVROYHUSUREOHPDVFRWLGLDQRV SDUDQRFRQVLGH-
6HVXSRQHTXHODWRPDGHGHFLVLRQHVHVUDFLRQDO\TXHORVWRPDGRUHVGHGHFLVLRQHVGHEHQ
DFWXDU FRPR GHFRGL¿FDGRUHV GH VHxDOHV LQIRUPDWLYDV GHO HQWRUQR \ DFWXDU HQ FRQVHFXHQFLD
(véase, en otra parte de este capítulo, más sobre
funciones del directivo, sea el jefe de una pequeña unidad o el director del hospital) SHUR
WHQHPRV PXFKRV \ YiOLGRV PRWLYRV SDUD GXGDU
GHTXHHVWRVHDDVt
'LFH 6LPRQ TXH HO FRPSRUWDPLHQWR
UHDO HQ HO PXQGR UHDO H[KLEH FDUDFWHUtVWLFDV GH
mosaico; cada segmento del patrón se alinea
FRQRWURVHQIXQFLyQGHORVSURSyVLWRVSHURpVWRVYDUtDQGHWDQWRHQWDQWRGHELGRDYDULDFLRQHV
HQHOHVWDGRGHFRQRFLPLHQWR\ODDWHQFLyQ$Vt
HO FRPSRUWDPLHQWR VyOR UHYHOD LVODV GH UDFLRQDOLGDGLQFOXVRGHQWURGHFDGDVHJPHQWRSHUR
el comportamiento global de la organización
PXHVWUDPX\SRFD±VLDOJXQD±FRQH[LyQ
Las organizaciones hoy por hoy son sistePDVSOXUDOLVWDVORVGLULJHQWHVGHOPiVDOWRQLYHOQRVRQQLFRQPXFKRXQDXQLGDGPRQROtWLFD
PXFKRPHQRVGHORTXHXQRGHVHDUtD \FDGD
uno es de hecho un jugador en un juego compeWLWLYRFX\RQRPEUHHVSROtWLFD&DGDVXEJUXSR
WLHQHVXVSURSLRVLQWHUHVHVOLEHUWDGHV\SRGHUHV
seriamente dedicados a luchas por el control
e incapaces de funcionar de manera conjunta
KROtVWLFD VRQ DPSOLDV UHGHV GH LQGLYLGXRV
SURIHVLRQDOHV DGPLQLVWUDWLYRV WpFQLFRV SUR-
TXH ODV DFWLYLGDGHV ODERUDOHV HVWDEDQ LQÀXLGDV
FRPRQRSRGtDVHUGHRWURPRGR SRUODQDWXUDOH]DGHOVHUKXPDQR\TXHORVWHyULFRVGHEtDQ
poner mucha atención en este lado humano de la
organización.
(QWUHODVYHQWDMDVGHODPHWiIRUDRUJDQLFLVWD
radica el entendimiento de las relaciones entre
ODRUJDQL]DFLyQ\VXHQWRUQRHQFRQWUDSRVLFLyQ
a la consideración de la misma como una caja
FHUUDGD\ODDWHQFLyQVLVWHPiWLFDGDGDDODVQHFHVLGDGHVTXHGHEHQVHUVDWLVIHFKDVD¿QGHTXH
ODRUJDQL]DFLyQVREUHYLYD$VLPLVPRHVIDFWLEOH
GLVWLQJXLUDOJXQDVHVSHFLHVGHRUJDQL]DFLyQTXH
VREUHYLYHQ HQ GLIHUHQWHV FRQWH[WRV RUJDQL]DWLYRV DOJRGHHVWRHVWDUiQtWLGDPHQWHSUHVHQWHHQ
ODREUDGH0LQW]EHUJ 6
+HUEHUW6LPRQSUHPLR1REHOGH(FRQRPtDOXHJRGHGLFDGRGHOOHQRDFXHVWLRQHVRUJDQL]DFLRQDOHV
4 - Fundamentos de estructura y diseño organizacionales / 89
MODELO RACIONAL MAXIMIZADOR OLÍMPICO (CLÁSICO)
INFORMACIÓN
ESTRATEGIA
TÁCTICA
OPERATIVA
DATOS
Problema
Alternativa
Implementación
SISTEMA DE INFORMACIÓN TRANSACCIONAL
Elección mejor alternativa
MODELO SATISFACTOR HEURÍSTICO
H
HOSPITAL
SOLUCIONES
EMERGENCIA
Inherentemente caóticas
En el mejor de los casos anarquías organizadas o arenas políticas
MODELO DEL TACHO DE BASURA
¿Qué sale?
- Soluciones huérfanas en busca de problemas
- Soluciones que son sólo ideas que se enganchan a un problema para darles curso
- Problemas persistentes
- Rutinas defensivas de Argyris
Cuadro 4.5: Diversos modelos de toma de decisiones: clásico, satisfactor heurístico y en tacho de basura
YHHGRUHV TXH VH XQHQ SRU FRQYHQLHQFLD SDUD
UHDOL]DUVXSUR\HFWRGHYLGDUHDOL]DUVXFDUUHUD
RORJUDUVXREMHWLYRGHVHDGR ORTXH0LQW]EHUJ
llama imperios y alianzasFXDQGRGH¿QHDOJXnos juegos característicos del poder en la orJDQL]DFLyQ 3RVHHQLQWHUHVHVPX\GLYHUJHQWHV
generando organizaciones inherentemente caóticas SRFR PiV TXH anarquías organizadas7
DOFpOHEUH\JUi¿FRGHFLUGH&\HUWK\0DUFK apenas montajes de escenarios para el desemSHxRGHORVDJHQWHVHQWLGDGHVSROtWLFRVRFLDOHV
HQODVTXHFDGDYH]HVQHFHVDULRQHJRFLDUPiV
funcionan mediante el reparto de autoridad y
la creación de un marco para el ejercicio del
poder.
En contra de los modelos decisionales teóULFRV FOiVLFRV FRPR HO UDFLRQDO PD[LPL]DGRU
olímpico emparentado con la idea del homo
2FRPRGLFH(WNLQ³«HQWRGDLQVWLWXFLyQKD\XQDGRVLVGHORFXUD«´,6$/8',,(QFXHQWURGH+RVSLWDOHV
90 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
WHQFLDGHĺFLHUWRVHOHPHQWRVFRQODFDSDFLGDG
GH VHQWLU \ H[SORUDU DVSHFWRV VLJQL¿FDWLYRV GHO
HQWRUQRĺODFDSDFLGDGGHFRPXQLFDUHVWDLQIRUPDFLyQDOFRQWUROFHQWUDOĺODFDSDFLGDGGH
GHWHFWDU GHVYtRV VLJQL¿FDWLYRV GH ODV QRUPDV R
SDUiPHWURVHVWDEOHFLGRV\¿QDOPHQWHĺODFDSDFLGDG GH LQLFLDU DFFLRQHV FRUUHFWLYDV FXDQGR
VHGHWHFWDQWDOHVGHVYtRV. Si se satisfacen estas
FRQGLFLRQHVSXHGHGHFLUVHTXHHOVLVWHPDJHQHUD
un intercambio continuo con su entorno y puede
controlar los cambios e iniciar respuestas aproSLDGDV\DVtVHFRPSRUWDGHPDQHUDLQWHOLJHQWH
y autorregulada. Los sistemas cibernéticos más
FRPSOHMRVFRPRHOFHUHEURKXPDQRVRQFDSDces de aprender a aprender y organizarse a sí
mismos.
(VWR KD OOHYDGR D ORV WHyULFRV PRGHUQRV D
hacer distinciones sutiles pero reales entre proceso y aprendizaje y el grado de aprender a
DSUHQGHU8QVLVWHPDFLEHUQpWLFRVLPSOHFRPR
XQ WHUPRVWDWR R OD IDPRVD PiTXLQD GH YDSRU
GH:DWWHVFDSD]GHDSUHQGHUHQHOVHQWLGRGH
GHWHFWDU\FRUUHJLUGHVYLDFLRQHVGHVGHQRUPDV
SUHGHWHUPLQDGDVSHURHVLQFDSD]GHFXHVWLRQDU
ORDSURSLDGRRQRGHORTXHHVWiKDFLHQGR8Q
WHUPRVWDWRQRSXHGHSRUHMHPSORGLVFHUQLUOR
DSURSLDGRRQRGHODWHPSHUDWXUD¿MDGDRSUHJXQWDUVHSRUTXpKDGHPDQWHQHUODKDELWDFLyQ
HQJUDGRV6LVWHPDVPiVFRPSOHMRVFRPRHO
FHUHEURHQFDPELRVtWLHQHQHVWDKDELOLGDGGH
cuestionarse a sí mismos y por lo tanto se dice
TXHVRQFDSDFHVGHDSUHQGHUDDSUHQGHU(VWRV
diferentes modos de funcionamiento se llaman
GH EXFOH VLPSOH R GREOH UHVSHFWLYDPHQWH$O
EXHQGHFLUGH$UJ\ULVHODSUHQGL]DMHGHXQVROR
circuito es apropiado para los aspectos rutinaULRV\UHSHWLWLYRVD\XGDDGHVHPSHxDUHOWUDEDjo cotidiano. El aprendizaje de doble circuito es
PiV UHOHYDQWH SDUD ORV DVSHFWRV FRPSOHMRV QR
/DPHWiIRUDXOWHULRUGH0RUJDQGHla orga- SURJUDPDEOHVDVHJXUDTXHKDEUiRWURGtDHQOD
nización como cerebroKDOODVXEDVHHQODFLEHU- RUJDQL]DFLyQ(QODVRUJDQL]DFLRQHVODFDSDFLnética o la habilidad de un sistema de mostrar dad para lograr este modo de bucle doble suele
XQFRPSRUWDPLHQWRDXWRUUHJXODGRTXHGHSHQGH ser problemática.
(QSULPHUOXJDUODIyUPXODJHQHUDOGHODRUde procesos de intercambio de información con
HO PHGLR /RV SULQFLSLRV FLEHUQpWLFRV VRQ HYL- ganización burocrática impone estructuras fragdentes en muchos tipos de sistemas y aún sub- mentarias de pensamiento sobre sus empleados
sistemas organizacionales \SUHVXSRQHQODH[LV- \ HVWLPXOD \ SURSHQGH HQ GH¿QLWLYD D TXH QR
economicus o el más mundano del satisfactor
heurístico HO PRGHOR GHFLVLRQDO IXQFLRQDO HQ
HVWDVHQWLGDGHVquaDQDUTXtDVHVHOOODPDGRHQ
tacho de basuraTXHVHHVTXHPDWL]DHQOD)LJXUD\TXHSURSRQHTXH
‡ VLHPSUH KD\ HQ OD RUJDQL]DFLyQ LGHDV SUHWHQGLGDPHQWH VROXFLRQHV SRWHQFLDOHV TXH
VHSURSRQHQ\DSR\DQFRPRRSFLRQHVVHDQ
cuales fueren los problemas –parafraseando
HOWtWXORGHODREUDGH3LUDQGHOORVHUtDQSoluciones huérfanas en busca de problemas;
‡ODVVROXFLRQHVVRQLQFUHtEOHPHQWHLQGHSHQdientes de los problemas;
‡GHDOJXQRVSUREOHPDV³QRVHKDEOD´ DGTXLHren estatus de tabú \ SHUVLVWHQ LQGH¿QLGDmente sin soluciones;
‡VHSURSRQHQVROXFLRQHVDXQFXDQGRQRKD\D
problemas;
‡VHKDFHQHOHFFLRQHVVLQUHVROYHUSUREOHPDV
‡ORVYHUGDGHURVSUREOHPDVSXHGHQSHUVLVWLUVLQ
VROXFLyQLQGH¿QLGDPHQWH DXQJHQHUDQGRHO
FRODSVRGHODRUJDQL]DFLyQ \¿QDOPHQWH
‡KDOODQH[SUHVLyQDPSOLDODVOODPDGDVrutinas
defensivasGHODRUJDQL]DFLyQTXHVHFRPHQWDQPiVDGHODQWH'HHVWHPRGRLGHDVSUREOHPDVVROXFLRQHVWDE~HVRUJDQL]DFLRQDOHV
y demás se agitan en un gran tacho de basura
GHGRQGHVDOHORTXHVDOH(QYHUGDGH[LVWH
XQRUGHQHQHOWDFKRGHEDVXUDSHURQRHVXQ
RUGHQ FRQYHQFLRQDO VX OyJLFD HV WHPSRUDO
QR MHUiUTXLFD QL FRQVHFXHQFLDO /RV SUREOHPDV\ODVVROXFLRQHVYLHQHQGHODPDQRGHODV
opciones y por tanto están relacionadas entre
VtQRVyORSRUYtQFXORVGHPHGLRV\¿QHVVLQR
SRUVLPXOWDQHLGDGHQHOOtPLWHSUiFWLFDPHQWH FXDOTXLHU VROXFLyQ SXHGH DVRFLDUVH FRQ
FDVL FXDOTXLHU SUREOHPD VLHPSUH \ FXDQGR
VHDQFRQWHPSRUiQHRV &\HUW\0DUFK /RGHROtPSLFRLPSOLFDXQDYLVLyQLUUHDOSDQySWLFDDEVROXWDTXHFRQVLGHUDWRGDVODVRSFLRQHV\UHDOL]DWRGRVORV
FiOFXORVXQDHVSHFLHGHPiTXLQDHFRQRPpWULFD
(VWRHVQRVHEDUDMDQWRGDVODVRSFLRQHV\SUREDELOLGDGHVORTXHVHUtDLPSRVLEOHVLQRVyORORUD]RQDEOHPHQWH
HVSHUDEOHRVDWLVIDFWRULRJHQHUDQGRVROXFLRQHVRUHVSXHVWDV³VX¿FLHQWHPHQWHEXHQDV´
4 - Fundamentos de estructura y diseño organizacionales / 91
SLHQVHQSRUVtPLVPRVVDOYRHPSUHVDVSDUDGLJPiWLFDPHQWHLQQRYDGRUDVFRPR0 \HVWRDXQ
FRQUHVHUYDVFRPRORGHPRVWUyHOIDPRVRcaso
Post it (Q RUJDQL]DFLRQHV HQ ODV TXH OD MHUDUTXtD \ ODV GLYLVLRQHV VRQ WDMDQWHV \ SRGHURVDV
ODLQIRUPDFLyQ\HOFRQRFLPLHQWRUDUDYH]FLUFXODQHQIRUPDOLEUHGHPRGRTXHHVWRVGLIHUHQWHV
sectores de la organización a menudo operan teniendo en cuenta diferentes aspectos de la situaFLyQVRFLDO\SXHGHQGHKHFKRSHUVHJXLUREMHWLYRVGHVXEJUXSRVFDVLFRPR¿QHVXREMHWLYRV
SRUHOORVPLVPRVLJQRUDQGRRGHVLQWHUHViQGRVH
del aspecto total.
8QDVHJXQGDJUDQEDUUHUDDHVWHDSUHQGL]Dje es el llamado principio de la responsabilidad
burocrática TXH UHVSRQVDELOL]D D ORV HPSOHDdos de sus funciones y castiga el error incitando –casi obligando– a los empleados a ocultar
ORV IDOORV SDUD SURWHJHUVH D Vt PLVPRV \ HYLWDU
FRORFDUVHHQXQDSRVLFLyQGHVIDYRUDEOH6HHQFXHQWUDQDVtPRGRVHVSXULRVGHGHVYLDUODDWHQción y encubrirse con formas de impresionar a
ODGLUHFFLyQKDFLHQGRTXHODVVLWXDFLRQHVSDUH]FDQPHMRUHVGHORTXHUHDOPHQWHVRQ(QVXPD
H[LVWH FRQ IUHFXHQFLD XQD WHQWDFLyQ GH GHFLU D
ORVMHIHVH[DFWDPHQWHORTXHVHSLHQVDTXHHOORV
TXLHUHQRtU
Cuando los sistemas de responsabilidad foPHQWDQ HVWH WLSR GH GHIHQVD XQD RUJDQL]DFLyQ
UDUDPHQWHHVFDSD]GHWROHUDUDOWRVQLYHOHVGHLQFHUWLGXPEUH\GLUHFWLYRV\HPSOHDGRVWDPELpQ
WLHQHQ XQD WHQGHQFLD D TXHUHU ³GHMDU ODV FRVDV
FRPR HVWiQ´ (VWR FRQ IUHFXHQFLD OHV OOHYD D
FUHDU LQWHUSUHWDFLRQHV GHPDVLDGR VLPSOL¿FDGDV
GHODVVLWXDFLRQHVTXHHVWiQWUDWDQGR7LHQGHQD
estar interesados en problemas sólo si hay soOXFLRQHV D PDQR /RV DVXQWRV FRPSOHMRV TXH
VRQGLItFLOHVGHGLJHULUVHGHMDQGHODGRRVHOHV
TXLWDLPSRUWDQFLDPLHQWUDVVHJDQDWLHPSRSDUD
lograr soluciones de escape o con esperanza de
TXH HO SUREOHPDV GHVDSDUH]FD /RV SRUWDGRUHV
GHPDODVQRWLFLDVSRFDVYHFHVVRQELHQYHQLGRV
\DPHQXGRVRQUHFKD]DGRV ODSROtWLFDGHPDWDU
DOPHQVDMHUR Otra barrera para los sistemas de aprendizaje
RUJDQL]DFLRQDOSURFHGHGHOKHFKRGHTXHDPHQXGRKD\XQYDFtRHQWUHORTXHVHGLFH\ORTXH
se hace. Algunos autores se han referido a este
hecho como la teoría de la adopción TXH GLFH
TXHPXFKRVGLUHFWLYRVLQWHQWDQUHVROYHUORVSUR-
EOHPDVFRQODOODPDGDUHWyULFDRUJDQL]DFLRQDO HV
GHFLUIUDVHRORJtDRUJDQL]DFLRQDOYDFtDRKXHFD GDQGRODLPSUHVLyQGHTXHVDEHQORTXHHVWiQKDFLHQGR\HVWRQRVyORSDUDFRQYHQFHUDORVGHPiV
VLQR WDPELpQ SDUD FRQYHQFHUVH D Vt PLVPRV GH
TXHWRGRHVWiELHQ\WLHQHQODFDSDFLGDGGHKDFHU
IUHQWHDODVLWXDFLyQ $UJ\ULV6FKRRQ Rutinas de defensa organizacional
/RVLQGLYLGXRVORVJUXSRV\ORVGHSDUWDPHQWRV
SRURWUDSDUWHSXHGHQGHVDUUROODUWHRUtDVTXHOHV
LPSLGHQFRPSUHQGHU\WUDWDUVXVSUREOHPDVOR
TXH FRQVWLWX\H YHUGDGHUDV rutinas de defensa
organizacional $UJ\ULV +D\XQDOyJLFD
IXQGDPHQWDO TXH VXVWHQWD WRGDV ODV UXWLQDV GHIHQVLYDVRUJDQL]DFLRQDOHV\TXHVHSXHGHLOXVWUDU
FRQODVLJXLHQWHIUDVHTXHHMHPSOL¿FDHVWDGLFRWRPtD \ HQYtR GH PHQVDMHV PL[WRV R GH GREOH
YtQFXOR³8VWHGHVWiDFDUJRGHOGHSDUWDPHQWR
SHURYHUL¿TXHHOFURQRJUDPDFRQHOVXEMHIH´R
ELHQ³9HUtDPRVFRQEXHQRVRMRVTXHVHDLQQRYDGRUSHURWHQJDFXLGDGR«´
La lógica subyacente es la siguiente:
1. Enviar un mensaje incongruente
2. Actuar como si no fuera incongruente
3. Hacer que 1 y 2 no sean debatibles (deliberativos)
4. Asegurarse que lo que no es debatible no
sea debatible
/DFDXVDGHODVUXWLQDVGHIHQVLYDVHVXQSURFHVRFLUFXODUTXHVHUHIXHU]DVLHPSUHDVtPLVmo\HQHOTXHODVWHRUtDVHPSOHDGDVGHOPRGHOR GH ORV LQGLYLGXRV SURGXFHQ HVWUDWHJLDV GH
SDVDUSRUDOWR\HQFXEULUTXHJHQHUDXQDDFWLWXG
RUJDQL]DFLRQDO GH SDVDU SRU DOWR \ HQFXEULU OR
TXHDVXYH]UHIXHU]DODVWHRUtDVHPSOHDGDVSRU
ORVLQGLYLGXRV
Para el aprendizaje organizacional de bucle
GREOH LQWHOLJHQWH VH UHTXLHUH TXH VH WUDFH XQ
SXHQWHHQWUHODWHRUtD\ODUHDOLGDGGHIRUPDTXH
OOHJXH D VHU SRVLEOH FXHVWLRQDUVH ORV YDORUHV \
normas inmersos en las teorías en uso. En esenFLD VH UHTXLHUH XQD QXHYD ¿ORVRItD GH JHVWLyQ
para enraizar los procesos de organización en
un proceso abierto de preguntas. Como se ha
PRVWUDGRODWRWDOLGDGGHOSURFHVRGHDSUHQGHUD
DSUHQGHUGHSHQGHGHD ODKDELOLGDGSDUDPDQ-
9pDVHHQHVWHVHQWLGRHOH[FHOHQWH\SUROt¿FRWUDEDMRGH&KULV$UJ\ULVGHOD8QLYHUVLGDGGH+DUYDUG
92 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
tenerse abiertos a los cambios ocurridos en el
HQWRUQR\E ODKDELOLGDGGHFXHVWLRQDUODVVXSRVLFLRQHVRSHUDWLYDVGHXQDIRUPDPiVEiVLFD
$VtHVQHFHVDULRIRPHQWDU\YDORUDUXQDJHVWLyQTXHDFHSWHHOHUURU\ODLQFHUWLGXPEUHFRPR
características inherentes de los entornos comSOHMRV\YDULDEOHV(VWHSULQFLSLRHVIXQGDPHQWDO
para permitir a los miembros de una organización tratar con la incertidumbre de una forma
FRQVWUXFWLYD (V SDUWLFXODUPHQWH LPSRUWDQWH HQ
ORV HQWRUQRV WXUEXOHQWRV GRQGH ORV SUREOHPDV
TXH DIURQWDQ ODV RUJDQL]DFLRQHV VRQ FRQ IUHFXHQFLD JUDQGHV FRPSOHMRV \ ~QLFRV \ SRU OR
WDQWRGLItFLOHVGHDQDOL]DU$QWHVGHFUHDUFRQGLFLRQHVTXHOOHYHQDORVHPSOHDGRVDHVFRQGHU
ORVHUURUHV\DHYLWDUSUHJXQWDUFXHVWLRQHVSUREOHPiWLFDV FRPR HQ HQWRUQRV EXURFUDWL]DGRV es necesario animarlos a entender y aceptar la
naturaleza problemática de las situaciones con
ODV TXH WLHQHQ TXH WUDWDU (Q VHJXQGR WpUPLQR
GHEHIRPHQWDUVHXQDDSUR[LPDFLyQDODQiOLVLV\
VROXFLyQGHSUREOHPDVFRPSOHMRVTXHUHFRQR]FDODLPSRUWDQFLDGHH[SORUDUGLIHUHQWHVSXQWRV
GHYLVWD'DGRTXHPXFKRVGHORVDVXQWRVDORV
TXHVHHQIUHQWDQODVRUJDQL]DFLRQHVHQHQWRUQRV
turbulentos son poco claros o multidimensionaOHV RDPEDVFRVDV XQDGHODVPD\RUHVGL¿FXOWDGHVHVGH¿QLUVXQDWXUDOH]D(VWRVHSRVLELOLWD
DWUDYpVGHXQD¿ORVRItDGLUHFWLYDTXHYDORUHOD
LPSRUWDQFLDGHLQGDJDUYDULDVGLPHQVLRQHV(Q
cada situación y permita la generación de conÀLFWRVFRQVWUXFWLYRV\GHEDWHVHQWUHSDUWLGDULRV
GHSHUVSHFWLYDVFRQWUDSXHVWDV
El meollo del planteo metafórico de MorJDQVHUH¿HUHDODVSURSLHGDGHVGHORVVLVWHPDV
KRORJUi¿FRV \ VX SUR[LPLGDG FRQFHSWXDO FRQ
los cerebros y las organizaciones. La forma en
TXHXQDOiPLQDKRORJUi¿FDFRQWLHQHWRGDODLQformación necesaria para producir una imagen
completa en cada una de sus partes tiene mucho
en común con el funcionamiento del cerebro. Y
HVSRVLEOHH[WHQGHUHVWDLPDJHQSDUDFUHDUXQD
YLVLyQ GH OD RUJDQL]DFLyQ GRQGH ODV FDSDFLGDGHV UHTXHULGDV HQ OD WRWDOLGDG HVWiQ HQYXHOWDV
HQ ODV SDUWHV SHUPLWLHQGR DO VLVWHPD D DSUHQder y autorganizarse y mantener un sistema en
IXQFLRQDPLHQWRLQFOXVRFXDQGRSDUWHVHVSHFt¿FDV QR IXQFLRQDQ R VH UHWLUHQ$OJXQDV DOWDV
RUJDQL]DFLRQHV LQQRYDGRUDV KDQ FRPHQ]DGR D
organizarse de esa forma. Pero los principios
VREUHORVTXHVHHVWUXFWXUDQVRQQRUPDOPHQWH
intuitivos más que explícitos(VDVtSURYHFKR-
so mirar algunas de las ideas surgidas desde la
PRGHUQDLQYHVWLJDFLyQGHOFHUHEURSDUDD\XGDU
DFODUL¿FDUFyPRWUDEDMDQORVVLVWHPDVKRORJUi¿FRVGHIRUPDTXHHVWDVLGHDVSXHGDQWHQHUXQ
gran impacto sobre la forma de diseñar orgaQL]DFLRQHV GHO IXWXUR (O FDUiFWHU KRORJUi¿FR
GHO FHUHEUR VH UHÀHMD FRQ FODULGDG HQ ORV PRGHORV GH FRQH[LRQHV GH ODV QHXURQDV D WUDYpV
GH ODV TXH FDGD XQD GH HOODV VH UHODFLRQD FRQ
RWURVFLHQWRVGHPLOHVSHUPLWLHQGRXQVLVWHPD
GHIXQFLRQDPLHQWRJHQHUDO\DODYH]HVSHFLDlizado. Distintas regiones del cerebro parecen
HVSHFLDOL]DUVHHQGLIHUHQWHVDFWLYLGDGHVSHURHO
control y ejecución del comportamiento espeFLDOL]DGRWRGDYtDQRHVWiORFDOL]DGR$VtPLHQtras podemos distinguir entre las funciones reaOL]DGDVSRUHOFRQWUROHOFHUHEHOR HORUGHQDGRU
RSLORWRDXWRPiWLFRTXHFRQWURODODVDFWLYLGDGHV
UXWLQDULDV \HQPHGLRHOFHUHEUR HOFHQWURGH
ODVHQVDFLyQORVVHQWLGRV\ODVHPRFLRQHV HVWDPRVREOLJDGRVDUHFRQRFHUTXHWRGRVVRQLQterdependientes y capaces de actuar en nombre
de cada uno de los otros cuando es necesario.
Veamos esto y también cómo la memoria pueGHVHUGLVWULEXLGDPiVTXHORFDOL]DGD7DPELpQ
VDEHPRVTXHODVSDUWHVL]TXLHUGD\GHUHFKDGHO
cerebro se combinan para producir modelos de
SHQVDPLHQWR\TXHODGHVWUXFFLyQHQWUHODVIXQFLRQHVGHDPERVKHPLVIHULRVHOGRPLQLRGHOD
FDSDFLGDGFUHDWLYD\DQDOtWLFDYDDFRPSDxDGD
GHXQRVPRGHORVJHQHUDOHVGHFRQHFWLYLGDG(O
secreto de la capacidad de los cerebros parece
GHSHQGHUWDQVyORGHHVWDFRQHFWLYLGDG TXHHV
ODEDVHGHODGLIXVLyQKRORJUi¿FD PiVTXHGH
una diferenciación estructural. La importancia
GHODFRQHFWLYLGDGHQODUHVSRQVDELOLGDGGHOD
complejidad de funcionamiento está reforzada
por las comparaciones entre cerebros humanos
\ GH DQLPDOHV 8Q DVSHFWR LQWHUHVDQWH GH HVWD
FRQHFWLYLGDGGHVFDQVDHQHOKHFKRGHFUHDUHQ
XQ PRPHQWR GDGR XQ Q~PHUR PD\RU GH FRQH[LRQHV FUX]DGDV \ FRPXQLFDFLRQHV VLHQGR
esta redundancia crucial para crear el potencial
KRORJUi¿FR\DVHJXUDUÀH[LELOLGDGHQODRSHUDción. La redundancia permite al cerebro crear
HQ PiV TXH GH XQD IRUPD GHWHUPLQDGD GHMDU
sitio para la acumulación de errores fortuitos y
JHQHUDU XQD FDSDFLGDG H[FHGHQWH TXH SHUPLWD
XQDV DFWLYLGDGHV \ IXQFLRQHV D GHVDUUROODU (O
cerebro tiene esta asombrosa capacidad de organizar y reorganizarse a sí mismo para tratar
FRQ ODV FRQWLQJHQFLDV TXH KD GH UHVROYHU 'LYHUVRVH[SHULPHQWRVKDQSXHVWRGHPDQL¿HVWR
4 - Fundamentos de estructura y diseño organizacionales / 93
VARIEDAD
REQUERIDA
APRENDER
A APRENDER
ORGANIZACIÓN
HOLOGRÁFICA
ESPECIFICACIÓN
MÍNIMA CRÍTICA
REDUNDANCIA
Cuadro 4.6: Principios centrales de comportamiento
organizacional holográfico
TXHFXDQWRPiVORFRPSURPHWDPRVHQXQDDFWLYLGDGHVSHFt¿FDPiVVHDXWRDMXVWDSDUDIDFLOLWDU
HOIXQFLRQDPLHQWRUHTXHULGR
¿Cómo se pueden emplear estas ideas acerca
GHO FDUiFWHU KRORJUi¿FR GHO FHUHEUR SDUD FUHDU
organizaciones o sistemas o subsistemas dentro
de las organizaciones que compartan esta envidiable cualidad de aprender y autorganizarse de
ODPDQHUDTXHORKDFHXQFHUHEUR"
6HVXJLHUHTXHFRQVWUX\HQGRPRGHORVGHULFD
FRQHFWLYLGDG HQWUH SDUWHV VLPLODUHV VH SXHGHQ
FUHDUVLVWHPDVTXHVHDQDODYH]HVSHFLDOL]DGRV\
JHQHUDOL]DGRV\TXHVHDQFDSDFHVGHUHRUJDQL]DU
HVWUXFWXUDVLQWHUQDV\IXQFLRQHVTXHDSUHQGDQD
satisfacer los desafíos en las meras demandas.
/RVFXDWURSULQFLSLRVLQWHUDFWLYRVSDUDSHQVDUHQ
términos de organización cibernética y comporWDPLHQWR RUJDQL]DFLRQDO KRORJUi¿FR VHUtDQ UHGXQGDQFLD GH IXQFLRQHV YDULHGDG UHTXHULGD DSUHQGHU D DSUHQGHU \ HVSHFL¿FDFLyQ
mínima crítica.
%UHYHPHQWHFRQVLGHUDGRVODUHGXQGDQFLDHV
QHFHVDULDHQFXDOTXLHUVLVWHPDGHHVWHWLSRTXH
pretenda tener capacidad de autorganizarse y suSRQHFRQWDUFRQFDSDFLGDGH[FHGHQWHSDUDFUHDU
espacio libre para maniobrar; sin ella se cree
TXH HO VLVWHPD QR WLHQH FDSDFLGDG SDUD SHQVDU
y preguntarse cómo está trabajando. La idea de
YDULHGDGUHTXHULGDVXJLHUHSRUVXSDUWHTXHOD
GLYHUVLGDGLQWHUQDGHFXDOTXLHUVLVWHPDGHDXWR-
UUHJXODFLyQ GHEH FRLQFLGLU HQ YDULHGDG \ FRPSOHMLGDGFRQODVGHORVHQWRUQRVFRQORVTXHWLHQH
TXH WUDWDU (O SULQFLSLR GH DSUHQGHU D DSUHQGHU
GHEH YLQFXODUVH D OD FDSDFLGDG GH DVLPLODU ORV
procesos de aprendizaje de bucle simple y doEOHTXHSHUPLWHQDOVLVWHPDJXLDUVHSRUVtPLVPR FRQ UHIHUHQFLD D XQ FRQMXQWR GH YDORUHV R
QRUPDVDOWLHPSRTXHFXHVWLRQDVLWDOHVQRUPDV
proporcionan una guía apropiada de comportaPLHQWR (O SULQFLSLR GH HVSHFL¿FDFLyQ PtQLPD
FUtWLFDVXJLHUHTXHORVGLUHFWLYRV\DQDOLVWDVRUJDQL]DFLRQDOHVRUTXHVWDUiQODVFRQGLFLRQHVSHUPLVLYDVTXHSHUPLWDQDXQVLVWHPDHQFRQWUDUVX
YHUGDGHUDIRUPD
6LPRQVXJLHUHTXHla jerarquía es la manera en que la racionalidad limitada trata con la
complejidad \GLFHTXHORVVLVWHPDVFRPSOHMRV
SXHGHQ WHQHU p[LWR HQ FRQVHJXLU XQ HVWDGR UHJXODUVLORVSURFHVRVRFXUUHQGHVXEVLVWHPDHQ
VXEVLVWHPDVLHQGRFDGDXQRUHODWLYDPHQWHLQGHpendiente de los demás.
(QGH¿QLWLYDVHVXJLHUHTXHODVorganizaciones innovadoras deben diseñarse como sistemas
de aprendizaje poniendo especial interés en que
estén abiertas a la autocrítica y a las exigencias /DV YHUGDGHUDV RUJDQL]DFLRQHV LQQRYDGRUDVUHTXLHUHQODVFDUDFWHUtVWLFDV\HVStULWXKRORJUi¿FRV(OGHVDItRSDUDGLVHxDURUJDQL]DFLRQHV
TXH HQ YHUGDG VHDQ LQQRYDGRUDV HV MXVWDPHQWH
HO GHVDItR GH GLVHxDU RUJDQL]DFLRQHV TXH SXHGDQ DXWRRUJDQL]DUVH$ PHQRV TXH XQD RUJDQLzación sea capaz de PRGL¿FDUVH SRU Vt PLVPD
SDUDDFRPRGDUODVLGHDVTXHSURGXFH\YDORUDHV
SUREDEOHTXHEORTXHHHYHQWXDOPHQWHVXVSURSLDV
LQQRYDFLRQHV
ONTOGÉNESIS ORGANIZACIONAL Y ANATOMÍA
ESTRUCTURAL DE LA ORGANIZACIÓN
Siguiendo en este tema al gurú organizacional
+HQU\ 0LQW]EHUJ GLUHPRV TXH FXDOTXLHU WLSR
GH HVWUXFWXUD \ GH KHFKR FXDOTXLHU DFWLYLGDG UHTXLHUH HO FRQFXUVR GH GRV HOHPHQWRV IXQGDPHQWDOHV \ KDVWD FLHUWR SXQWR FRQWUDSXHVWRV
OD GLYLVLyQ GHO WUDEDMR HQ GLIHUHQWHV WDUHDV \ OD
coordinación subsecuente de estas tareas. Las
organizaciones están estructuradas para captar
\ GLULJLU VLVWHPDV GH ÀXMRV \ SDUD GH¿QLU ODV
interrelaciones entre las distintas partes. En la
EDVHGHFXDOTXLHURUJDQL]DFLyQHVWiQORVRSHUDULRVHVWRHVODJHQWHTXHHODERUDHOSURGXFWRR
EULQGD HO VHUYLFLR IXQGDPHQWDO GH OD RUJDQL]D-
94 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
La holografía demostró que es
posible crear procesos donde la
totalidad pueda ser codificada
en cada una de las partes
Más recientemente se ha
comparado con un sistema holográfico
El cerebro ha sido comparado
con muchas cosas: una computadora,
una central telefónica transfiriendo
información a través de impulsos
eléctricos. un sistema de televisión
capaz de embalsar imágenes
coherentes a partir de millones de
datos separados
LA BUROCRACIA GENERA
RACIONALIDAD LIMITADA POR EL
DISEÑO: UNO PARA TODOS PERO
NO TODOS PARA UNO
VENTAJAS
- Aporta comprensión al
problema del aprendizaje
organizacional
- Sugiere que las organozaciones
innovadoras deben diseñarse
como sistemas de aprendizajes
- Exigen que estén abiertas
a la autocrítica y las exigencias
Las organizaciones nunca pueden
ser TOTALMENTE RAZONABLES
porque los componentes tienen
capacidades limitadas para tramitar
la información (SIMON) SRL
LA ORGANIZACIÓN COMO CEREBRO
HACIA LA AUTOORGANIZACIÓN
La organización raramente es capaz de tolerar
altos niveles de incertidumbre y se tiene una
tendencia a querer “dejar las cosas como están”
- Los lleva a crear interpretaciones demasiado
simplificadas de las situaciones que están tratando
- Tienden a estar interesados en problemas sólo
si hay soluciones a mano
- Los asuntos complejos, que son difíciles de digerir,
se dejan de lado o se les quita importancia mientras
se gana tiempo para lograr soluciones de escape
o con esperanza de que el problema desaparezca
- Los portadores de malas noticias pocas veces
son bienvenidos
Lo mejor que puede obtenerse
en estas condiciones son
FORMAS LIMITADAS
DE RACIONALIDAD
La metáfora de la organización como
cerebro halla su base en la cibernética
o la habilidad de un sistema de mostrar
un comportamiento autorregulado
¿EN QUÉ CONSISTE UN SISTEMA
CIBERNÉTICO?
El secreto de la capacidad de los
cerebros parece depender más
de la asociatividad que de
la diferenciación estructural
En definitiva se sugiere que las
organizaciones innovadoras deben
diseñarse como sistemas de
aprendizaje poniendo especial
interés en que estén abiertas
a la autocrítica y a las exigencias
Una gran barrera del aprendizaje
de bucle doble es el:
- principio de la responsabilidad
burocrática, que
- responsabiliza a los empleados de
sus funciones y castiga el error
(mata al mensajero)
Los sistemas cibernéticos más
complejos, como el cerebro humano,
son capaces de aprender a
aprender y organizarse a si mismos
Cuadro 4.7: Metáfora de la organización como sistema holográfico
FLyQ$PHGLGDTXHHVWDFUHFH\VHFRPSOHML]D
DGRSWD XQD GLYLVLyQ GHO WUDEDMR HODERUDGD YROYLpQGRVH FDVL PDQGDWRULR WHQHU XQD HVSHFLH GH
gerente absolutoTXHHVWpHQORTXHSRGUtDPRV
OODPDUODFXPEUHHVWUDWpJLFD$VXYH]\DPHGLGDTXHODRUJDQL]DFLyQVHYXHOYHPiVHODERUDGD
VHUHTXLHUHQPiVJHUHQWHV±QRVyORJHUHQWHVGH
operadores sino gerentes de gerentes– creándose
FDVLLPSHUFHSWLEOHPHQWHXQDOtQHDPHGLDMHUDUTXtDGHDXWRULGDGHQWUHHOQ~FOHRRSHUDWLYR\OD
FXPEUH HVWUDWpJLFD $ PHGLGD TXH FRQWLQ~D HO
SURFHVRGHHODERUDFLyQHVSUREDEOHTXHODRUJDQL]DFLyQVHGLULMDFDGDYH]PiVDODHVWDQGDUL]DFLyQFRPRXQPHGLRGHFRRUGLQDUVXWUDEDMRUHcayendo la responsabilidad para buena parte de
HVWDHVWDQGDUL]DFLyQVREUHRWURJUXSRGHJHQWH
TXHSRGUtDPRVOODPDUORVDQDOLVWDVRWHFQyFUDWDV
RUJDQL]DWLYRVeVWRVIRUPDQODOODPDGDWHFQRHVWUXFWXUDIXHUDGHODMHUDUTXtDGHDXWRULGDGGHOtQHD(QFRQWUDPRVDVtGLYLVLyQPX\VLJQL¿FDWLYD
GHO WUDEDMR DGPLQLVWUDWLYR ±HQWUH DTXHOORV TXH
ORHIHFW~DQRVXSHUYLVDQ\TXLHQHVORHVWDQGDUL]DQRSDUDPHWUL]DQ)LQDOPHQWHODRUJDQL]DFLyQ
agregará unidades de staff de una naturaleza algo
GLIHUHQWHQRSDUDHIHFWXDUHVWDQGDUL]DFLyQVLQR
SDUDSURYHHUVHGHVHUYLFLRVTXHSXHGHQVHUGHVde una cafetería hasta un departamento de consejo legal o de relaciones públicas.11 Llamamos
a esta gente el staff de apoyo. Esto nos da cinco
partes básicas de la organización: el núcleo opeUDWLYRHQODEDVHXQLGRDODFXPEUHHVWUDWpJLFD
HQHOFXOPHQSRUODOtQHDPHGLDFRQODWHFQRHV-
6LELHQpVWDIXHVLHPSUHODGLYLVLyQFRQFUHWDSURSXHVWDSRU0LQW]EHUJFLHUWDPHQWHKD\PXFKDV\QRWRULDVGLIHUHQFLDVHQWUHXQDFDIHWHUtD\XQFRQVHMHUROHJDOSRUHMHPSOR0LQW]EHUJXELFDHQSDUWHGHVXREUDHQWUHORVPLHPEURV
GHOVWDIIGHDSR\RDODFRQVHMHUtDOHJDO\VLELHQGLFHTXHHQRFDVLRQHVHOVWDIIGHDSR\R\ODWHFQRHVWUXFWXUD¿JXUDQ
XQLGDV\HWLTXHWDGDVVLPSOHPHQWHFRPRVWDIIHQRWUDSDUWHVHSDUDODVQRFLRQHVQXHYDPHQWHGLFLHQGRTXHHOVWDIIGH
DSR\RQRSXHGHYHUVHHQSULPHUDLQVWDQFLDFRPRFRQVHMHUR
11
4 - Fundamentos de estructura y diseño organizacionales / 95
Cumbre estratégica responsabilidad
general de la organización
Junta directiva
Presidente
Director
Médico
Línea media: Jerarquía de
autoridad entre el núcleo
operativo y la línea media
Vicepresidente de operaciones y Marketing
Jefes de departamento
Recepción
Imprenta
Biblioteca
Cafetería
Enfermería y servicios
Complementarios
Planeamiento estratégico
Analistas
Estudio de trabajo
Comités hospitalarios
Capataces y supervisores
jefes de unidad
Tecnoestructura, analistas fuera
de la línea de trabajo operacional.
Centran su atención en el
diseño y funcionamiento de la
estructura
Operarios, vendedores,
transportadores, médicos
Núcleo operativo, trabajo básico
de producir los productos y brindar los
servicios
Staff de apoyo
Suministran apoyo a la
organización fuera de su
corriente de trabajo operacional
Cuadro 4.8: Estructura organizativa según Mintzberg
tructura y el staff de apoyo de cada lado. Esta
conformación tipo puede sufrir deformaciones o
GLVWRUVLRQHVGHDFXHUGRDODRUJDQL]DFLyQGHTXH
se trate (véase más adelante). El término gerencia intermedia –o con mayor amplitud y en esSHFLDOHQWUHQRVRWURVmandos medios±HVHQJHQHUDOSREUHPHQWHGH¿QLGRSRUORJHQHUDOSDUHFH
incluir a todos los miembros de la organización
TXH QR HVWiQ QL HQ OD FXPEUH HVWUDWpJLFD QL HQ
HOQ~FOHRRSHUDWLYR(QQXHVWURHVTXHPDSRUOR
WDQWRODgerencia intermedia comprendería tres
JUXSRV GLVWLQWRV ±ORV JHUHQWHV GH OtQHD PHGLD
los analistas y el staff de apoyo. Veamos algunas
FDUDFWHUtVWLFDVGLVWLQWLYDVGHFDGDXQD
(OQ~FOHRRSHUDWLYRGHODRUJDQL]DFLyQDEDUFDDDTXHOORVPLHPEURV±ORVRSHUDULRVGHDKtVX
QRPEUH±TXHUHDOL]DQHOWUDEDMREiVLFRUHODFLRnado directamente con la elaboración de producWRV \ VHUYLFLRV /RV RSHUDGRUHV UHDOL]DQ FXDWUR
IXQFLRQHVSULQFLSDOHV $VHJXUDQORVLQVXPRV
SDUDODSURGXFFLyQ FRQVLGHUDQGRFRPRQ~FOHR
RSHUDWLYRDOGHSDUWDPHQWRGHFRPSUDVTXHDG-
TXLHUHODVPDWHULDVSULPDV\DOGHSDUWDPHQWRGH
UHFHSFLyQ TXH ODV UHFLEH 7UDQVIRUPDQ ORV
insumos en producción. Algunas organizaciones
trasforman materias primas; otras trasforman
SDUWHV LQGLYLGXDOHV HQ XQLGDGHV FRPSOHWDV \
RWUDVWUDVIRUPDQLQIRUPDFLyQRJHQWHUHDOL]DQGRFRQVXOWRUtDVHGXFDQGRDOXPQRVFRUWDQGRHO
FDEHOORRFXUDQGRHQIHUPHGDGHV 'LVWULEX\HQ
ODVSURGXFFLRQHV±SRUHMHPSORYHQGLHQGR\GLVWULEX\HQGR ItVLFDPHQWH OR TXH VDOH GHO SURFHVR
GH WUDQVIRUPDFLyQ 3URYHHQ DSR\R GLUHFWR D
ODV IXQFLRQHV GH HQWUDGD WUDVIRUPDFLyQ \ SURducción. El núcleo operacional es el corazón
GHWRGDRUJDQL]DFLyQODSDUWHUHVSRQVDEOHGHOD
SURGXFFLyQHVHQFLDOTXHODPDQWLHQHYLYD3HUR
H[FHSWR ODV PX\ SHTXHxDV ODV RUJDQL]DFLRQHV
también necesitan componentes administratiYRV (O FRPSRQHQWH DGPLQLVWUDWLYR FRPSUHQGH
OD FXPEUH HVWUDWpJLFD OD OtQHD PHGLD \ OD WHFnoestructura.
(Q HO RWUR H[WUHPR GH OD RUJDQL]DFLyQ HVWi
ODFXPEUHHVWUDWpJLFD$TXtVHHQFXHQWUDQDTXH-
96 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
llas personas encargadas de la responsabilidad
general de la organización –el director general
\ WRGRV DTXHOORV JHUHQWHV GH DOWR QLYHO FX\RV
LQWHUHVHVVRQJOREDOHV7DPELpQHVWiQLQFOXLGRV
DTXpOORVTXHVXPLQLVWUDQDSR\RGLUHFWRDODDOWD
JHUHQFLD±VHFUHWDULRVDVLVWHQWHVHWF(QDOJXQDV
RUJDQL]DFLRQHVODFXPEUHHVWUDWpJLFDLQFOX\HDO
FRPLWpHMHFXWLYRRFRPLVLyQGLUHFWLYD/DFXPEUH HVWUDWpJLFD HVWi HQFDUJDGD GH DVHJXUDU TXH
la organización cumpla su misión de manera
HIHFWLYD\WDPELpQTXHVDWLVIDJDODVQHFHVLGDGHV
GHDTXpOORVTXHODFRQWURODQ TXHVHVDWLVIDJDOD
PLVLyQ\VHFXPSODFRQORVSRGHURVRV /DGLVWLQFLyQOtQHDVWDIIVyORVLJQL¿FDGLIHUHQFLDUDORV
LQYROXFUDGRV GLUHFWDPHQWH GH DTXpOORV LQYROXcrados de modo periférico en el trabajo operatiYRGHODVRUJDQL]DFLRQHVDXQTXHPXFKDVYHFHV
puede haber un área gris entre línea y staff.
(QHVWDMHUDUTXtDHOJHUHQWHGHOtQHDPHGLD
ejecuta una cantidad de tareas en la corriente de
OD VXSHUYLVLyQ GLUHFWD SRU HQFLPD \ SRU GHEDjo de él. Recoge información retroalimentada
feedback HQHOGHVHPSHxRGHVXSURSLDXQLGDG
y pasa una parte de ésta a los gerentes por enciPDGHpODPHQXGRFRPSOHWiQGRODHQHOSURFHVR DYHFHVGHIRUPiQGROD 7DPELpQLQWHUYLHQH
HQODFRUULHQWHGHGHFLVLRQHV$VFHQGLHQGRKD\
SUREOHPDVHQODXQLGDGSURSXHVWDVGHFDPELR
GHFLVLRQHVTXHUHTXLHUHQDXWRUL]DFLRQHV$OJXnas son tratadas por el mismo gerente de línea
PHGLD\SDVDRWUDVSDUDDFFLyQDXQQLYHOVXSHULRUHQODMHUDUTXtD'HVFHQGLHQGRHVWiQORV
UHFXUVRVTXHHOGHEHDVLJQDUHQVXXQLGDGODV
UHJODV\SODQHVTXHGHEHHODERUDU\ORVSUR\HFWRVTXHGHEHLPSOHPHQWDUDOOt&DGDJHUHQWHGH
línea media debe mantener contactos de enlaFHFRQRWURVJHUHQWHVDQDOLVWDVPLHPEURVGHO
VWDIIGHDSR\R\RWURVH[WHUQRVFX\RWUDEDMRHV
interdependiente con el de su propia unidad.
En la tecnoestructura encontramos a los anaOLVWDV \ VX VWDII GH HPSOHDGRV GH DSR\R TXH
VLUYHQDODRUJDQL]DFLyQDIHFWDQGRHOWUDEDMRGH
otros. Estos analistas están fuera de la corriente
GH WUDEDMR RSHUDFLRQDO ±SXHGHQ GLVHxDUOD SODQHDUODFDPELDUODRHQWUHQDUJHQWHSDUDTXHOR
KDJDSHURQRORKDFHQHOORVPLVPRV$VtODWHFQRHVWUXFWXUDHVHIHFWLYDVyORFXDQGRSXHGHXVDU
sus técnicas analíticas para hacer el trabajo de
RWURVPHMRURPiVHIHFWLYR¢4XLpQHVIRUPDQOD
tecnoestructura? Están los analistas encargados
GH OD DGDSWDFLyQ GH FDPELDU OD RUJDQL]DFLyQ
SDUDDGHFXDUOD\DTXHOORVHQFDUJDGRVGHOFRQ-
WUROGHHVWDELOL]DUHVTXHPDVGHDFWLYLGDGHQOD
organización. Si bien los llamados analistas de
FRQWUROGHODWHFQRHVWUXFWXUDVLUYHQSDUDOOHYDUD
cabo ciertas formas de estandarización en la orJDQL]DFLyQHVWRQRVLJQL¿FDTXHORVRSHUDGRUHV
no pueden estandarizar algo de su propio trabajo
–así como cada uno establece su propio proceGLPLHQWR SDUD YHVWLUVH HQ ODV PDxDQDV R SDUD
FRUWDUVHHOSHOR3HURHQJHQHUDOFXDQWDPiVHVWDQGDUL]DFLyQXVHODRUJDQL]DFLyQPiVFRQItDHQ
VXWHFQRHVWUXFWXUD7DOHVWDQGDUL]DFLyQUHGXFHOD
QHFHVLGDGGHVXSHUYLVLyQGLUHFWD±HVWRSDVDPX\
DPHQXGRHQHOKRVSLWDOSRUHMHPSOR±DYHFHV
SHUPLWLHQGR TXH ORV PLVPRV HPSOHDGRV ±PX\
FDOL¿FDGRVSRUFLHUWR±KDJDQORTXHDQWHVKDFtDQ
los gerentes.
([LVWHQYDULDVYLVLRQHVSRVLEOHVSDUDLPDJLQDUFyPRIXQFLRQD RTXpHVHQGH¿QLWLYD ODRUJDQL]DFLyQ$VtSXHGHFRQFHSWXDOL]DUVH–como
GLDJUDPDHO&XDGUR–FRPRXQDUHGGHÀXMRV
regulados –GH WUDEDMR GH SURGXFFLyQ D WUDYpV
GHO Q~FOHR RSHUDWLYR GH yUGHQHV H LQVWUXFFLRQHVEDMDQGRSRUODMHUDUTXtDDGPLQLVWUDWLYDSDUD
FRQWURODU HO Q~FOHR RSHUDWLYR GH LQIRUPDFLyQ
UHWURDOLPHQWDGD DSR\DGD HQ ORV UHVXOWDGRV \
de información y asesoramiento llegando desde
ORVODGRVeVWDHVXQDYLVLyQGHODRUJDQL]DFLyQ
compatible con las nociones tradicionales de
DXWRULGDG\MHUDUTXtDTXHSRQHPiVpQIDVLVVREUHODHVWDQGDUL]DFLyQTXHVREUHODVXSHUYLVLyQ
GLUHFWD7DPELpQSXHGHYHUVHFRPRXQVLVWHPD
GHFRPXQLFDFLyQLQIRUPDOHQIDWL]DQGRHOSDSHO
GHODMXVWHPXWXRHQODFRRUGLQDFLyQ/RTXHWHQHPRVDTXtHQUHDOLGDGHVXQsociograma –un
PDSD GH TXLpQ HQ UHDOLGDG VH FRPXQLFD FRQ
TXLpQ/RTXHHVWDYLVLyQGHODRUJDQL]DFLyQLQGLFDHVTXHH[LVWHQFHQWURVGHSRGHUQRR¿FLDOHV
HQODVRUJDQL]DFLRQHV\TXHODVJUDQGHVUHGHVGH
FRPXQLFDFLyQ LQIRUPDO VXSOHPHQWDQ \ D YHFHV
burlan los canales de autoridad y regulación. La
WHUFHUD YLVLyQ UHSUHVHQWD OD RUJDQL]DFLyQ FRPR
un sistema de constelaciones de trabajo. La base
GHODYLVLyQDTXtHVTXHODJHQWHVHDJUXSDFRQ
VXVSDUHV QRHQUHODFLyQFRQODMHUDUTXtD SDUD
hacer su trabajo. Cada grupo o constelación trata
con distintas decisiones apropiadas a su propio
QLYHOHQODMHUDUTXtD\HVWiXQLGRVyORÀRMDPHQte con los otros. En contraste con la organización como una especie de ordenado resorte en
HVSLUDO GH ODV GRV SULPHUDV YLVLRQHV \ FRQ OD
FRQIXVDWRUWDPDUPRODGDGHODWHUFHUDODYHPRV
como una especie de semiordenada torta en caSDV(QRWUDYLVLyQHQWpUPLQRVGHXQDIiEULFD
4 - Fundamentos de estructura y diseño organizacionales / 97
WtSLFDWHQHPRVWUHVFRQVWHODFLRQHVGHWUDEDMRHQ
XQQ~FOHRRSHUDWLYR–una encargada de la fabriFDFLyQXQDVHJXQGDGHODUPDGRXQDWHUFHUDGH
la distribución. Sobre ellas hay una constelación
GHSURGXFFLyQDGPLQLVWUDWLYDTXHDEDUFDDQDOLVWDV\VXSHUYLVRUHVGHFRQWDFWRHQFDUJDGDGHOD
programación de producción y la administración
general de planta. Por encima hay una constelaFLyQGHSURGXFWRVQXHYRVLQFOX\HQGRDQDOLVWDV
JHUHQWHVGHOtQHD\VWDIIGHDSR\R FRPRLQYHVWLJDGRUHV ([FOXVLYDPHQWH GHQWUR GHO VWDII GH
DSR\RKD\WUHVFRQVWHODFLRQHVHQFDUJDGRVGHOD
FDIHWHUtDGHSODQWDODLQYHVWLJDFLyQ\HOGHVDUUROOR )LQDOPHQWH HQ OD FLPD OD FRQVWHODFLyQ GH
¿QDQ]DV FRQHFWD D OD DOWD JHUHQFLD FRQ HO SHUVRQDOGHDSR\R¿QDQFLHUR\ODFRQVWHODFLyQGH
SODQL¿FDFLyQGHODUJRSOD]RXQHDORVDOWRVJHrentes con los analistas superiores de la tecnoesWUXFWXUD 3RU ~OWLPR SXHGH YHUVH XQD HVWDPSD
TXHUHSUHVHQWDODRUJDQL]DFLyQFRPRXQVLVWHPD
de procesos de decisión ad hoc.
6HDQ SXHV FLQFR YLVLRQHV R WHRUtDV VREUH
FyPRIXQFLRQDRTXpHVODRUJDQL]DFLyQ¢&XiO
HV OD FRUUHFWD" &ODUDPHQWH QLQJXQD HQ IRUPD
aislada o en sí misma. Cada una es una especie
GH VREUHVLPSOL¿FDFLyQ GH OD UHDOLGDG RUJDQL]DWLYD SHUR FDGD XQD WDPELpQ WLHQH XQD SDUWH GH
FLUJO DE AUTORIDAD FORMAL
YHUGDG6RORFRPELQiQGRODVFRPRHQHO&XDGUR
FRPHQ]DPRVDORJUDUXQD³VHQVDFLyQGHOD
YHUGDGHUDFRPSOHMLGDGGHOIXQFLRQDPLHQWRGHOD
RUJDQL]DFLyQ´
Mecanismos de coordinación
Varios mecanismos parecen describir las formas
IXQGDPHQWDOHVHQODVTXHFXDOTXLHURUJDQL]DFLyQ
FRRUGLQDVXWUDEDMR6XFLQWDPHQWHFRQVLGHUDGRV
son:
1. Adaptación mutua, TXHORJUDODFRRUGLQDFLyQ
por medio del proceso simple de la comunicación informal FRPR HO TXH WLHQH OXJDU
HQWUHGRVRSHUDULRV .
2. Supervisión directa, HQ HO TXH OD FRRUGLQDFLyQVHORJUDKDFLHQGRTXHXQDSHUVRQDHPLWD
yUGHQHVRLQVWUXFFLRQHVDRWUDVYDULDVFX\R
trabajo está interrelacionado como cuando
XQ MHIH OHV GLFH D RWURV OR TXH VH WLHQH TXH
hacerGDQGRXQSDVRGHWUiVGHRWUR 3. Normalización de los procesos de trabajo,
TXH DOFDQ]D OD FRRUGLQDFLyQ HVSHFL¿FDQGR
los procesos de trabajo de las persRQDVTXe
desempeñan tareas iQWHUUHODFLRQDGDV SRUOR
general esas normas se desarrollan en la tecnoestructura para su cumplimiento en el nú-
FLUJO DE COMUNICACIÓN INFORMAL
FLUJO DE PROCESO DE DECISIONES
CONJUNTO DE CONSTELACIONES
DE TRABAJO
FLUJO DE ACTIVIDAD REGULADA
Cuadro 4.9: Cinco ideas sobre el funcionamiento organizacional (tomado de Mintzberg)
98 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
FOHRRSHUDWLYRcomo en el caso de las instrucFLRQHVGHWUDEDMRTXHVXUJHQGHORVHVWXGLRV
de métodos y WLHPSRV 4. Normalización de los outputs TXHORJUDOD
coordinacióQ HVSHFL¿FDQGR ORV UHVXOWDGRV
GH GLIHUHQWHV WUDEDMRV WDPELpQ VH GHVDUURlla en la tecnoestructuracomo el caso de un
SODQ ¿QDQFLHUR TXH HVSHFL¿FD ORV REMHWLYRV
GHODVVXEXQLGDGHVRODVHVSHFL¿FDFLRQHVTXH
GH¿QHQODVGLPHQVLRQHVGHXQSURGXFWRTXH
VHYDDIDEULFDU .
5. Normalización de las habilidades (y los
conocimientos) VHJ~Q OD TXH ORV GLIHUHQWHV
WUDEDMRV VH FRRUGLQDQ HQ YLUWXG GH OD SUHSDUDFLyQ FRUUHVSRQGLHQWH TXH KDQ UHFLELGR
ORVWUDEDMDGRUHV FRPRHOFDVRGHORVPpGLcos especialistas –digamos un cirujano y un
DQHVWHVLVWD TXH HVWiQ HQ HO TXLUyIDQR– TXH
responden casi automáticamente a los procedimientos normalizados del otro .
6. Normalización de las reglas, según la cual
son las reglas TXHDIHFWDQHOWUDEDMRODVTXH
se controlangeneralmente para toda la organización SDUD TXH WRGR HO PXQGR IXQFLRQH
de acuerdo con el mismo conjunto de doctrinaV cRPRHQXQDRUGHQUHOLJLRVD Puede considerarsHTXHestos mecanismos de
coordinación son los elementos más básicos de
la estructuraXQDHVSHFLHGH aglutinante o pegamento TXHPDQWLHQHXQLGDODRUJDQL]DFLyQ. PareFHTXe siguen cierto ordeQDSUR[LPado: conforme el trabajo de la organización se hace más
complicadoel medio preferido de coordinación
parece desplazarsHGHVGHODDGDSWDFLyQPXWXD el
mecanisPRPiVVHQFLOORHQSULQFLSLRVLELHQHQ
última instancia es también el adoptado por orga-
Cuadro 4.10: Imagen de la organización holística (tomado y adaptado de Mintzberg)
4 - Fundamentos de estructura y diseño organizacionales / 99
QL]DFLRQHVVR¿VWLFDGDPHQWHFRPSOHMDVFRPRODV
DGKRFUDFLDV KDFLDOa superYisión direFWDOXHJR
hacia la normalización preferentemente de los
procesos de trabajo a reglasRde otro modode
los outputs o habilidadesreYLUWLHQGR¿QDOPHQWH
a la adaptación mutua Saradójicamente es también el mecanismo más capaz de manejar las
formas PiVFRPSOHMDVGHWUDEDMR . 'HVGHOXHJR
ninguna organización puede depender de uno
solo de estos mecanismos. Los mecanismos se
pueden sustituir de modo parcial unos por otros
pero todos se encontraránde manera representatiYaen toda organización razonablemente desarrollada. En particularla adaptación mutua y
la sXSHUYLVLyQ GLrecta son casi siempre importantesFRQLQGHSHQGHQFLDGHOXVRTXHse haga de
las Yarias formas de normalización.
DISEÑO ORGANIZATIVO
las TXH QR orgánicas. /D IRUPDFLyQ VLHPSUH
VHJ~Q0LQW]EHUJVHUH¿ere al uso de programas
formales de inVWUXFFLyQTXe proporcionan a las
personas y normalizan las habilidades y los coQRFLPLHQWRVUHTXHULGRVSDUa hacer trabajos concretos en las organizaciones. La formación es un
parámetro de diseño claYH HQ WRGR WUDEDMR TXH
llamamos profesional. Básicamente la formación y formalización son sustitutos mutuos para
ORJUDUODQRUPDOL]DFLyQ HQUHDOLGDGODEXURFUDtización GHOFRPSRUWDPLHQWR(QXQDlas normas se aprenden en forma de habilidadesen la
otrase imponen al trabajo en forma de reglas.
El adoctrinamiento VH UH¿HUH D ORV SURJUDPDV
\WpFQLFDVSRUPHGLRGHORVTXHVHQRUPDOL]DQ
las reglas de los miembros de una organización
SDUDTXHVHDQVHQVibles a las necesidades ideológicas de la misma \por tantose pueda con¿DUHQHOORVSDUDWRPDUGHFLVLRQHV\UHDOL]DUODV
actiYidades.
La esencia del diseño organizaWLYR HV OD Panipulación de una serie de parámetros TXH GHterminan la diYisión del trabajo y el logro de la
coordinación. Algunos de éstos tLHQHQ TXH Yer
con el diseño de posiFLRQHVLQGLYLGXDOHV y otroV
con el diseño de la superestructura el entramado global de las subunidades UHÀejado en el organigrama ; algunos con el diseño de enlaces
laterales para dar forma a esa superestructura;
y un último grupo tieQHTXHYHr con el sistema
para tomar decisiones de la organización.
La especialización del trabajo se re¿HUe al
número de tareas en un trabajo dado y el control
del trabajador sobre estas tareas. El trabajo está
especializado horizontalmente en cuanto Tue
abarca unas pocas tareas ELHQGH¿QLGDV\YerticalmentHHn FXDQWRTXHHOWUDEDMDGRUFDUHFe de
control sobre las tareas realizadas. Los trabajos
TXH UHTXLHUHQ Soca habilidad están muy especializados en ambos sentidos; ORV WUDEDMRV TXe
reTuieren mayor habilidad o profesionales están
especializados horizontal pero no Yerticalmente. El enriquecimiento del trabajo VHUH¿HUHDVX
ampliación en las dos dimensiones la Yertical
y la horizontal. La formalización del comportamiento VHUH¿HUHDODnormalizaFLyQ±HVWRHVD
bajarlos a una norma– de los procesos de traEDMRLPSRQLHQGRLQVWUXcciones opeUDWLYDVdescripciones del puesto de trabajo reglas reglamentos y similares. Las esWUXFWXUDVTXHGHSHQGHQ GH FXDOTXLer forma de normalización para
su coordinación se pueden llamar burocráticaV
La agrupación de unidades VH UH¿HUH D OD
elección de los criterios según los cuales los trabajos se agrupan en unidades \ esas unidades
HQ RWUDV GH RUGHQ PiV HOHYDGR. La agrupación
IRPHQWDODFRRUGLQDFLyQ\DTXHSRQHGLIHUHQWHV
WUDEDMRVEDMRXQDVXSHUYLVLyQFRP~Qal H[igirleVTXHcompartan recursos comunes y DGTXLHUDQ
PHGLGDVWDPELpQFRPXQHVGHFRPSRUWDPLHQWR
y al facilitarles la adaptación mutua entre ellos.
/RVGLYHUVRVFULWHULRVSDUDODDJUXSDFLyQ–procesos de trabajo productos clientes áreas y
DVtVXFHVLYDPHQWH– se pueden reducir en última
instancia a dos elementales: la función realizada
y el mercado DO TXH VH VLUYe. El tamaño de la
unidad VHUH¿HUe DOQ~PHURGHSXHVWRV RXQLGDGHV FRQWHQLGDVHQXQDVRODXQidad. Cuando el
WUDEDMRHVWiDOWDPHQWHQRUPDOL]DGR ELHQDFDXVD
de la formalizacLyQRGHODIRUPDFLyQ el tamaño de la unidad puede ser muy JUDQGHSRUTXHQR
KDFHPXFKDIDOWDXQDVXSHUYLVLyQGLUHFWD.
Los dispositivos de enlace VHUH¿HUHQDWRGD
una serie de mecanismos utilizados para fomentar la adaptación mutua entre y dentro de las
unidades. Van desde los puestos de enlaFH ORV
grupos de trabajo hasta las estructuras matriciales completamente desarrolladas.
Recordaremos en este punto la esencia de
la concepción de estructura de matriz\DTXH
funciona plenamente en el hospital. MencioQDPRV FRPR WUDVIRQGR TXH OD GLVWULEXFLyQ
estructural más común es por funciones –esto
HV IXQFLRQDO– HV GHFLU DJUXSD SHUVRQDV TXH
100 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
FRPSDUWHQ ODERUHV UHFXUVRV \ FRQRFLPLHQWRV
VLPLODUHV HQHOKRVSLWDOWRGRVORVFDUGLyORJRV
MXQWRV ORV REVWHWUDV HWF VL ELHQ DGHPiV KD\
una estratificación temática del conocimiento
±WRGRVVRQH[SHUWRVHQFDUGLRORJtD– y una por
así decir jerárquica\DTXHQRHVORPLVPRHO
FDUGLyORJRGHOFRQVXOWRULRH[WHUQRTXHHOGHOD
XQLGDGGHLQWHUQDFLyQ\HQHVWHFDVRWDPSRFR
HVLJXDOVLKDFHGRFHQFLDTXHVLQR &RPRIXHUHODUHSUHVHQWDFLyQ ILFFLRQDOHQJUDQPHGLGD GHHVWRHVHOFOiVLFRRUJDQLJUDPD/DVGHVYHQWDMDVFDUDFWHUtVWLFDVGHHVWDHVWUXFWXUDVRQ
XQD GHILFLHQWH FRRUGLQDFLyQ HQWUH IXQFLRQHV
identificándose los empleados con su propio
departamento y generándose una atmósfera
GHUHQXHQFLDDOWUDEDMRHQHTXLSRSDUDORJUDU
ODV PHWDV RUJDQL]DFLRQDOHV UHFXpUGHVH FyPR
estaban dispersos y aislados los feudos medieYDOHV /DVGHFLVLRQHVVHDFXPXODQHQHOQLYHO
VXSHULRU OR TXH VXHOH SURYRFDU FDUJD H[FHVLYD SDUD ORV JHUHQWHV HQ HVWRV QLYHOHV \ HVWR
SXHGH SURYRFDU GHFLVLRQHV GHPDVLDGR OHQWDV
o inapropiadas. La estructura funcional hace
TXHORVHPSOHDGRVVHFRQFHQWUHQHQODVPHWDV
\DFWLYLGDGHVGHWLSRIXQFLRQDO/RVFDPELRV
HQWRGDRUJDQL]DFLyQVRQGLItFLOHVGHOOHYDUD
ODSUiFWLFDHQXQDHVWUXFWXUDIXQFLRQDOSRUOR
TXHODVLQQRYDFLRQHVWLHQGHQDRFXUULUFRQPHnor frecuencia y el tiempo de respuesta es más
lento. Es difícil establecer la responsabilidad
por el desempeño. El desempeño global de
XQDRUJDQL]DFLyQHVWiLQWHJUDGRSRUDFWLYLGDGHVGHGLYHUVRWLSRLQYHVWLJDFLyQLQJHQLHUtD
ILQDQ]DVFRPHUFLDOL]DFLyQ&XDQGRODRUJDQL]DFLyQ WLHQH p[LWR R IUDFDVD OD FRQWULEXFLyQ
de cada uno de los departamentos puede no
ser identificada correctamente. Las preguntas
respecto a si el fracaso del producto se debió
D XQD LQIRUPDFLyQ GH PHUFDGR LQDGHFXDGD D
XQ GLVHxR R D XQD SURGXFFLyQ LQHILFLHQWH QR
se pueden contestar. La capacitación de la geUHQFLDJHQHUDODGHPiVVXHOHVHUOLPLWDGD\D
TXHODPD\RUtDGHORVHPSOHDGRVDYDQ]DQSRU
ODMHUDUTXtDGHODRUJDQL]DFLyQDWUDYpVGHORV
GHSDUWDPHQWRVIXQFLRQDOHVSRUORTXHVXH[SHULHQFLDHVWiOLPLWDGDDDFWLYLGDGHVHVSHFLDlizadas.
En contra de esta conformación estructural
VHGHVDUUROODODHVWUXFWXUDGHXQLGDGHVDXWRVX¿FLHQWHVRSRUSUR\HFWRV RUHVXOWDGRV DTXtODV
DFWLYLGDGHVIXQFLRQDOHVQHFHVDULDVSDUDREWHQHU
determinado resultado se asignan a una sola diUHFFLyQ±RUHVSRQVDEOHFRQRFLGRFRPROtGHUGH
proyecto. En el ámbito sanitario esto podría ser
XQSURJUDPDGHVDOXG0XFKDVRUJDQL]DFLRQHV
SRU RWUD SDUWH QR HVWiQ RUJDQL]DGDV FRPR HVWUXFWXUDVELHQIXQFLRQDOHVSXUDVELHQSRUSURGXFWRV SXUDV VLQR TXH DO DXPHQWDU GH WDPDxR
VH UHRUJDQL]DQ HQ XQLGDGHV DXWRVX¿FLHQWHV GH
algún tipo; éstas se llaman estructuras híbridas.
CUERPO
CLÍNICO
-»$)#/3
COORDINACIÓN JERÁRQUICA VERTICAL
CONSEJO
ADMINISTRACIÓN
(DIRECTOR)
ENFERMERÍA
SERV. SOCIAL
NUTRICIÓN
PEDIATRÍA
OBSTETRICIA
EMERGENCIA
OTROS
COORDINACIÓN HORIZONTAL O LATERAL
(EN EQUIPO)
* Representación de departamento en team o equipos
Cuadro 4.11: Hospital como organización matricial (tomado de las series Paltex, OPS)
ETC.
4 - Fundamentos de estructura y diseño organizacionales / 101
$OJXQDVGHHVWDVRUJDQL]DFLRQHV FRPRHOKRVSLWDO HQYH]GHFRQWDUSRUVHSDUDGRFRQHVWUXFWXUDVIXQFLRQDOHVRKtEULGDVJHQHUDQXQDMHUDUTXtDGXDOTXHDIHFWDDFDGDGHSDUWDPHQWRGHQWUR
GHODRUJDQL]DFLyQ ODHVWUXFWXUDPDWULFLDO ORV
jefes funcionales y los jefes de producto tienen
una autoridad parecida y muchos empleados reportan a ambos simultáneamente. Piénsese en la
HQIHUPHUDGHVDODTXHUHSRUWDDVXMHIHRUJiQLFR
y al mismo tiempo al jefe de sala. La estructura
PDWULFLDO YLROD HO SULQFLSLR GH XQLGDG GH PDQdo de la administración clásica y presupone una
armónica relación entre los jefes de un mismo
DJHQWH/DTXLQWDHVHQFLDGHHVWDHVWUXFWXUDHVWi
HQ HO pQIDVLV SXHVWR HQ HO SURGXFWR ¿QDO PiV
TXH HQ OD FRQWULEXFLyQ IXQFLRQDO JHQHUDQGR
FRQIRUPDFLRQHV ÀH[LEOHV LQQRYDGRUDV \ GH
comportamiento adaptable. En algunas matriFHVGHRUJDQL]DFLyQQRREVWDQWHODVGLYLVLRQHV
IXQFLRQDOHV UHWLHQHQ PXFKR FRQWURO SLHQVH HQ
ORVGHSDUWDPHQWRVKRVSLWDODULRV FRQORTXHORV
HTXLSRV VRQ FRQMXQWRV GHQWUR GH OD HVWUXFWXUD
EXURFUiWLFDTXHVXHOHQVHUGLItFLOHVGHURPSHU
así y todo la organización de matriz ofrece un
PHGLR GH HOLPLQDU EDUUHUDV HQWUH HVSHFLDOLVWDV
permitiendo a los profesionales de diferentes
ámbitos fundir sus habilidades para atacar el
problema común.
6HJXUDPHQWH PXFKR GH OD LGHD GH PDWUL]
también está presente en la concepción de MatusFXDQGRKDEODGHODVGL¿FXOWDGHVGHODJHVtión pública y del encuentro entre el técnico y el
SROtWLFR VLHQGR TXH GH IRUPD UHLWHUDGD KHPRV
FLWDGR HQ HVWD REUD D 0DWXV WUDVFULELPRV XQD
parte sustancial de los conceptos comentados;
dice:
“/DJHVWLyQS~EOLFDHVHQJHQHUDOGHVLOXVLRnante. No apunta al blanco de los problemas. Su
FDOLGDGHVEDMD\HVWDFLRQDULD(QFRQWUDVWHODV
FLHQFLDVDYDQ]DQPLHQWUDVORVSUREOHPDVVRFLDles se acumulan. Las ciencias no parecen tener
LPSDFWR UHOHYDQWH HQ HO HQIUHQWDPLHQWR GH ORV
problemas sociales y en la calidad de la gestión
pública. Hay un abismo entre el retraso de la
SROtWLFD \ HO DYDQFH GH ODV FLHQFLDV« /D SUiFWLFDVRFLDOGHVERUGDODIRUPDFLyQSURIHVLRQDO\
FXDOTXLHUDVHDVXiPELWRH[LJHHQWUHRWUDVFXHV0DWXV&Teoría del juego socialop cit.
Las negritas son nuestras.
WLRQHVH[SOLFDUODUHDOLGDGLGHQWL¿FDU\SRQGHUDU
SUREOHPDVFDOFXODUVREUHHOIXWXURLQFLHUWRIRUPXODU\HYDOXDUDSXHVWDVVREUHSURGXFWRV\UHVXOWDGRVGHQXHVWUDVDFFLRQHVUHVROYHUFRQÀLFWRV
FRJQLWLYRVKDFHUDQiOLVLVHVWUDWpJLFRSDUDFRQVWUXLUYLDELOLGDG«HVWRV\YDULRVRWURVSUREOHPDV
VRQ FRPXQHV D OD SUiFWLFD VRFLDO \ QR VH WUDWD
GHSUREOHPDVVLPSOHVTXHSXHGHQUHVROYHUVHSRU
LQWXLFLyQ HQ OD SUiFWLFD PLVPD« 7DPSRFR VH
trata sólo de estos problemas abstractos horizonWDOHVGHODSUiFWLFD3RUVXQDWXUDOH]Dcualquier
problema social tiene un contenido transdepartamental que no reconocen las facultades
o departamentos de las Universidades y de las
ciencias. Esa interrelación transdepartamental
obliga al análisis de causas y efectos entre los
departamentos de las ciencias. Es el caso más
común de las relaciones entre la política y la
HFRQRPtD«HOHFRQRPLVWDTXHIRUPXODSROtWLFDV
HFRQyPLFDV \ HO PpGLFR TXH KDFH SROtWLFDV GH
VDOXGHQHOiPELWRSXEOLFRFRQVXIRUPDFLyQHQ
IDFXOWDGHVXQLYHUVLWDULDVYHUWLFDOHVQRVSDUHFHQ
HVWDUHQVXFDPSRGHFRPSHWHQFLDDSHVDUGHOD
frecuencia de sus fracasos en la gestión pública.
3HUR QR HV DVt 6yOR WLHQHQ FRPSHWHQFLD SDUD
realizar una práctica profesional intradepartamental. No tienen la formación necesaria para
ejercer la práctica social horizontal. Sabemos
que un problema de salud no es únicamente
un problema de medicina, sino que al mismo
WLHPSR HV SROtWLFR HFRQyPLFR RUJDQL]DWLYR
HFROyJLFR HWF 6LQ HPEDUJR DFWXDPRV FRPR
si el sentido común pudiese procesar esas interacciones intradepartamentales. No pensamos que cualquier práctica social es transdepartamental y presenta problemas teóricos
comunes, repetitivos y complejos. No pensaPRV HQ XQD FLHQFLD GH OD DFFLyQ SUDFWLFD TXH
procese esos problemas comunes… la práctica
VRFLDO KRUL]RQWDO TXH VH HMHUFH HQ HO iPELWR
S~EOLFRFUX]DORVGHSDUWDPHQWRVGHODVFLHQcias en dos sentidos:D JHQHUDUHODFLRQHVWUDQVGHSDUWDPHQWDOHV GH FRQWHQLGR TXH REOLJDQ DO
análisis del intercambio de problemas entre los
GLVWLQWRVGHSDUWDPHQWRVSRUHMHPSORYDORUDUOD
H¿FDFLD SROtWLFD versus OD H¿FDFLD HFRQyPLFD
HYDOXDUORVHIHFWRVSROtWLFRVGHODDFFLyQHFRQyPLFD\YLFHYHUVDHWF\E SURGXFHSUREOHPDV
FRPXQHVTXHVRQLQKHUHQWHVDODSUiFWLFDVRFLDO
102 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
la cual no reconoce la división vertical por deSDUWDPHQWRV VyOR GLVWLQJXH SUREOHPDV Este
VHJXQGR DVSHFWR HV H[DFWDPHQWH HO WHPD GH OD
WHRUtD GH OD SUiFWLFD \ VH UH¿HUH D DSUHFLDU VLWXDFLRQHV\SURFHVDUSUREOHPDVKDFHUDSXHVWDV
EDMRLQFHUWLGXPEUHOLGLDUFRQODVVRUSUHVDVPDQHMDUFULVLVKDFHUDQiOLVLVHVWUDWpJLFRIRUPXODU
\HYDOXDUSODQHVHVWXGLDUDORVDFWRUHVGHOMXHJR
VRFLDOHYDOXDUHOFDPELRGHODUHDOLGDGGHOMXHJRGLVHxDURUHIRUPDURUJDQL]DFLRQHVH[SORUDU
QXHYRVFDPLQRVGHGHVDUUROORHWF«´
<HQRWUDSDUWH
“Las dirigencias políticas no reconocen su baja
capacidad de gobierno y no aciertan sobre las cauVDVGHVXGHVSUHVWLJLR7RGRVVHDXWRFDOL¿FDQGH
FDSDFHVSRUTXHQRVDEHQTXHQRVDEHQ«pVWHQR
HVVyORXQGLYRUFLRFDXVDGRSRULQWHUHVHVHQFRQWUDGRV\FDUHQFLDGHYROXQWDG(VWDPELpQHOSURGXFWR
de un abismo entre la política y las ciencias sociaOHVHQWUHOD practica y la teoría… los problemas
de la práctica no se parecen a los problemas de
las ciencias... no coinciden con los departamentos y las facultades de las universidades. Los
problemas de la práctica no están previamente
LGHQWL¿FDGRV \ IRUPXODGRV no pertenecen a
XQD FLHQFLD HVSHFt¿FD QR VRQ HVSHFLDOL]DGRV
ni son bien estructurados. La baja capacidad de
JRELHUQRTXHGRPLQDODSROtWLFDHVEDMDFDSDFLGDG
SDUDSURFHVDUORVSUREOHPDVUHDOHVHVGHFLUSDUD
procesar problemas cuasiestructurados… el poOtWLFR SUiFWLFR QR SURFHVD WHFQRSROtWLFDPHQWH
los problemas sociales… trabaja directamente
con soluciones… Los problemas de la práctiFDSROtWLFD\ORVSUREOHPDVGHODJHQWHFUX]DQ
KRUL]RQWDOPHQWH ORV GHSDUWDPHQWRV YHUWLFDOHV
del conocimiento que aporta la ciencia tradicional.$WUDYLHVDQODVIDFXOWDGHVGHODVXQLYHUVLGDGHV3RUVXSDUWHODVFLHQFLDVVRFLDOHVHVWiQGH
espaldas a los problemas prácticos de la política
y el gobierno. Se colocan en la misma posición
TXHODVXQLYHUVLGDGHV'LYLGHQDUWL¿FLDOPHQWHOD
realidad en compartimentos verticales que no
existen en la práctica. La frontera de cada cienFLD HV XQD QHFHVLGDG UHODWLYD \ XQD LPSRVLFLyQ
DQDOtWLFD H[LJLGD SRU OD LQYHVWLJDFLyQ FLHQWt¿FD
3HUR HVD IURQWHUD HV XQ OtPLWH FRQYHQFLRQDO
TXH QR H[LVWH HQ OD SUiFWLFD GHO MXHJR VRFLDO
(VDIURQWHUDTXHVyORHVWiWUD]DGDHQODPHQWHGHO
LQYHVWLJDGRUGL¿FXOWDODFRPSUHQVLyQ\ODDFFLyQ
VREUHORVSUREOHPDVGHODSUiFWLFDVRFLDO8QSUREOHPDFLHQWt¿FRQRHVXQSUREOHPDGHODSUiFWLFD
VRFLDO<KDVWDDKRUDHQODFRQFHSFLyQWUDGLFLRQDO
GHODVFLHQFLDVYHUWLFDOHV\GHWHUPLQLVWDV un proEOHPD VRFLDO QR HV XQ SUREOHPD FLHQWt¿FR. El
SULPHURHVXQGLVHxRFRJQLWLYR(OVHJXQGRHVXQ
diseño para la acción. Para formular un problema
FLHQWt¿FRXQLQYHVWLJDGRUDtVODXQDYDULDEOH\HVWXGLDVXVHIHFWRVSDUDDWULEXtUVHORVDHVDYDULDEOH
/DLQWHUURJDQWHFLHQWt¿FDWUDWDGHFRPSUHQGHUXQD
SDUFHODGHXQIHQyPHQR\SUHJXQWDSRUODUHODFLyQSXUD\OLEUHGHRWURVHIHFWRVFRQWDPLQDQWHV
HQWUHGRVYDULDEOHVTXHVHVXSRQHQUHODFLRQDGDV
/DFDXVDOLGDGFLHQWt¿FDHVXQDFDXVDOLGDGOLPpia, de laboratorio, intradepartamental, que
no es correspondiente con la causalidad transdepartamental del proceso social. Son dos tipos
GH FDXVDOLGDGHV GLVWLQWDV 8QD FRVD HV FDOFXODU
un efecto tal como lo apreciarían los ciudadanos
HQ OD YLGD SUiFWLFD \ RWUD GLVWLQWD HV FDOFXODU HO
HIHFWRGHXQDYDULDEOHVREUHRWUDYDULDEOHEDMRHO
supuesto de ceteris paribusSDUDFRPSUHQGHUOD
naturaleza pura de las relaciones entre ellas... un
SUREOHPDVRFLDOH[LVWH\VHIRUPXODSRUODLQWHUDFFLyQFRQMXQWDGHP~OWLSOHVYDULDEOHVHQXQDVLWXDFLyQFDUJDGDGHSUREOHPDV\VHHVWXGLDSDUDFRPprender y calcular un resultado de conjunto sobre
ODVLWXDFLyQD¿QGHWRPDUXQDGHFLVLyQVREUHORV
problemas. Se trata de PXOWLHIHFWRV RULJLQDGRV
por multicausas,LQWHJUDFLyQGHYDULDEOHV\HIHFWRVHQYH]GHDLVODPLHQWRGHYDULDEOHV\HIHFWRV
ODFRPSDUWDPHQWDOL]DFLyQYHUWLFDOGHODVFLHQFLDV
FUHDXQDEDUUHUDHQWUHHOWpFQLFR\HOSROtWLFRHVWLPXODODLGHRORJtDGHWHUPLQLVWDHQIDWL]DORVPLWRV
GHODSUHGLFFLyQ\ODPHGLFLyQFXDQWLWDWLYDIDFLOLWD
ODDPSXWDFLyQGHYDULDEOHVHQODFRQVWUXFFLyQGH
PRGHORVVRFLDOHVSRFRUHSUHVHQWDWLYRVy fomenta
ORVEDUEDULVPRVH[WUHPRVVHDQSROtWLFRVRWHFQRFUiWLFRV«ODVFLHQFLDVYHUWLFDOHVLJQRUDQOD
UD]yQWHFQRSROtWLFDGHOLQWHUFDPELRGHSUREOHmas14 entre sus diversos comportamientos… la
GHSDUWDPHQWDOL]DFLyQ GH ODV FLHQFLDV LPSLGH
DQDOL]DUFRQULJRUORVHIHFWRVSROtWLFRVGHODDFción económica y los efectos económicos de la
DFFLyQSROtWLFD«´
/DREUDGH0DWXVSDUHFHSRUPRPHQWRVLQDEDUFDEOHSRUORFRPSOHMDSUHFLVD\H[KDXVWLYD1RSRGHPRVH[WHQGHUQRVPiVHQHVWHSXQWRSHURUHPLWLPRVDOOHFWRUDSURIXQGL]DUHQODLGHDGH³LQWHUFDPELRGHSUREOHPDV´SUHVHQWH
HQVXREUDSRUVXDSRUWHHSLVWHPROyJLFRH[FHOVRDPXFKDWHPiWLFDWUDWDGDHQQXHVWUDREUD
14
4 - Fundamentos de estructura y diseño organizacionales / 103
La descentralizacLyQVHUH¿HUHDODGLIXVLyQ
del poder para tomar decisiones. Cuando todo el
poder reside en un solo punta de la organización
GHFLPRV TXH VX HVWUXFWXUa está centralizada; si
el poder está disperso entre muchos indiYiduos
decimos Tue está relatiYamente descentralizada. Se pueden describir al menos seis formas
dH GHVFHQWUDOL]DFLyQ FHQWUDOL]DFLyQ Yertical
y horizontal en Tue todo el poder reside en el
ápice estratégico; GHscentralización horizontal limitada VelectiYD HQTXHHOiSLFe estratégico comparte algún poder con la tecnoestructura
TXHQRUPalizó el trabajo de todos los demás; descentralización Yertical lLPLWDGD SDUDOHOD HQ
TXHDORVGLUHFWRUHVGHXQLGDGHVGHPHUcado se
les delega el poder para controlar la mayoría de
las deciVLRQHVUHODWLYDVDVXVXQLGDGHVGe línea;
GeVFHQWUDOL]DFLyQYHUWLFDOy horizontalHQTXH
la mayor parte del poder reside en el núcleo de
operacionesen el niYHl más bajo de la estructurD GHVFHQWUDOizacLyQ Yertical y horizontal
VHOHFWLYa eQ TXe el poder sobre diferentes decisiones está disperso entrHYDULRVOugares de la
organizaciónentre directiYosH[SHUWRVGHVWDII
RSHUDULRV Tue trabajan en eTXipRV D GiYHrsos
QLYHOHVjeráUTXLFRV\ GHVFHntralización puUD
eQTue el poder está compartido con más o menos igualdad entre todos los miembros de la organización.
ESTRUCTURA, CONTEXTO Y SISTEMA TÉCNICO
,QHYLWDEOHPHQWHHVWUXFWXUD\FRQWH[WRHVWiQUHODFLRQDGRV3RUHMHPSORFuantos más años tiene
una organizacióQ PiV Iormalizado es el comportamieQWR HO OODPDGR VtQGURPH GH ³estar de
YuelWD GH WRGR´15 A mediGD TXH HQYHMHFHn las
organizacionestienden a repetir sus comportamienWRVHQFRnsecuenciaéstos son más predecibles y mucho más susceptibles de formalizar.
Cuanto más grande es una organización más
formalizado es su comportamiento. Asimismo
cuanto más grande es una organización más
elaborada es su estructura; esto es más especializados son sus puestos de trabajo y unidades y más desarrollados son sus componentes
adminisWUDWLYRV. A medidDTue crece el tamaño
de las organizacionHVpVWDVVRQFDSDces de especializar sus trabajos con más meticulosidad.
/D SHlXTuería grande puede permitirse tener
un especialista para cortar el pelo a los niños;
la pHTueña no. En consecuenciatambién pueden especializar –o diferenciar– el trabajo de
sus unidades con más amplitud. Esto H[ige un
mayor esfuerzo de coordinación y asíla organización grande tiende también a incrementar la
jHUDUTuía para efectuar una superYisión directa y
hacer más uso de su tecnoestructura para lograr
la coordinación por medio de la normalización
o bien fomentar la coordinación por medio de la
adaptación mutua.
El sistema técnico se re¿Hre a los instrumentos usados en el núcleo de operaciones para producir los outputs. Cuanto más regulado esté el
sistema técnico –esto eVFuanto más controle el
trabajo de los operarios–más formalizado estará
el trabajo de los operarios y más burocratizada la
estructura del núcleo de operaciones. Los sistemas técnicos TXe regulan el trabajo de los operarios –por ejemploen las líneas de montaje de
producción en serie– haceQ TXH ese trabajo sea
altamente rutinario y predeciblHy faYorecen así
su especialización y formalización Tuea sXYH]
crean las condiciones burocráticas en el núcleo de
operaciones. Cuanto más complejo sea el sistema
técnicomás elaborado y profesional será el staff
de apoyo. En esenciaVi una organización Ya a utilizar maTXLQDULa complicadDWLHQHTXe contratar
a e[pertos de stDIITXe conozcan esa maTXLQaria
–TXH Wengan capacidad para diseñarla VHleccionarla y PRGL¿Farla. Y OXHJROHVWLene TXHFRQFHder un poder considerable para tomar decisiones
relatiYDs a eVD PDTXLQariD y estimularlos a TXH
usen los disposLWLYRV GH enlace para asegurar la
adaptación mutua entre ellos. La automatización
del núcleo de operaciones transforma una estructura DGPLQLVWUDWLYa burocrática en otra orgánica.
Cuando el trabajo no especializado se coordina
por medio de la normalización de los procesos
de trabajR tendemos hacia una estructura burocrática H[tendida por toda la organizacióQ\D
TXe una mentalidad controladora impregna todo
el sistema. Pero cuando el trabajo del núcleo de
operaciones se automati]Dlas relaciones sociales
suelen cambiar. Ahora son las máTXLQDV no las
personDVlas TXe se regulan. AstWLende a desaparecer la obsesión por el control –las máTXLQas no
necesitaQTXHVe las Yigile– y junto con esta desaparición tambiéQVHYan muchos de los directiYRV
«TXHPXFKDVYHFHVTXLHUHGHFLUTXHQRIXHURQQXQFDDQLQJXQDSDUWH«
15
104 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
y analistas TXe hacían falta para controlar a los
operarios. En su lugaUYLenen los especialistas de
apoyo para cuidar de la maTXLQariDcoordinando
su trabajo por medio de la adaptación mutua. Por
tantola automatización reduce la línea de autoridad a faYRUGHORVH[pertos de staff y reduce la
tendencia a depender de la normalización para
conseguir la coordinación.
El entorno se re¿HUHDYDrias características del
FRQWH[WRH[terno de la organizacióQUelacionado
con los mercadoV el clima político las condiciones económiFDV\DVtVXFHVLYamente. Cuanto
más dinámico sea el entorno de una organización
más orgánica será su estructura. Es lógico Tue en
un entorno estable –cuando nada cambia– una
organización pueda predecir sus condiciones futuras y así siendo igual todas las demás cosas
puede fácilmente depender de la normalización
para conseguir la coordinación. Pero cuando las
condiciones son dinámicascuando la necesidad
de cambiar el producto es frecuentela rotación
de la mano de obra es eleYada y las condiciones
políticas son inestables –la organización no se
puede norPDOL]DUVLQRTXe tieQHTXHPantenerse
ÀH[LEOHhaciendo uso de la supeUYisión directa o
la adaptación mutua para conseguir la coordinacióQ\de este modo tieQHTXHXVDUXQa estructura
más orgánica. Así por ejemplolos ejércitosTXH
tienden a ser instituciones altamente burocratizadas durante los tiempos de pa]puHGHQYolYerse
bastante orgánicos cuando esWiQ LQYRlucrados
en asuntos bélicos muy dinámicos tipo guerrilla.
Cuanto más complejo sea el entorno de una organizaciónmás descentralizada será su estructura.
La razón fundamental para descentralizar una estructura es TXHWRGDOa información necesaria para
tomar decisiones no puede estar encerrada en una
sola cabeza. Por tantoFuando las operaciones de
una organización se basan en un cuerpo complejo
de conocimientoV normalmente hace falta descentralizar el poder para tomar decisiones. ObVpUYese TXe un entorno simple puede ser estable
o GLQiPLFR el fabricante de Yestidos se enfrenta
a un entorno simple perosin embargono puede
predecir el estilo de una temporada DRWUD Dl igual
TXe puede serlo uno complejo el especialistDTue
realiza una cirugía muy precisa a corazón abierto
se enfrenta a una tarea complejapero sabe TXe
puede espeUDU . Cuanto más diYHrsL¿cados sean
los mercados de una organización Payor será
la propensióQDGLYLGLUse en unidades basadas en
el merFDGRRGLYisionesdada una economía de
escalDIDYorable. Cuando una organización puede ideQWL¿FDUGLstintos mercados –regiones geográ¿cas clientes pero especialmente productos
\ VHUYLcios– estará predispuesta a diYLGLUse en
unidades de alto QLYHOVHJ~Qesa bDVHy a darle
a cada una buena cantidad de control sobre sus
propias operaciones. La hostilidad H[trema del
entorno hace TXHXQDorganización centralice su
estructura proYLsionalmente. Cuando está amenazada por una hostilidaGH[WUema del entornouna
organización tiene tendencia a centralizar el poderen otras palabrasYolYer a su mecanismo de
coordinación más rígido la VXSHUYLVLyQ GLUecta.
$TXtun solo líder puede garantizar una respuesta pronta y coordinada a la amenaza.
EL HOSPITAL, ¿BUROCRACIA PROFESIONAL O
MERITOCRACIA?
Dentro de la tipología organizacional de MintzEHUJ PX\ FRPSOHMD FRPR SDUD FRQVLGHUDUOD HQ
GHWDOOH DTXt \ TXH FRQVLGHUD YDULDV especies orJDQL]DWLYDVPHQFLRQDUHPRVVtDODOODPDGDEXURFUDFLDSURIHVLRQDOTXHVHHQFXHQWUDHQKRVSLWDOHV
XQLYHUVLGDGHVHVWXGLRVMXUtGLFRVRFRQWDEOHVHVWR
HVFRQWH[WRVFRQSURIHVLRQDOHVGHOQ~FOHRRSHUDWLYRDPSOLDPHQWHHVSHFLDOL]DGRV(VWDRUJDQL]DFLyQ
contrata especialistas debidamente capacitados y
enseñados –profesionales– para el núcleo operatiYR\OXHJRVHOHVGDFRQVLGHUDEOHFRQWUROVREUHVX
propio trabajo. El profesional trabaja en forma reODWLYDPHQWHLQGHSHQGLHQWHGHVXVFROHJDVSHURHVWUHFKDFRQORVFOLHQWHV SDFLHQWHVHQQXHVWURFDVR TXHDWLHQGH7RGDHVWDFDSDFLWDFLyQHVWiGLULJLGDD
ODLQWHUQDOL]DFLyQGHQRUPDVSDUDVHUYLUDOFOLHQWH\
FRRUGLQDUHOWUDEDMRHQRWUDVSDODEUDVODHVWUXFWXUD
GHHVWDVRUJDQL]DFLRQHVHVHQHVHQFLDEXURFUiWLFD
pero mientras la burocracia mecánica16 genera sus
SURSLDV QRUPDV ODV GH OD SURIHVLRQDO VH JHQHUDQ
IXHUDGHVXVOtPLWHV HQODVXQLYHUVLGDGHV \VHHQfatiza la autoridad de naturaleza profesional. Es diItFLOFRQ¿DUHQRWUDVIRUPDVGHHVWDQGDUL]DFLyQ\D
TXHORVSURGXFWRVVRQGHPDVLDGRFRPSOHMRVFRPR
para ser estandarizados directamente por los analisWDV SLpQVHVHSRUHMHPSORHQXQDFLUXJtDFDUGtDFD
3RUHMHPSORXQDHPSUHVDDXWRPRWUL]FRQXQDFDGHQDGHPRQWDMHWtSLFDRLQFOXVRXQDHPSUHVDGHVHUYLFLRVFRPR
Mc Donald.
16
4 - Fundamentos de estructura y diseño organizacionales / 105
DFLHORDELHUWRTXHVyORSXHGHVHUHVWDQGDUL]DGDR
SDUDPHWUL]DGDSRUTXLHQHVODHIHFW~DQ DVLPLVPR
los productos del trabajo profesional no pueden ser
medidos con facilidad y así no se prestan a la estanGDUL]DFLyQ HOHMHPSORGHODDXGLWRUtDPpGLFD\ODV
UHVLVWHQFLDVLQKHUHQWHVTXHJHQHUDRHOGHODYDULDbilidad de la práctica profesionalYLHQHQDODPHQWH 6HSRGUtDHQWHQGHUDODEXURFUDFLDSURIHVLRQDO
como un repertorio de programas estándar ensamEODGRVTXHVRQDSOLFDEOHV\DSOLFDGRVDVLWXDFLRQHV
SUHGHWHUPLQDGDVOODPDGDVFRQWLQJHQFLDVWDPELpQ
estandarizadas. El profesional tendría así dos taUHDVEiVLFDVFODVL¿FDUODQHFHVLGDGGHOFOLHQWH±SDciente– y aplicar o ejecutar ese programa; la gente
HVFODVL¿FDGD\FRORFDGDHQFDVLOOHURVSRUTXHOOHYDUtDHQRUPHFDQWLGDGGHUHFXUVRVWUDWDUFDGDFDVR
FRPR~QLFR(OQ~FOHRRSHUDWLYRHVODSDUWHFUtWLFD
y crucial de esta estructura y dado el alto costo de
los profesionales tiene sentido respaldarlos tanto
FRPRVHDSRVLEOHSRUORTXHVHQHFHVLWDXQDSR\R
GHVWDIISDUDHIHFWXDUWRGRHOWUDEDMRGHUXWLQDTXH
pueda ser formalizado. El staff de apoyo clásico
HQORVKRVSLWDOHVHVWiGDGRSRUORVVHUYLFLRVFRPplementarios y muy especialmente por el departamento de enfermería. La tecnoestructura y la línea
PHGLDSRUVXSDUWHQRHVWiQGHPDVLDGRHODERUDGDV\DTXHSRUXQODGRHOWUDEDMRHVGLItFLOPHQWH
HVWDQGDUL]DEOHVHJ~QPHQFLRQDPRV\SRURWUROD
OtQHDPHGLDHVDQJRVWDSXHVH[LVWHSRFDQHFHVLGDG
GHVXSHUYLVLyQGLUHFWD VLELHQHVWRQRLPSOLFDTXH
QRH[LVWDRQRVHDLPSRUWDQWH /DSRFDQHFHVLGDG
GHVXSHUYLVyQGLUHFWDRLQFOXVRDMXVWHPXWXRSXHGH
\KDVWDWLHQGHDJHQHUDUXQLGDGHVRSHUDWLYDVPX\
JUDQGHV6HVXJLHUHTXHODEXURFUDFLDSURIHVLRQDO
HVXQDHVWUXFWXUDGHPRFUiWLFDSRUORPHQRVSDUD
ORVSURIHVLRQDOHVGHOQ~FOHRRSHUDWLYR \DTXHORV
profesionales no sólo controlan su propio trabajo
VLQRTXHWDPELpQEXVFDQFRQWURODUODVGHFLVLRQHV
DGPLQLVWUDWLYDVTXHORVDIHFWDQ SHURHVPHMRUGH¿QLUODFRPRXQDPHULWRFUDFLD Siguiendo a Varo
DGHPiVDFHSWDPRVODXELFDFLyQWRSRJUi¿FDGHORV
comités hospitalarios dentro de la tecnoestructura
RUJDQL]DWLYD HV GHFLU HQ HO HVWUDWR DQDOtWLFR TXH
SODQHD GLVHxD \ FDPELD LQFOXVR ORV SURFHVRV GH
trabajo en las organizaciones y funciona como aseVRUDGLUHFWDGHODDOWDJHUHQFLD ODGLUHFFLyQHQHVWH
FDVR &RPR KHPRV VHxDODGR ORV DQDOLVWDV GH OD
tecnoestructura se ocupan del diseño y la dirección
del sistema formal de control y adaptación. Como
tales ejercen un considerable papel como agentes
FRQ LQÀXHQFLD GHQWUR GH OD RUJDQL]DFLyQ SDUWLFLSDQGRDFWLYDPHQWHHQORVMXHJRVGHSRGHUTXHKDQ
sido descritos de modo magistral por Mintzberg
(véanse en otra parte de este libro)HQHVWHFDVR
en el llamado juego de la línea media versus la asesoría especializada. El enfrentamiento entre ambos
FRQ¿JXUDXQMXHJRGHSRGHUFOiVLFR(QIUHQWDODV
GHFLVLRQHV GH OD OtQHD PHGLD TXH WLHQH DXWRULGDG
formal contra los especialistas de la tecnoestructura
TXHWLHQHQSRGHUJUDFLDVDVXVKDELOLGDGHVHVSHFLDOHV/DDXWRULGDGGHHVWRV~OWLPRVHVSRUGH¿QLFLyQ
QR GLUHFWD HV GHFLU HO SHUVRQDO HVSHFLDOL]DGR QR
GHEHLQIRUPDUDORVDQWHULRUHVVLQRDQLYHOHVPiV
DOWRV GH OD MHUDUTXtD 3RU OR WDQWR DPERV JUXSRV
WLHQHQ XQ HVWDWXV SDUHFLGR SRGUtDPRV UHEDXWL]DU
HVWHMXHJRFRPRODULYDOLGDGHQWUHSULPRVKHUPDQRV &ODUDPHQWHHOREMHWLYRGHOMXHJRHVFRQWURODU
ODVGHFLVLRQHVWUDWDQGRORVGLUHFWLYRVGHUHWHQHUVX
capacidad de actuar de forma discrecional y los esSHFLDOLVWDV GH HOLPLQDU HVWD SUHUURJDWLYD (VWR OR
pueden hacer los últimos de dos maneras: como
consejeros pueden tratar de controlar la informaFLyQTXHJXtDODVGHFLVLRQHVRFRPRGLVHxDGRUHV
pueden imponer normas burocráticas para limitar
las posibilidades de los otros. En un sentido es
un enfrentamiento entre poder formal e informal;
XQRV WUDWDQ GH PDQWHQHU HO MXHJR HQ XQ QLYHO GH
mando y otros en uno de autoridad. Los asesores
GHODWHFQRHVWUXFWXUDVHPXHYHQDGHPiVFRQOLEHUWDGHQWUHORVQLYHOHVPiVDOWRVGHODMHUDUTXtDGH
TXLHQHVGHSHQGHQGLUHFWDPHQWHDSHODQGRDYHFHV
a la estrategia de la ropa suciaSXHVFRPRSDUWHGH
VXVLQYHVWLJDFLRQHVHQRWURVGHSDUWDPHQWRVSXHGHQ
GHVFXEULULQH¿FLHQFLDVHLQFRPSHWHQFLDVGHRWURV
para utilizar luego este conocimiento en contra de
VXVHYHQWXDOHVULYDOHV$GHPiVORVDQDOLVWDVTXHVH
HQFXHQWUDQIXHUDGHODMHUDUTXtDSXHGHQDPHQXGR
presentarse ante la dirección para conseguir el apo\RSDUDHOGHVDUUROORGHVXVSODQHVPLHQWUDVTXHOD
OtQHDPHGLDHYHQWXDOPHQWHQRSXHGHQLVLTXLHUD
SRQHUVHHQFRQWDFWRFRQORVTXHVHHQFXHQWUDQSRU
encima de ellos.
6HJ~QFRPHQWDPRVDQWHVODHVWUXFWXUDTXHHVWDPRVFRQVLGHUDQGRVHKDGH¿QLGRTXL]iFRQPiV
precisión como meritocracia. Ésta aparece en conGLFLRQHVTXHWLHQHQXQVLVWHPDWpFQLFRFRPSOHMR
Gestión estratégica de la calidad en los Servicios Sanitarios.
9pDQVH/HPXV-'$UDJXHV\2UR]9,QYHVWLJDFLyQHQ6LVWHPDV\6HUYLFLRVGH6DOXG5RVDULR&RUSXV\
WDPELpQGHORVPLVPRDXWRUHV$XGLWRUtD0pGLFD\3URIHVLRQDO,QWHJUDO5RVDULR&RUSXV
106 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
TXHREOLJDDFRQ¿DUHQODFXDOL¿FDFLyQGHORVDJHQtes; se da de preferencia en estructuras como las
EXURFUDFLDVSURIHVLRQDOHVHQODVTXHFDGDHVSHFLDOLVWDWUDEDMDDXWyQRPDPHQWHHQHOQ~FOHRRSHUDWLYR
aplicando técnicas estandarizadas. Hay dos formas
básicas de meritocracia: federativas: entorno estaEOH\IiFLOGHSUHGHFLUORVH[SHUWRVSXHGHQDSOLFDU
directamente procesos estandarizados a las necesiGDGHVGHORVFOLHQWHV\WUDEDMDUHQIRUPDUHODWLYDPHQWHDXWyQRPDHQHOQ~FOHRRSHUDWLYR\ODVcolaborativas:ODVQHFHVLGDGHVQRSXHGHQ¿MDUVHGH
DQWHPDQR\HQFRQVHFXHQFLDORVH[SHUWRVGHEHQ
dedicar esfuerzos y habilidades para solucionar
cada caso. La burocracia profesional es una meriWRFUDFLDGHWLSRIHGHUDWLYR\DTXHORVH[SHUWRVVRQ
FRQWUDWDGRVSRUODRUJDQL]DFLyQSHURpVWRV¢FyPR
la consideran? Probablemente sea una estructura
GHFRQYHQLHQFLDHQODTXHSXHGHQSUDFWLFDUVXSURIHVLyQFRQDSR\RDGPLQLVWUDWLYRSHURUHWHQLHQGR
ellos control considerable sobre su propio trabajo
TXHHVSRURWUDSDUWHGHPDVLDGRFRPSOHMRFRPR
SDUDSRGHUVHUFRQWURODGRSRUORVGLUHFWLYRVRHQ
forma burocrática por los analistas; tampoco los
UHVXOWDGRVVHSXHGHQUHJXODUSRUTXHQRUPDOPHQWH
QRVHWUDWDGHREMHWLYRVRSHUDWLYRV(OSRGHUGHORV
H[SHUWRV SXHGH YHUVH DXPHQWDGR SRUTXH VXV VHUYLFLRVHVWiQPX\GHPDQGDGRV\HQFRQVHFXHQFLD
pueden dejar a la organización cuando lo deseen
HQFRQGLFLRQHVLGHDOHVORVVHUYLFLRVGHORVH[SHUtos son muy demandados y en consecuencia poGUtDQ GHMDU D OD RUJDQL]DFLyQ VL TXLVLHUDQ OR TXH
Mintzberg llama los cosmopolitasWpUPLQRFRQHO
TXHGHVLJQDDORVSURIHVLRQDOHVSOXULHPSOHDGRV\
YROiWLOHVHQFRQWUDSRVLFLyQDORVlocalesDOXGLHQGRDORVHPSOHDGRVDWLHPSRFRPSOHWRPiVFRPSURPHWLGRVFRQODRUJDQL]DFLyQ\DYHFHVKDVWDencadenadosDHOOD (QODVPHULWRFUDFLDVHOVLVWHPD
GHDXWRULGDG±QyWHVHDXWRULGDGQRSRGHU±WLHQGH
DVHUUHODWLYDPHQWHGpELO(OSRGHUGLVWULEXLGRHQ
base a la habilidad puede recordarnos en cierta
PDQHUDDXQDGHPRFUDFLDSHURHQUHDOLGDGODSDODEUDPHULWRFUDFLDHVPXFKRPiVDGHFXDGD\DTXH
ORTXHHQYHUGDGLPSRUWDHVHOtipo de habilidad
que se poseeVLHQGRTXHese poder no se distribuye
en forma equitativa, sino desigualmente en base
a las habilidades y conocimientos críticos para la
organización.$GHPiVHQODVPHULWRFUDFLDVODGLVtribución desigual de poder puede encontrarse en
XQDYDULHGDGGHQLYHOHVSRUTXHGLVWLQWRVWLSRVGH
H[SHUWRVWLHQHQGLVWLQWRVQLYHOHVGHKDELOLGDGGHVDUUROOiQGRVHHQWUHHOORVMHUDUTXtDVFRPRVXFHGH
HQWUHGRFWRUHV\HQIHUPHUDVHQWUHORVFLUXMDQRV\
RWURVPpGLFRVRLQFOXVRHQWUHSURIHVLRQDOHVDQilogos de la misma especialidad se dan diferentes
QLYHOHV MHUiUTXLFRV SRU HMHPSOR ORV PpGLFRV GH
sala y los de consultorio externoRSRUVXSXHVWR
los que dan cátedra Esto sucede cuando su trabajo es tan complejo
TXHWLHQHTXHVHUUHDOL]DGR\FRQWURODGRVyORSRU
SURIHVLRQDOHV \ DO PLVPR WLHPSR HV HVWDEOH GH
IRUPDTXHODVKDELOLGDGHVGHHVRVSURIHVLRQDOHV
se pueden perfeccionar por medio de programas
RSHUDWLYRVQRUPDOL]DGRV/DHVWUXFWXUDDGRSWDOD
IRUPDGHEXURFUDFLDSURIHVLRQDOTXHHVFRUULHQWH
CUMBRE ESTRATÉGICA: Dirección Médica
LÍNEA MEDIA: Jefes de División, Jefas de Sala
TECNOESTRUCTURA: Comisiones clínicas,
entre ellas de auditoría profesional
STAFF DE APOYO:
Enfermería, rayos, laboratorio
NÚCLEO OPERATIVO: Médicos
Cuadro 4.12: Las cinco partes de la organización en el contexto hospitalario
4 - Fundamentos de estructura y diseño organizacionales / 107
FRQFHQWUHQHQODLQQRYDFLyQGHODVVROXFLRQHVGH
QXHYRVSUREOHPDVVLQRHQODDSOLFDFLyQGHSURJUDPDVHVWiQGDUDSUREOHPDVELHQGH¿QLGRV/RPLVPRSDUHFHVHUFLHUWRHQHOFDVRGHORVKRVSLWDOHV
SRUORPHQRVHQORTXHFRQFLHUQHDTXHVXVVLVWHPDVWpFQLFRVVRQVHQFLOORV (QDTXHOODViUHDVTXH
A causa del poder de sus operarios profesio- UHTXLHUHQXQHTXLSRPiVVR¿VWLFDGR–en número
naleVDHVtas organizDFLRQHVVHODVGLEXMDDYH- FUHFLHQWHHQDSDULHQFLDHQHVSHFLDOHQODVLQVWLWXces como pirámiGHVLQYertidascon los operarios ciones de enseñanza– el hospital se orienta hacia
profesionales en la parte superior y los adminis- XQDHVWUXFWXUDKtEULGDFRQFDUDFWHUtVWLFDVGHODIRUtraGRUHVTXe los atienden .en la parte inferior. No PDLQQRYDGRUD3HURHVWDWHQGHQFLDHVWiPLWLJDGD
REVWDQWH semejante descripción menosprecia el por la preocupación primordial del hospital con la
poder de los administradores del trabajo profe- seguridad. 6yORVHSXHGHFRQ¿DUHQORTXHKDVLGR
sional DXQTXe pueda ser una descripción e[ac- SUREDGR\HVH[DFWRORTXHSURGXFHXQDDYHUVLyQ
WDGHDTXHOOas persRQDVTXHGLULJen las unidades QDWXUDO KDFLD OD FRQ¿JXUDFLyQ LQQRYDGRUD PiV
de apoyo. Para el staff de apoyo –a menudo más OD[D +DVWDDKRUDnuestros ejemplos han procedinumerosRTXHHl staff profHVLRQDOpero general- GRGHOVHFWRUGHVHUYLFLRV3HURODIRUPDSURIHVLRmente menos preparado– no hay democracia en nal también se puede encontrar en la fabricación
la organización profesionaltan sólo la oligaUTXta FXDQGRVHGDQODVFRQGLFLRQHVDQWHULRUHV7DOHVHO
de los profesionales. Así pues OR TXH DSDUHFH FDVR GH ODV HPSUHVDV DUWHVDQDOHV SRU HMHPSOR OD
frecuentemente en la organización profesional IiEULFDTXHHPSOHDDWUDEDMDGRUHVFDSDFLWDGRVSDUD
VRQMHUDUTXtDVSDUDOHODVXQDTXHYDGHDEDMRDUUL- fabricar productos de cerámica. El mismo térmiEDSDUDORVSURIHVLRQDOHV\XQDVHJXQGDPDTXLQDO no artesano LPSOLFDXQDFODVHGHSURIHVLRQDOTXH
aprende unas habilidades tradicionales por medio
de arriba abajo para el staff de apoyo.
GHXQODUJRDSUHQGL]DMH\DOTXHOXHJRVHOHSHUPLWH
SUDFWLFDUODVVLQVXSHUYLVLyQGLUHFWD
Cuándo se desarrolla la
HQ ODV XQLYHUVLGDGHV KRVSLWDOHV JHQHUDOHV HVWXGLRVFRQWDEOHVRMXUtGLFRVHWF7RGDVGHSHQGHQGH
las habilidades y conocimientos de sus profesioQDOHVRSHUDWLYRVSDUDIXQFLRQDUWRGDVSURGXFHQ
SURGXFWRVRVHUYLFLRVQRUPDOL]DGRV
organización profesional
La forma profesional de organización aparece donGHTXLHUDTXHHOWUDEDMRRSHUDWLYRGHXQDRUJDQL]DFLyQHVWpGRPLQDGRSRUWUDEDMDGRUHVSUHSDUDGRV
TXHXVHQSURFHGLPLHQWRVGLItFLOHVGHDSUHQGHUSHUR
SUHFLVDPHQWHGH¿QLGRV(VWRVXSRQHXQDVLWXDFLyQ
TXHHVDODYH]FRPSOHMD\HVWDEOH–ORVX¿FLHQWHPHQWHFRPSOHMDFRPRSDUDTXHKDJDQIDOWDSURFHGLPLHQWRVTXHVyORVHSXHGDQDSUHQGHUSRUPHGLR
GHXQDSUHSDUDFLyQDPSOLDSHURORVX¿FLHQWHPHQWH
HVWDEOHVFRPRSDUDTXHVXXVRSXHGDVHUQRUPDOL]DGR(OHMHPSORSULPRUGLDOGHODFRQ¿JXUDFLyQ
SURIHVLRQDOHVODRUJDQL]DFLyQGHVHUYLFLRSHUVRQDO
SRUORPHQRVODTXHWLHQHXQWUDEDMRFRPSOHMR\
HVWDEOHTXHGHSHQGDGHXQVLVWHPDWpFQLFRHODERUDGR/DVHVFXHODV\XQLYHUVLGDGHV¿UPDVFRQVXOWRUDVDVHVRUtDVMXUtGLFDV\FRQWDEOHV\R¿FLQDVGH
WUDEDMRVVRFLDOHVWRGDVHOODVGHSHQGHQGHHVWDIRUma de organizaciónPiVRPHQRVPLHQWUDVQRVH
Organizaciones supercomplejas
(OKRVSLWDOFRQIRUPDSDUDGLJPiWLFDPHQWHORTXH
hemos dado en llamar estructuras verdaderamente complejas o supercomplejas /HPXV -'
9$UDJHV\2UR] VLELHQFRPRREVHUYD
(WNLQ SDUD XQD VXHUWH GH LPDJLQDULR FROHFWLYRORVKRVSLWDOHVHVFXHODVHWFWLHQGHQDYHUVH
FRPRSDUDGLJPDVGHODVLPSOLFLGDGVLHQGRTXH
HQ UHDOLGDG VRQ OXJDUHV DWUDYHVDGRV SRU IXHU]DV
FRQWUDGLFWRULDVHQORVTXH³QRWLHQHPXFKRVHQWLGRGHGLFDUODYLGDDEXVFDUORPHMRUVLHQGRTXH
QHFHVDULDPHQWH HVR YD D FRQYLYLU FRQ OR PHQRV
PDOR´ (WNLQ %iVLFDPHQWHpVWDVORFDOL]DQ
HQ VX VHQR XQD DPSOLD GLYHUVLGDG GH IXQFLRQHV
REMHWLYRV\VXEVLVWHPDVDWHQFLyQPHGLFDHGXFDFLyQLQYHVWLJDFLyQKRWHOHUtDWHFQRORJtD\GLYHUsidad de personal: alguno con educación altamenWHVR¿VWLFDGD\RWURVLQHGXFDFLyQIRUPDOPXFKD
/HPXV-'9$UDJHV\2UR]³+RVSLWDOHV8QLYHUVLGDGHV\0LQLVWHULRVFRPRSDUDGLJPDVGHODVXSHUFRPSOHMLGDGRUJDQL]DFLRQDO´-RUQDGDV6$2$663$VRFLDFLyQ0pGLFD$UJHQWLQD
-RUJH(WNLQ/LFHQ$GPLQLVWUDFLyQ'LUHFWRUGHO'SWR3HGDJyJLFRGH$GPLQLVWUDFLyQ 8%$ DXWRUGHXQDSUROt¿FDREUD9pDQVHSRUHMHPSORSistemas y estructuras de organizaciones Viabilidad en las organizaciones
Burocracia en organizaciones públicas y privadas HWF
108 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
YLVLELOLGDGPHGLiWLFD\SHVRHQODRSLQLyQSXEOLFD
\GREOHOtQHDGHFRPDQGR\DXWRULGDG PpGLFD\
DGPLQLVWUDWLYDPL[LUUHVROXEOH VLWXDFLRQHVHQODV
TXHFDVLVLHPSUHVHGLULPHQODYLGD\ODPXHUWH
GL¿FXOWDGHQSRQGHUDURPHGLUHOIXQFLRQDPLHQWRGHODRUJDQL]DFLyQRVXUHQGLPLHQWRUHVXOWDGR
6REUHHVWHIRQGRODDXWRULGDGIRUPDOHVWiUHSUHVHQWDGDSRUXQÀXMRGHSRGHUEDMDQGRSRUODMHUDUTXtD HVWR HV XQ JUi¿FR GH OD RUJDQL]DFLyQ X
RUJDQLJUDPD DXQTXH PXFKDV YHFHV HV VyOR XQ
personograma (O RUJDQLJUDPD HV XQD ¿FFLyQ
VLVWHPDWL]DGDTXHREYLDDOJXQRVKHFKRVGHFLVLYRV
\UHDOHVGHFyPRIXQFLRQDQODVRUJDQL]DFLRQHVHV
FRPRXQPDSDHQFLHUWDPHGLGDLQYDORUDEOHSDUD
HQFRQWUDUFLXGDGHV\UXWDVTXHODVFRQHFWDQSHUR
TXHQRQRVGLFHQDGDGHODVUHODFLRQHVHFRQyPLcas o sociales de las regiones.
'HIRUPDVLPLODUDXQFXDQGRHORUJDQLJUDPD
no muestra relaciones informales puede sí repreVHQWDUXQDLPDJHQH[DFWDGHODGLYLVLyQGHOWUDEDMR
PRVWUDQGRDVLPSOHYLVWDTXpSRVLFLRQHVH[LVWHQHQ
ODRUJDQL]DFLyQFyPRHVWiQDJUXSDGDVHQXQLGDGHVFyPRÀX\HHQWUHHOODVODDXWRULGDGIRUPDO1R
REVWDQWHFDOODODVFRQ¿JXUDFLRQHVLQIRUPDOHV ODV
PiVUHDOHVGLJDPRV \WLHQHUiSLGDREVROHVFHQFLD
Debilidades del organigrama:
cortocircuitos, atajos, incrustaciones
Mención aparte y especialísima de las debilidades organigramáticas merecen los llamados cru-
FHV FRUWRFLUFXLWRV HIHFWRV GH by pass GHVYtR
DWDMRRGHULYDFLyQ HLQFUXVWDFLRQHV /HPXV-'
9$UDJHV\2UR] (QEUHYHOD¿FFLyQGHO
RUJDQLJUDPD VH HYLGHQFLD FRQ WRGD VX FUXGH]D
en situaciones como las llamadas de by pass en
ODVTXHSRUHMHPSORHOQ~PHURXQRGHODRUJDQL]DFLyQ XVXDOPHQWHHOGXHxRRIXQGDGRU XELca a una SHUVRQDGHFRQ¿DQ]D en posiciones del
RUJDQLJUDPD HQ ODV TXH VXSXHVWDPHQWH GHEHUtD
UHSRUWDUDXQMHIHSHURVXGHSHQGHQFLDUHDOHVKDFLD DTXpO JHQHUDQGR XQ ÀXMR GH LQIRUPDFLyQ \
autoridad anómalos –un cortocircuito o by pass–
hablamos también en algunos de estos casos de
incrustaciones\DTXHHVWDSHUVRQDHVWiDQRUPDOPHQWH LQVHUWD HQ OD HVWUXFWXUD VLQ XQD SRVLFLyQ
IRUPDO GH¿QLGD R H[SOtFLWD SHUR DGRSWDQGR PXchas funciones by proxyLOHJtWLPDVHQODPHGLGD
HQTXHQRREHGHFHQDQLQJ~QVXEVLVWHPDIRUPDO
en la organización (véase más sobre esto en el
capítulo de poder). Las incrustaciones y los corWRFLUFXLWRV PiV WtSLFRV \ QRWRULRV QR REVWDQWH
HVWiQGDGRVSRUODVFRQVXOWRUDV\VXVHTXLSRVTXH
LQYDGHQ H LQ¿OWUDQ ±VLHQGR VWDII– posiciones de
línea. Otra malformación usual de la estructura
está dada por los vacíos funcionales XQDHVSHFLH
GHFRUWRFLUFXLWRHQGH¿QLWLYD WDOHVTXHHQWUHHO
número uno y las posiciones más bajas del escaODIyQ GHODGLUHFFLyQRHOIXQFLRQDULDGR QRKD\
SXHVWRV LQWHUPHGLRV ~WLOHV FRQ IXQFLyQ \ QLYHO
RSHUDWLYRUHDOFRQFUHWR\H¿FLHQWH De resultas
GHHVWRODVSRVLFLRQHVLQIHULRUHVVHVREUHFDUJDQ\
PRESIDENTE
VICEPRESIDENTE
VICEPRESIDENTE
VICEPRESIDENTE
Jefe de
Jefe de
Jefe de
departamento departamento departamento
Jefe de
Jefe de
Jefe de
departamento departamento departamento
Jefe de
Jefe de
Jefe de
departamento departamento departamento
Supervisor
Supervisor
Operario
Operario
Operario
Supervisor
Supervisor
Operario
Operario
Cuadro 4.13: Esquema de un organigrama típico. El paralelogramo gris revela relaciones informales dentro
del esquema formal de fondo (tomado de Hodge).
(VWRLQFOX\HSXHVWRVSROtWLFRVSDUWLGDULRVRQRWHFQyFUDWDVGLYRUFLDGRVGHODUHDOLGDGSRUDEVROXWDOHMDQtDGLUHFFLRQHV³DFRQWUROUHPRWR´\RWUDVPLVFHOiQHDVWD[RQyPLFDV
4 - Fundamentos de estructura y diseño organizacionales / 109
H
HOSPITAL
??
Cuadro 4.14: Esquema de un cortocircuito o by pass estructural
recalientan±\¿QDOPHQWHSXHGHQIXQGLUVH– y las
SRVLFLRQHVVXSHULRUHVSHQGHQHQHOYDFtRVLQDQFODMHDORVQLYHOHVPiVoperativos por así decir.
Barbarismos estructurales análogos están dados por las llamadas estructuras fuera de nivel,
presentes en organizaciones altamente burocráWLFDVTXHLPSOLFDQODFUHDFLyQGHSXHVWRVRraviolesVXSHUSXHVWRVFRQHOQLYHOGHOtQHDVHSDUDGRVGHDTXHOORVSHURTXHDFW~DQFRPRWDOHV
Como se ha citadoSDUHFHPRVSURYHQLUGH
un molde cultural casi congénitamente rígido y
UXWLQDULRHQHOTXHPXFKDVRWRGDVODVGHFLVLRQHV
TXHPHUHFHUtDQHOQRPEUHGHHVWUDWpJLFDVVHWRPDQHQHOQLYHOVXSHULRUVLQREMHWLYRVFODURVHQ
ODFRWLGLDQHLGDGFRQSRFDRQLQJXQDFUHDWLYLGDG
\ROYLGRGHOFRQWH[WRORVPDQGRVPHGLRVWUDEDjan normalmenteEDMRSUHVLyQUHVXHOYHQDVXQWRV
XUJHQWHV ±WRGR HV ³SDUD D\HU´– y postergan los
LPSRUWDQWHVHQVXPDRUJDQL]DFLRQHVUXWLQDULDV
VLQDQiOLVLVGHVLWXDFLyQFRQSRFDGH¿QLFLyQGH
REMHWLYRV HVWUDWpJLFRV \ DFWLWXG HVWiWLFD FRPR
DGHFXDGD\JUi¿FDPHQWHVHKDGH¿QLGRYHUGDGHUDV³EyYHGDVPDHVWUDVGHO(VWDGRGH%LHQHVWDU´.
6RQ DGHPiV SRU OR JHQHUDO LQGLIHUHQWHV SRU HO
FRQVXPLGRUGHVXVVHUYLFLRV\FRQIXQGHQH¿FLHQFLDFRQH[FHVRGHDFWLYLGDGHVSODQWHDQGRVLHPSUHLQFRUSRUDFLyQGHPiVSHUVRQDO KRUDVH[WUDV
acostadasRPiVUHFXUVRVFRPR~QLFDDOWHUQDWLYD
SDUDVROXFLRQDUORVSUREOHPDV VHKLSHUWUR¿DGH
HVWH PRGR OD HVWUXFWXUD \ HQ FRQVHFXHQFLD VH
IUDJPHQWDHQDXWRULGDG\YHUVDWLOLGDGKDVWDOOHJDU
a ser sólo un enorme e informe grupo de gente
FX\R ~QLFR ¿Q SDUHFH VHU TXH QR VH GHWHQJD OD
JUDQPiTXLQDLQHUFLDOGHWDUHDVVHPSLWHUQDV±OD
PLVPDTXHSRURWUDSDUWHKDFHVREUHYLYLUDODRUganización aún cuando cambian las cabezas.
Esta estructura profesionalizada se segmenta en feudos o reinos formada por profesionales
TXHYDQLPSRQLHQGRVXVYLVLRQHVSDUFLDOL]DGDV\
muy localistas a la organización generando subHVWUXFWXUDV\VXEFXOWXUDVTXHUHVSRQGHQDSHU¿OHVHVSHFt¿FRVGHDFFLyQ&DGDMHIHYDDUPDQGR
VXVHFWRUGHDFXHUGRFRQORVUHTXHULPLHQWRVQHFHVDULRV SDUD OD REWHQFLyQ GH VXV REMHWLYRV HVSHFt¿FRVSHURVLQWHQHUHQFXHQWDHOWRGRYHUdadero serviciocentrismoTXHLPSUHJQDWRGDOD
organización.
+RVSLWDO3~EOLFRGH$XWRJHVWLyQ0DUFR&RQFHSWXDO(VWUDWHJLDVH,QVWUXPHQWRV2SHUDWLYRV06$6DEULO
-RVp-HV~V0DUWtQ\0DUWtQ:RUNVKRS8&(6%XHQRV$LUHV
110 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
(VWDYLVLyQWLHQHPXFKRTXHYHUFRQODFXOWXUDRUJDQL]DFLRQDO5HFRUGHPRVTXHHQ~OWLPD
LQVWDQFLDODVRUJDQL]DFLRQHVVRQFRPRSHTXHxDV
VRFLHGDGHV YLpQGRVH VX LQGLYLGXDOLGDG HQ VX
FXOWXUDSDUWLFXODU/DFXOWXUDGHFXDOTXLHURUJDQL]DFLyQVHH[SUHVDHQWUHVQLYHOHVEiVLFRV
‡$UWHIDFWRVHQWRUQRItVLFROHQJXDMHV MHUJDV ĺ QRPLQDFLRQHV GH HPSOHDGRV FRPR QRUGLHV OHQJXDMHV –en la escuela ¿QRFKLHWWLVta SRU HMHPSOR WRGRV LPSUHFDEDQ \ PDOdecían como el maestro pero pocos operaban como él; los aprendices aprendían más
TXHUiSLGRDPDOGHFLUa lo)LQRFKLHWWRD~Q
abriendo un simple absceso glúteo–; símbolos y productos.
‡9DORUHVFRPSDUWLGRVHVWUDWHJLDVREMHWLYRV\
¿ORVRItDV GHO OtGHU QR HV OR PLVPR HO DPbiente de la Fundación FavaloroTXHHOGHO
Sacre Coer ‡ 6XSXHVWRV EiVLFRV FUHHQFLDV SHUFHSFLRQHV
SHQVDPLHQWRVVHQWLPLHQWRVLQFRQVFLHQWHVGH
la organización. imagen de calidad
incorporan más personas y cambia la situación.
(QXQVHQWLGRODVHPSUHVDVLPLWDQODHYROXFLyQ
ELROyJLFD GH ODV HVSHFLHV VXSHUYLYHQFLD GH ODV
PiVDSWDV\H[WLQFLyQGHXQDVFXDQWDV–la ma\RUtD VH GLFH TXH OD FXOWXUD HV IXHUWH FXDQGR
impregna a todos los miembros de la organización y es una especie de molde férreo; por el
FRQWUDULRHVGpELOFXDQGRQRHVWiDFHSWDGDSRU
todos los miembros de la organización. La organización y el grupo únicamente maduran al tener
TXH KDFHU IUHQWH D FXHVWLRQHV GH VXSHUYLYHQFLD
\FUHFLPLHQWRDSUHQGLHQGRODQHFHVLGDGGHVHU
ÀH[LEOH\DGDSWDUVHDODVFDPELDQWHVFRQGLFLRnes del entorno.
0RUJDQGHOTXHKHPRVKDEODGRUHSHWLGDPHQWHWUDWDDODFXOWXUDWDPELpQFRPRXQDPHWiIRUD
GLFLHQGRTXHVXPD\RUIXHU]DUDGLFDHQTXHGLULJHODDWHQFLyQDOVLJQL¿FDGRVLPEyOLFRHLQFOXVR
PiJLFRGHPXFKRVDVSHFWRVGHODYLGDRUJDQL]DFLRQDO TXH VRQ FUXFLDOHV SDUD HQWHQGHU FyPR OD
RUJDQL]DFLyQIXQFLRQDGtDDGtD/DRUJDQL]DFLyQ
GLFH pO GHVFDQVD HQ XQ VLVWHPD GH VLJQL¿FDGRV
FRPSDUWLGRV \ HQ HVTXHPDV LQWHUSUHWDWLYRV GH
/D YLVLyQ \ DVSLUDFLRQHV GH ORV IXQGDGRUHV VLJQL¿FDGRVTXHVHFUHDQ\UHFUHDQFRQWLQXDPHQGHODRUJDQL]DFLyQDVtFRPRVXVYDORUHV\HOVHQ- WHDXQDVtORVQXHYRVHPSOHDGRVSXHGHQDSUHQGHU
tido de misión tienen un papel preponderante en DDFWXDUPDODQRKDFHUQDGD FXOWXUDHVWDWDOEXel establecimiento y asentamiento de la cultura URFUiWLFD /DFXOWXUDHVXQDHVSHFLHGHDJOXWLQDLQLFLDO VRQ ORV SULPHURV \ OH LPSULPHQ VX VH- GRURFHPHQWRQRUPDWLYRTXHGDVRSRUWHDWRGD
llo. Los fundadores establecen la primera cul- OD RUJDQL]DFLyQ 2WUD YHQWDMD GH OD PHWiIRUD HV
WXUD\HVWRHVWiD\XGDGRSRUHOSHTXHxRWDPDxR su aporte a la comprensión del cambio organizaGHLQLFLR HVWUXFWXUDVLPSOH VXFHVLYDPHQWHVH cional. Solemos pensar al hablar de cambio en el
8QDUHIHUHQFLDGHODWUD\HFWRULDGH(QULTXH)LQRFKLHWWRel divino será siempre limitada pero obligada. Ingresa a
OD)DFXOWDGGH0HGLFLQDGH%XHQRV$LUHVHQHQ\DHUDSUDFWLFDQWHGHO+RVSLWDOGH&OtQLFDV\HQVH
KDFHFDUJRGHO6HUYLFLRGHSLHO\HQIHUPHGDGHVYHQpUHDVGHO+RVSLWDO5DZVRQ(QWUH\YLDMDSRU(XURSD
YLVLWDQGRFOtQLFDVHQGLYHUVRVSDtVHV&XDQGRUHJUHVDDVHQWDGRHQHO+RVSLWDO5DZVRQHQVD\DPRGHUQDVWpFQLFDVTXLU~UJLFDVFRPRODFLUXJtDGHWLURLGHV(QWUH\DSUHQGHGLEXMRWpFQLFRSDUDSODVPDUHQHOSDSHOORVDSDUDWRV
TXHLGHDED\WHQtDHQPHQWH\HQHVWDDFWLYLGDGGHPRVWUyXQDKDELOLGDGIXHUDGHORFRP~Q VXVGLEXMRVVRQYHUGDGHUDV
REUDVGHDUWH (QWUH\YXHOYHD(XURSDKDFLpQGRVHFDUJRGHO6HUYLFLRGH&LUXJtDGHO+RVSLWDO$UJHQWLQR
HQ3DUtVGRQGHDWLHQGHDVROGDGRVKHULGRVGXUDQWHOD3ULPHUD*XHUUD0XQGLDO\REWLHQHXQDLQYDORUDEOHH[SHULHQFLD
TXLU~UJLFD/XHJRGHXQDHVWDGtDHQ1RUWHDPpULFDUHJUHVDDOSDtV\DPX\IDPRVR\HQIHUPRTXL]iGHVt¿OLV$JUDYDGD
VXHQIHUPHGDG)LQRFKLHWWRUHQXQFLDDOD&iWHGUDGH&OtQLFD4XLU~UJLFDHQ(VHDxRHO&RQVHMR6XSHULRUGHOD
8QLYHUVLGDGGH%XHQRV$LUHVORGHVLJQy3URIHVRU+RQRUDULR&RQWLQXyVXWDUHDGHFLUXMDQRHQHO5DZVRQGRQGHOR
FRQVXOWDEDQSDFLHQWHVGHWRGRHOSDtV\HOH[WHULRU(OGHPDU]RGHUHDOL]DODTXHVHUtDVX~OWLPDRSHUDFLyQ
6LJXLHQGRFRQODHVFXHOD¿QRFKLHWWLVWDVXHOHFLWDUVHODVLJXLHQWHDQpFGRWDFRPRHMHPSORGHODE~VTXHGDSHUPDQHQWHGHODFDOLGDGDXQGHPDQHUDLQWXLWLYD&XpQWDVHTXHXQGLVFtSXORUHDOL]DHQXQDJDVWUHFWRPtDFRQXQELVWXUtXQ
SDVRTXHGHEHKDFHUVHFRQWLMHUDFRQJUDQKDELOLGDG\p[LWR$O¿QDOGHODFLUXJtDHVJUDYHPHQWHUHSUHQGLGRSRUVX
PDHVWURTXLHQDPHQD]DFRQH[SXOVDUORGHUHSHWLUVHHOKHFKR(OPDHVWUROHUHFULPLQDTXHSXVRHQSHOLJURDOSDFLHQWH
\DTXHHVHSDVRTXLU~UJLFRHVWDEDELHQUHJODGR$OKDFHUORSRUDxDGLGXUDFRQKDELOLGDG\VHUYLVWRSRUQXPHURVRV
DSUHQGLFHVpVWRVWHQGHUiQDSHQVDUTXHHVIiFLOGHKDFHU\TXHUUiQLPLWDUORPXFKRVVHJXUDPHQWHFRQPHQRVp[LWR
3RQLHQGRDPEDVFRVDVMXQWDVVHSRQGUiHQULHVJRDYDULRVSDFLHQWHV\VLDOJXQRIDOOHFHSRUHVWDFDXVDVHOHVLRQDUi
ODLPDJHQGHPDUFDGHOFLUXMDQR\GHODHVFXHODTXLU~UJLFD JHVWLyQGHOULHVJR\GHODLPDJHQGHPDUFD .
4 - Fundamentos de estructura y diseño organizacionales / 111
H
HOSPITAL
¿QUIÉN HACE QUÉ?
¿QUIÉN REPORTA A QUIÉN?
¿QUIÉN DEPENDE DE QUIÉN?
¿CÓMO SE DIVIDE?
¿CÓMO SE ORGANIZA?
¿QUIÉN MANDA?
INSERTOS EN LÍNEA STAFF CON PODERES
DE LÍNEA DE ALGÚN MODO LEGITIMADOS
CONSULTORA 1
INTRINCADO
CIRCUITO
CAÓTICO
INSERTOS DE FACTO SIN
MIRAMIENTOS POR LO FORMAL
CONSULTORA 2
Suerte de guías
espirituales
EZQUIZOFRENIA DOBLE VÍNCULO
EFECTO CORTOCIRCUITO
Cuadro 4.15: Efecto cortocircuito en la estructura organizacional
UHHPSOD]RGHWHFQRORJtDVHVWUXFWXUDV VREUHWRGR
HVWUXFWXUDURWDUSHUVRQDOLQGH¿QLGDPHQWHFRPR
HQHOJRELHUQR KDELOLGDGHVHWFSHURVLELHQHVWR
HVHQSDUWHFLHUWRHOYHUGDGHURFDPELRGHEHWHQHU
HQFXHQWDIDFWRUHVGHODFXOWXUDFRPRODVLPiJHQHV\YDORUHVTXHJXtDQODVDFFLRQHV
5HVSHFWRGHORVOXJDUHVGLUHPRVTXHODVSHUVRQDVWLHQHQHQWRUQRVItVLFRVGH¿QLGRVODHVWUXFWXUDItVLFDSURSRUFLRQDLPSRUWDQWHVHYLGHQFLDVGH
ODFXOWXUD/RVGLVHxRVGHORVHGL¿FLRV\VXXELcación se hacen hasta cierto punto para satisfacer
QHFHVLGDGHVIXQFLRQDOHV ODIXQFLyQKDFHDOyUJDQR \GH¿QHTXpSXHGHKDFHUVHHQHOORV\FRQTXp
IDFLOLGDG/DFXOWXUDFRUSRUDWLYDGH/HYL6WUDXVV
SRUHMHPSORVHFDUDFWHUL]DSRUVLPSDWtDDSHUWXUD
\ÀH[LELOLGDG/DHPSUHVDWHQtDHQFRQFRUGDQFLD
XQHGL¿FLRFRQR¿FLQDVFHQWUDOHVTXHFRQVWDEDGH
FXDWURSODQWDVDOUHGHGRUGHXQSDWLRFHQWUDOGHVSDFKRVLQWHUFRPXQLFDEOHV\DELHUWRVHQ1LNHHO
MHIHIXQGDGRU3KLO.QLJKWWHQtDXQGHVSDFKRSUL-
YDGRVLWXDGROHMRVGHOSDVLOORSULQFLSDO\ODPtVWLFDTXHURGHDEDD.QLJKWVHYHtDDOLPHQWDGDSRU
ODFRQ¿JXUDFLyQGHVXGHVSDFKR(OHGL¿FLRGHOD
VHGHFHQWUDOHVFRPRXQFDPSXVXQLYHUVLWDULRFRQ
DUTXLWHFWXUDGHEXHQJXVWRHLQIUDHVWUXFWXUDVR¿VWLFDGDSDUDODSUiFWLFDGHSRUWLYD/RVGHVSDFKRV
HMHFXWLYRVGH)RUG0RWRUVVHKDOODQXELFDGRVHQ
las plantas superiores de la sede central mundial
ODFDVDGHFULVWDO HQ0LFKLJDQ/DGLVSRVLFLyQGH
ODVHGHFHQWUDOHVMHUiUTXLFDFRQORVSLVRVVXSHULRUHVRFXSDGRVSRUODPiVDOWDMHUDUTXtDVLWXDFLyQ
HVSDFLDOTXHVHUHLWHUDHQPXFKDVRUJDQL]DFLRQHV
DPHGLGDTXHORVHMHFXWLYRVRIXQFLRQDULRVGHDOWR
rango caen en desgracia son defenestrados internamente pasando a pisos más bajos.
El hiato entre el saber y el hacer
(QXQLQWHUHVDQWHWUDEDMR3IHIIHU\6XWWRQ se
SODQWHDQ SRU TXp PXFKRV GLUHFWLYRV TXH FRQR-
(VOODPDWLYRTXHORPLVPRSDVHFRQORVPXUFLpODJRVTXHGXHUPHQFROJDGRVFDEH]DDEDMRHQODVUDPDVGHORV
iUEROHVRFXSDQGRSRVLFLRQHVVXSHULRUHV±UDPDVPiVDOWDV±DPHGLGDTXHVXMHUDUTXtDHQHOJUXSRHVPD\RU±\DVt
DGHPiVVHPDQWLHQHQPiVDOHMDGRVGHORVGHSUHGDGRUHVGHWLHUUD
3IHIIHU-56XWWRQ La brecha entre el saber y el hacerFLWDGRHQODELEOLRJUDItD
112 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
BUROCRACIA: Basada en el incremento del control institucional (auditorías, inspecciones)
para una supuesta mejora de la eficiencia.
Se desarrollaron rutinas, normas y procedimientos para una supuesta mejora de la
eficiencia. No hay motivación ni convicción.
Todos están apegados al NO SE PUEDE.
H
HOSPITAL
SE DESARROLLAN ACTIVIDADES
CON UN ESQUEMA DE MÁXIMA
CENTRALIZACIÓN Y CONTROL DIRECTO
SE CONFUNDE EFICIENCIA CON
EXCESO DE ACTIVIDADES
2 -.,/./, ! /)-- 7),6)-)* +/ 7)-, $()2 ,0$$) (.,$-')
2 -.,/./,-8&))*$(1.,%-), -/. '
2)&-)( - -$"/& ( &-* .)!/($)(& & -.,/./,
Cuadro 4.16: Feudos serviciocéntricos en la estructura organizacional
cen el desempeño de una organización y pueden
GHFLUWRGDFODVHGHFRVDVLQWHOLJHQWHVVREUHHOODV
VH YHQ HQ OD FRWLGLDQHLGDG DWUDSDGRV HQ FRPSRUWDPLHQWRV FLUFXODUHV TXH VRFDYDQ HO GHVHPSHxR(VWRHVVDEHQTXpGHEHUtDQKDFHUSHURQR
lo hacen. (QWUHVDEHUTXpKDFHU\ODFDSDFLGDG
UHDO\FRQFUHWDGHDFWXDUVyORH[LVWHXQDUHODFLyQ
YDJDHLPSHUIHFWDHYLGHQWHPHQWHVyORVDEHUTXp
KDFHUQREDVWDDSUHQGHUPHGLDQWHOHFWXUDSURJUDPDVGHFDSDFLWDFLyQRXQWtWXORXQLYHUVLWDULR
VRQVyORXQDSDUWHGHOFDPLQR DOPHQRVVHWLHQH
ODLOXVLyQGHOVDEHUVLQRHOVDEHUUHDO ¢3RUTXp
–se preguntan los citados– toda la educación y
FDSDFLWDFLyQODFRQVXOWRUtDODVLQYHVWLJDFLRQHV
TXH VH UHDOL]DQ VREUH JHVWLyQ \ DGPLQLVWUDFLyQ
así como las montañas de libros y artículos…
QRORJUDQSURGXFLUFDPELRVVLJQL¿FDWLYRVHQHO
GHVHPSHxRHIHFWLYRGHJHUHQWHV\GHRUJDQL]Dciones?
Los conocimientos y principios son en lo
HVHQFLDODWHPSRUDOHVQRVHPRGL¿FDQQLVHPRGL¿FDUiQ FRPRORVSULQFLSLRVGHODVGLHWDV VLQ
HPEDUJRORVFXUVRVVHUHLWHUDQXQD\RWUDYH]«
FRPR ODV GLHWDV HQ ODV UHYLVWDV IHPHQLQDV Cada año las empresas gastan miles de milloQHVHQFRQVXOWRUDVSHURVXVFRQVHMRVUDUDYH]VH
SRQHQHQSUiFWLFD¢SRUTXpWDQWDHGXFDFLyQQR
funciona?
3UXHEDV GHULYDGDV GH HVWXGLRV VREUH YDULDV
LQGXVWULDV GHPRVWUDURQ TXH ORV FRQRFLPLHQWRV
sobre cómo mejorar el desempeño no se trans¿HUHQSRUHMHPSORDGLIHUHQWHVSODQWDVGHQWUR
GH OD PLVPD HPSUHVD ¢SRU TXp VRQ GLIHUHQWHV
HQWUHVtORVVXSHUPHUFDGRVGHXQDPLVPD¿UPD"
¿no deberían ser todos iguales"
&DGDSODQWDHVXQVLVWHPDGLIHUHQWHFDVLXQD
HPSUHVD GLIHUHQWH SRU PiV TXH WHQJDPRV XQD
planta frente a otra en la misma calle conseguir
TXH VH WUDV¿HUDQ VXV PHMRUHV SUDFWLFDV HV XQD
tarea endiablada según reconocen los propios
VXSHUYLVRUHVHQUHLWHUDGDVRFDVLRQHVODVSHUVRQDV
comprenden el problema, comprenden qué debe
VXFHGHUSDUDTXHVHPRGL¿TXHHOGHVHPSHxRSHUR
no hacen lo que saben que tendrían que hacer. A
PHQXGRDGHPiVORVGLULJHQWHVUDFLRQDOL]DQVXV
acciones –o inacciones–GDQGRHODERUDGDVH[SOLFDFLRQHVGHOPRWLYRSRUHOTXHKDEtDQUHVXHOWRQR
KDFHU ODV FRVDV TXH VHJ~Q HOORV PLVPRV VDEtDQ
HUDQLPSRUWDQWHVSDUDHOp[LWRGHOQHJRFLR
(Q VX SDUWLFXODU HVWLOR $UJ\ULV FRPHQWD XQ
FDVRDQiORJRGHHVWXGLRHQXQDHPSUHVDHQODTXH
una docena de capataces trataron de descubrir
en dónde se podrían hacer reducciones de costos
debido a una consultoría puntual. Pudieron idenWL¿FDUPiVGHiUHDVSDUDXQDSRVLEOHDFFLyQ
'HVSXpVGHWUHVPHVHVVHUHXQLHURQSDUDUHSRUWDU
Véase el dilema de la supercoopizaciónGHORVVXSHUPHUFDGRVFLWDGRHQODVIXHQWHV
4 - Fundamentos de estructura y diseño organizacionales / 113
VXVORJURV6HKDEtDQORJUDGRORVREMHWLYRVSDUD
ODVVHLViUHDV/DJHUHQFLDHVWLPyTXHORVDKRUURV
SUREDEOHVHUDQGHDOUHGHGRUGHPLOGyODUHV
7RGRVVHVHQWtDQFRPSODFLGRV&RPRHVGHVXSRQHU HO DPELHQWH HUD IHVWLYR (, JUXSR VH UHXQLy
para una cena ofrecida por la gerencia.
6LQHPEDUJRQRVHKDEtDDERUGDGRXQDSUHJXQWDGHFLVLYD'HKHFKRHOJHUHQWHTXHGLULJLy
ODH[SRVLFLyQGHFODUyTXHQLVLTXLHUDKDEtDSHQVDGR HQ KDFHU OD SUHJXQWD 8Q REVHUYDGRU H[WHUQRTXHHVWXGLDEDHVDVMXQWDVGHUHGXFFLyQGH
costos sí preguntó:
OBSERVADOR: ¿Recuerdan la lista de las áreas
TXHLGHQWL¿FDURQKDFHWUHVPHVHV"
CAPATACES: Por supuesto.
OBSERVADOR: ¿Cuánto tiempo hace que están
HQWHUDGRVGHHVDOLVWD"
CAPATACES: No entendemos. ¿Adónde trata de
OOHJDU"
OBSERVADOR: ¿Cuánto tiempo hace que están
HQWHUDGRVGHTXHH[LVWtDQHVRVSUREOHPDV"
CAPATACES: De uno a tres años. Eran algo del
conocimiento común.
OBSERVADOR: ¿Qué fue lo que los condujo a no
emprender una acción hasta estos seminaULRV"¢4XpIXHORTXHOHVLPSLGLyHPSUHQGHU
HVWDVDFFLRQHVVLQHOHVWtPXORGHOVHPLQDULR"
CAPATACES:¢(VWiEURPHDQGR"¢+DEODHQVHULR"
OBSERVADOR: No estoy bromeando; hablo en
serio. ¿Qué les impidió corregir los problePDVTXHXVWHGHVFRQRFtDQGHVGHKDFHDxRV"
CAPATACES: Tenga cuidado. ¡Está abriendo una
lata de gusanos! 9ROYLpQGRVHKDFLDHOUHSUHsentante de la alta gerencia. ¿Quiere usted
TXHUHVSRQGDPRVDHVDSUHJXQWD"£(VRSRdría arruinar la noche!
Al menos uno de la docena de hechos cruFLDOHVTXHH[SOLFDQHVWHKLDWRHQWUHKDELOLGDGHV
GHFRPSUHQVLyQ\GHDFFLyQ HVWiGDGRSRUHO
KHFKRGHTXHORVFRQRFLPLHQWRVRSHUDWLYRV HO
VDEHUKDFHUHQGH¿QLWLYD DPHQXGRVHWUDVPLWHQGHXQRVLQGLYLGXRVDRWURVPHUFHGDUHODWRV
FKLVPHVUXPRUHV\observando cómo trabajan
los demásODPD\RUSDUWHGHORTXHVHDSUHQGH
HQHOOXJDUGHWUDEDMRQRKDVLGRSUHVXSXHVWDGR
SODQHDGR\QLVLTXLHUDFDSWDGRSRUODRUJDQL]DFLyQGLFLpQGRVHTXHKDVWDHOGHODSUHQGLzaje en el lugar de trabajo es informal –esto es
OD FXOWXUD OD JHQWH DSUHQGH YLHQGR D OD JHQWH
WUDEDMDU« SRU HVR VH WUDQVPLWH PXFKDV YHFHV
de forma malsana.
$SHVDUGHKDEHUVHGHPRVWUDGRTXHHODSUHQGL]DMH LQIRUPDO WLHQH OXJDU FRPR GLMLPRV HQ
GHFHQDVGHDFWLYLGDGHVFRWLGLDQDVODPD\RUtDGH
los empeños de manejo del conocimiento pone
el acento en la tecnología y transferencia de inIRUPDFLyQFRGL¿FDGDGDWRVHVWDGtVWLFDSUHVHQWDFLRQHVHWF
(VWRH[SOLFDTXHWRGRHVWHDQGDPLDMHWHyULFR
QROOHJXHDEXHQSXHUWRSXHVWRTXHORVHPSOHDGRVTXHQRORKDQYLYHQFLDGRVHQFLOODPHQWHQR
ORWRPDQFRPRXQWH[WRHVFULWRHQRWURLGLRPD
Literalmente pues parecen compartimentos
estancos y separados en la mente del trabajador.
$PHQXGRDGHPiVODDFFLyQTXHQRVHKDFH
VH VXSODQWD SRU PHGLRV GLYHUVRV R sustituciones
GHVGHODFUHHQFLDPiJLFDGHTXHXQDYH]WRPDGD
XQDGHFLVLyQGHKDFHUDOJRQRVHUHTXLHUHQLQJ~Q
WUDEDMRSDUDTXHVHUHDOLFHFRPRVLODSDODEUDper
seSXGLHUDJHQHUDUVXFHVRVHVWRHVODVXVWLWXFLyQ
GH OD DFFLyQ SRU OD WRPD GH GHFLVLRQHV KDVWD HO
UHXQLRQLVPRHOSUHVHQWDFLRQLVPR\HOGRFXPHQWLVPR HVGHFLUUHXQLRQHVFRWLGLDQDV\H[WHQVtVLPDV
DFRPSDxDGDV GH SUHVHQWDFLRQHV HQ SRZHU SRLQW
seguidas de documentos escritos –esto es como
manejar la organización desde un cuarto oscuro a
FRQWUROUHPRWR\XVXDOPHQWHQRIXQFLRQD Mintzberg también ha llamado la atención
sobre la confusión entre tener un plan o dedicarVHDODSODQL¿FDFLyQFRQODLQVWUXPHQWDFLyQHIHFWLYDGHOSODQ\HOFRQVHFXHQWHDSUHQGL]DMH'LFH
TXHHQFLHUWDVHPSUHVDVKD\FXDUWRVHQWHURVDWLERUUDGRV GH FDUSHWDV YLQFXODGDV D ORV SODQHV \
HVWUDWHJLDVLPDJLQDGRVSDUDODHPSUHVDSHURTXH
QXQFD VH SXVLHURQ YHUGDGHUDPHQWH HQ SUiFWLFD
(VXVXDOTXHODSODQL¿FDFLyQVHFRQYLHUWDHQXQ
ejercicio ritual desconectado de las operaciones
y de la transformación del conocimiento en acción.
Recientemente un artículo especializado senWDEDTXH³XQDLQWUDQHWHVXQDGHODVKHUUDPLHQtas más poderosas para la administración del coQRFLPLHQWR´\TXH³HOPDQHMRGHOFRQRFLPLHQWR
SDUWHGHODWHFQRORJtD´1DGDSDUHFHPiVDOHMDGR
GHODUHDOLGDGVHKDGHPRVWUDGRTXHYROFDUWHFQRORJtDVREUHXQSUREOHPDSDUDUHVROYHUORUDUD
YH]HVXQDVROXFLyQH¿FD]
&XDQGRHOFRQRFLPLHQWRVHWUDQV¿HUHQRVyOR
RSULQFLSDOPHQWHDWUDYpVGHVLVWHPDVIRUPDOHV
VLQR SRU PHGLR GH UHODWRV FKLVPHV HWF YLHQH
acompañado de información sobre el proceso
utilizado para desarrollarlo e ilumina aspectos
WiFLWRV GH ORV TXH QR GDQ FXHQWD ORV VLVWHPDV
más formales.
114 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
PARÁMETROS
ADMINISTRACIÓN
TRADICIONAL
$PELHQWHHQTXH
mejor funciona
Rutina
7LSRGHXVXDULR
Pacientes sumisos
Gestión personal
7LSRGHOLGHUD]JR
RUJDQL]DWLYRWRPDGH
decisiones
Estructura
Organización
Administración
-HIDWXUDVGHVHUYLFLR
Política de calidad
Reglamentación
técnica
Administración de
recursos humanos
Política salarial
Presupuestos
ADMINISTRACIÓN NECESARIA
1HFHVLGDGGHLQQRYDFLyQ
Ciudadano informado con derecho eplícito
DSDUWLFLSDUDPDQLIHVWDUSUHIHUHQFLDV\D
ejercer control social
%XURFUiWLFDVLQRULHQWDFLyQ Centrada en personas y procesos y orientada
a clientes
DODH[FHOHQFLD\ODFRPSHWHQFLD
$XWRULWDULRMHUDUTXL]DGR
Democrática y conductora de
con centralización del
WUDQVIRUPDFLRQHVGHVFHQWUDOL]DFLyQGHO
SRGHUFRPXQLFDFLyQ
SRGHUJHVWLyQSDUWLFLSDWLYDGHODVGHFLVLRQHV
unidireccional
comunicación multidireccional
3LUDPLGDOYHUWLFDO
Aplanada y basada en redes funcionales
compartimentalizada
/DLPSRUWDQFLDGHXQDDSUR[LPDFLyQ
)XQFLRQDOVLQ
del manejo de los tiempos y de
consideración de procesos personalizada
la línea de prestación del trabajo
5tJLGDRULHQWDGDDOD
legalidad
Selección según criterio
WpFQLFRFLHQWt¿FRPpGLFR
gerencial
'pELOHQIXQFLyQ
del cumplimiento de
procedimientos
)OH[LEOHRULHQWDGDDORVUHVXOWDGRV
Selección según criterio de gestión por
productos y capacidad gerencial
Mejoramiento continuo de calidad
*HVWLyQFOtQLFDSURWRFROL]DFLyQSDUD
$PSOLDYDULDELOLGDGVHJ~Q DVHJXUDUFDOLGDG\H¿FLHQFLD SUHVFULSFLyQ
criterios médicos
FRQWURODGDVREUHODEDVHGHSUiFWLFDVH[LWRVDV
\HYLGHQFLDV
&HQWUDOL]DGDQRUPDWLYD
UtJLGDGHRUGHQ\FRQWURO 'HVFHQWUDOL]DGDHVWUDWpJLFDSDUWLFLSDWLYDGH
IUDJPHQWDGDGHUpJLPHQ
FDOLGDG\SURGXFWLYLGDGÀH[LEOHGHUpJLPHQ
ODERUDOFHUUDGRIXQFLyQ
ODERUDODELHUWRIXQFLyQGHODDOWDGLUHFFLyQ
DGPLQLVWUDWLYDDLVODGD
6HJ~QFDWHJRUtDV\QLYHOHV ,QFHQWLYRVVHJ~QSURGXFFLyQ\UHVXOWDGRV
5HSDUWLFLyQYDULDEOHGHUHFXUVRV
5HSDUWLFLyQ¿MDGH
SUHVXSXHVWDFLyQSURVSHFWLYDEDVDGDHQFRVWRV
UHFXUVRVKLVWyULFD
producción y demanda
'HUHJLVWURVLQFULWHULRGH 'HFRVWRVOLJDGDDSUHVXSXHVWRV
costos
Política de
&HQWUDOL]DGDVREUHODEDVH 'HVFHQWUDOL]DGDSRUXQLGDGHVGHJHVWLyQ
DGTXLVLFLRQHV
de concursos
Auditorías de procedimientos
Rendición de cuentas ,QH[LVWHQWH
FOtQLFRTXLUXUJLFRVLQIRUPDFLyQDELHUWDDOD
FRPXQLGDGOLJDGDDODHYDOXDFLyQ
Como recurso para toma de desiciones
Información
Como ejercicio formal
garantía de transparencia
Participación
ÏUJDQRVSDUWLFLSDWLYRVGHJRELHUQR
Débil
social en gestión
hospitalario
'LVFLSOLQDFRQIRUPLVPR
$VSHFWRVTXHVH
OHDOWDGFXPSOLPLHQWR
&DPELRGHVDUUROORDSUHQGL]DMHFUHDWLYLGDG
SHUFLEHQFRPRYDORUHV GHODQRUPDUHVSHWRDOD
FRQ¿DQ]DFRPXQLFDFLyQ
DXWRULGDGDQWLJHGDG
Contabilidad
Tabla 4.2: Escenarios de gestión hospitalaria actual y del futuro (Fuente: OPS y Ministerio Francés de Asuntos
Exteriores)
4 - Fundamentos de estructura y diseño organizacionales / 115
Escenarios futuros
en la arena hospitalaria
¿Hacia dónde deberíamos ir? Hacia:
‡DFWLWXGRULHQWDGDDODDFFLyQ action driven
‡DQWLEXURFUiWLFD
‡FRPSURPLVRFRQODSREODFLyQDVHUYLU
‡OLGHUD]JR \TXHQRVHDXQDSDODEUD
‡PDQWHQHUXQDHVWUXFWXUDVLPSOH\iJLO
‡ RWRUJDU OLEHUWDG GH FUHDFLyQ D WUDYpV GH XQ
marco adecuado
‡DGHFXDGRV \YHUGDGHURV VLVWHPDVGHLQIRUmación
‡FRPSURPLVRFRQODRUJDQL]DFLyQ
‡DGHFXDGDVFRDOLFLRQHVSROtWLFDV QRVHSXHGH
VHUXQNDPLND]H
‡VLVWHPDVGHRSHUDFLyQ SHIDFWXUDFLyQ H¿cientes
(QGH¿QLWLYDXQHTXLSRTXHLQWHJUHDOHVFHnario hospitalario del futuro (véase Tabla 4.2)
HQHOTXHVHDFHSWDTXHORVFHQWURV
ĺVHUiQPHQRV \VLELHQHQFXDOTXLHUOXJDU
del mundo cerrar un hospital es un problema de
GLItFLOVROXFLyQ ĺVHUiQPiVSHTXHxRV PHQRV
FDPDV\PiVFDSDFLGDGGHDPEXODWRUL]DFLyQ ĺ
serán abiertos: …en el más amplio sentido del
WpUPLQR D OD FRPXQLGDG OD FLXGDG DO FRQMXQWRGHODVRFLHGDGĺORVQXHYRVHVWDEOHFLPLHQWRV KRVSLWDODULRV GHEHUiQ SDUHFHUVH FDGD YH]
PiV D FXDOTXLHU RWUR HVSDFLR FRP~Q VLPLODUHV
DGRQGHODVSHUVRQDVGHVDUUROODQVXVDFWLYLGDGHV
FRWLGLDQDV VH SRGUi FRQFXUULU D FXDOTXLHU KRUD
GHOGtD\ODQXHYDUHODFLyQPpGLFRXVXDULRVHUi
FDGDYH]PiVDPLJDEOHHOSDUDGLJPDSRGUiVHU
HQWRQFHV ³URPSHU ODV SDUHGHV GHO KRVSLWDO´ĺ
HVWDUiQ LQWHJUDGRV KRUL]RQWDO \ YHUWLFDOPHQWH
OD LQWHJUDFLyQ KRUL]RQWDO VH SRGUtD D¿UPDU TXH
HVGHVHQFLOODYLVXDOL]DFLyQHLGHQWL¿FDFLyQĺ
WDPELpQ VHUiQ GH IiFLO DFFHVR GHVGH OR ItVLFR
FRQUHFRUULGRV\FLUFXODFLRQHVFODURVDPHQRV\
FRPSUHQVLEOHVĺVHFRQVROLGDUiHOKRVSLWDOGH
día: como consecuencia del cambio en la maQHUDGHDWHQGHUVHSXHGHDVHJXUDUTXHODPLWDG
GHORVSDFLHQWHVORVHUiQHQKRVSLWDOGHGtDFRQ
WUDWDPLHQWRVLQWHQVLYRVGHDKVTXHVHUi
PRVWUDGRHQFDVLWRGDVODVLQVWLWXFLRQHVSRWHQFLDGRSRUODWHQGHQFLDGHORVSDFLHQWHVDQRTXHUHULQWHUQDUVHTXHVHHQFXHQWUDPX\FRQVROLGDdo en las clases medias y altas.
5
GESTIÓN DE OBJETIVOS
Y PODER EN LA ORGANIZACIÓN
OBJETIVOS ORGANIZACIONALES
Reiteradamente hemos dado forma a la idea de
la organización como la manera estructurada de
UHJXODUHQXQJUXSRGHOLEHUDGRGHSHUVRQDVODV
relaciones de poder entendidas como la habiOLGDG SDUD KDFHU SUHYDOHFHU OD SURSLD YROXQWDG
FRQWUD ODV UHVLVWHQFLDV GH VXV PLHPEURV SDUD
PHGLDQWH XQD UHODWLYD FRQÀXHQFLD GH LQWHUHVHV
FRQVHJXLU HO ¿Q LQVWLWXFLRQDO (Q WpUPLQRV PiV
VHQFLOORV SRGUtD GHFLUVH TXH ODV RUJDQL]DFLRQHV
VRQGLVSRVLWLYRVGHVWLQDGRVDKDFHUFXPSOLUREMHWLYRV$OLJXDOTXHODVSHUVRQDVODVRUJDQL]DFLRQHVWLHQHQREMHWLYRVFRPRLQWHQFLRQHVTXHVH
RFXOWDQWUDVODVGHFLVLRQHV\DFFLRQHVTXHWRPD
la organización; debe haber intención y consisWHQFLD HVWR HV OD RUJDQL]DFLyQ FRPR XQ WRGR
SHUVLJXHREMHWLYRVGHIRUPDFRQVLVWHQWH6HJ~Q
0LQW]EHUJKD\FXDWURWLSRVGHREMHWLYRVTXHWRdas las organizaciones tienden a perseguir:
‡ideológicos
‡formales
‡SURSLRVGHORVVLVWHPDV\
‡personales compartidos
'H WRGRV HOORV ORV TXH SXHGHQ VHU PHQRV FRPHQWDGRVVRQORVREMHWLYRVSHUVRQDOHVFRPSDUWLGRV
SRUTXHSXHGHQWRPDUPXFKDVIRUPDVHQUHDOLGDG
SXHGHQVHUFXDOTXLHUFRVDTXHTXLHUDQORVDJHQWHV
FRQLQÀXHQFLDGHVGHSHUIHFFLRQDUXQGHWHUPLQDGR
producto hasta mantener la fábrica perfectamente
OLPSLD/RPLVPRFDEHSDUDORVREMHWLYRVIRUPDOHV
Es mucho más fácil realizar generalizaciones sobre
ORVREMHWLYRVSURSLRVGHORVVLVWHPDV\ORVLGHROyJL(Q~OWLPDLQVWDQFLDXQDDGKRFUDFLD
1
FRVSRUTXHWLHQGHQDVHUPiVHVSHFt¿FRV'HDPERV
ORV PiV RPQLSUHVHQWHV GLUtDPRV TXH FRPSUHQGHQ
ORVTXHDFRQWLQXDFLyQVHSUHVHQWDQ
1. Supervivencia
$OLJXDOTXHXQVLVWHPDYLYRFXDOTXLHURUJDQL]DFLyQ VH HVIXHU]D SRU VREUHYLYLU /D VXSHUYLYHQFLDGHEHVHUYLVWDHQUHDOLGDGFRPRODUHVtricción última para todo sistema y se encuentra
HQ OD EDVH GH VXV REMHWLYRV 8QD RUJDQL]DFLyQ
TXHVHFUHDGHIRUPDWHPSRUDOSDUDFXPSOLUXQ
FLHUWRREMHWLYR\OXHJRGHVKDFHUVH1±FRPRSRU
HMHPSOR HO FRPLWp RUJDQL]DGRU GH ORV -XHJRV
2OtPSLFRV± SRGUtD SDUHFHU XQD H[FHSFLyQ 6LQ
HPEDUJRODVXSHUYLYHQFLDVXHOHFRQYHUWLUVHHQ
XQREMHWLYREiVLFRLQFOXVRHQHVWDVRUJDQL]DFLRQHV %HFNHU\1HXKDXVHU 3HUURZFLWDHO
HVWXGLRGHODRUJDQL]DFLyQ7RZQVHQGTXHVHJ~Q
GLFHHVWHDXWRU³VHODVDUUHJOySDUDPDQWHQHUVH
HQ YLGD WUDQVIRUPDQGR VX REMHWLYR SROtWLFR GH
apoyo a los ancianos mediante un plan económiFRUDGLFDOHQREMHWLYRVVRFLDOHVGHDVHVRUDPLHQWR¿VFDOFRPSDxHULVPRMXHJRVGHFDUWDV\YHQWD
GHYLWDPLQDV\PHGLFLQDVDVXVPLHPEURV´
8Q IHQyPHQR SDUHFLGR OODPDGR VXFHVLyQ
RVXSODQWDFLyQRUHHPSOD]R GHREMHWLYRV±R
LQFOXVRGHPLVLyQ±RFXUUHQRFXDQGRODRUJDQL]DFLyQIDOODHQORJUDUVXREMHWLYRVLQRFXDQGRSDUDGyMLFDPHQWHWLHQHp[LWR %ODX /DRUJDQL]DFLyQTXHKDDOFDQ]DGRORTXHHVWDED
SUHYLVWRHQOXJDUGHFHUUDUODVSXHUWDVGHEHHVIRU]DUVHSRUFRQVHJXLUXQQXHYRREMHWLYRSDUD
118 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
seguir funcionando. En la literatura es muy
FRQRFLGDODKLVWRULDGHOD)XQGDFLyQ1DFLRQDO
SDUDOD3DUiOLVLV,QIDQWLO 1),3 GH((88 YpDVHSRUHMHPSOR6LOO FUHDGDHQD
LQVWDQFLDV GH )UDQFLV 'HODQR 5RRVHYHOW YtFtima aparente de la enfermedadORTXHQROH
impidió proseguir su carrera política y alcan]DUODSUHVLGHQFLDHVWDGRXQLGHQVHHQWUH\
/D1),3RUJDQL]yXQDIDPRVDFDPSDxD
SDUD OD REWHQFLyQ GH IRQGRV FRQ HO ¿Q ~OWLPR
de erradicar la enfermedad. A lo largo de los
DxRVFLHQWRVGHPLOHVGHFLXGDGDQRVFRQWULbuyeron con sus donaciones a la marcha de los
diez centavosXQDFDXVDGHVWLQDGDDOFXLGDGR\
KRVSLWDOL]DFLyQGHORVSDUDOtWLFRVODIRUPDFLyQ
GH ORV SURIHVLRQDOHV ODV DFFLRQHV GXUDQWH ODV
HSLGHPLDV\ODLQYHVWLJDFLyQHQWUDWDPLHQWRV\
YDFXQDV &RQ HO GHVDUUROOR GH ODV YDFXQDV GH
6DON\6DELQVHDOFDQ]yHOREMHWLYRGHODRUJDnización y por tanto ésta perdió su razón de ser.
(Op[LWRFUHyLQHVSHUDGD\SDUDGyMLFDPHQWHXQD
FULVLVGHVXSHUYLYHQFLD+DEtDXQDYDVWDPDVD
GHYROXQWDULRVORVOtGHUHV\HOSHUVRQDOFRRUGLQDGRVWRGRVHOORVHQXQDRUJDQL]DFLyQH¿FLHQWH
\HIHFWLYDSHURpVWDKDEtDSHUGLGRVXUD]yQGH
VHU\SRUWDQWR³WHQtDTXHHQFRQWUDUXQQXHYR
REMHWLYR \XQDQXHYDPLVLyQ RFHVDUVXDFWLYLGDG«GHIRUPDSUHYLVLEOHVHODVDUUHJOySDUD
ORJUDUORSULPHUR&RQVXSRGHURVDLGHRORJtD
OD )XQGDFLyQ HQFRQWUy XQD QXHYD PLVLyQ ±OD
lucha contra las anomalías congénitas en general± \ FDPELy VX QRPEUH DGRSWDQGR HO GH OD
SULPHUDFDPSDxDMarch of DimesFRQHOTXH
SHUGXUDKDVWDKR\/DRUJDQL]DFLyQVREUHYLYLy
DXQTXHQRORKLFLHUDVXREMHWLYRIXQGDPHQWDO
7RGRHVWRVXJLHUHTXHLQFOXVRODVRUJDQL]DFLRQHVFRQ¿QHVWHPSRUDOHVWLHQHQODFRVWXPEUHGH
FRQYHUWLUVHHQSHUPDQHQWHV
3HURHOFRQFHSWRGHVXSHUYLYHQFLDHVPXFKDV
YHFHVWHQXHGLItFLOGHDSUHKHQGHU'HVGHHOPRPHQWRHQTXHXQDRUJDQL]DFLyQHVWiIXQFLRQDQGRVREUHYLYH&RPRUHVXOWDGRORVPLHPEURVGH
la organización tienden a pensar no en términos
GHVXSHUYLYHQFLDVLQRGHVHJXULGDG8QRGHORV
medios para conseguir esta seguridad son las reVHUYDVTXHDFXPXODODRUJDQL]DFLyQ'XUDQWHORV
EXHQRV WLHPSRV VH DFXPXODQ ORV UHFXUVRV VR
brantes para utilizarlos cuando las condiciones
se deterioran. Otra forma de garantizar la seguULGDGHVODGLYHUVL¿FDFLyQGHSURGXFWRV\VHUYLFLRV$XPHQWDQGRVXVPHUFDGRV\PLVLRQHVOD
RUJDQL]DFLyQSXHGHUHGXFLUVXYXOQHUDELOLGDGHQ
FDVRGHXQDFULVLVHQFXDOTXLHUDGHHOORV
1DWXUDOPHQWH GXUDQWH ODV FULVLV SURIXQGDV
±FXDQGRHVWiDPHQD]DGDODVXSHUYLYHQFLDGHOD
organización– la protección del sistema se conYLHUWH HQ HO REMHWLYR SULPRUGLDO D H[SHQVDV GH
todos los demás. “El sistema amenazado se desprende primero de las partes menos importanWHV SDUD VX VXSHUYLYHQFLD DOJXQDV VH PXHVWUDQ
GLVSXHVWDV D GHVSUHQGHUVH GH WRGR H[FHSWR GHO
Q~FOHRGHVXH[LVWHQFLD GHVXVFUHHQFLDV\HVWUDWHJLDVHLQFOXVRGHVXLGHRORJtD\VXPLVLyQ ´
¢3RU TXp HV WDQ LPSRUWDQWH OD VXSHUYLYHQFLD
de una organización? La teoría económica clásica
QRVGLFHTXHHVVDOXGDEOHTXHGHYH]HQFXDQGR
algunas empresas hagan bancarrota; lo mismo es
SUREDEOHPHQWH YiOLGR SDUD ODV LQVWLWXFLRQHV VLQ
¿QHVGHOXFURTXHVHFRQYLHUWHQHQLQHIHFWLYDVR
LUUHOHYDQWHV/DUHDOLGDGHVTXHODPXHUWHGHXQD
RUJDQL]DFLyQ VXSRQH PiV TXH OD VLPSOH GLVSHUVLyQGHORVDJHQWHVTXHIRUPDEDQSDUWHGHHOOD\OD
SpUGLGDGHSRGHUGHDOJXQRVGLUHFWLYRV6LJQL¿FD
ODGLVROXFLyQGHWRGRXQVLVWHPDGHLQYHUVLRQHV
WDQWRGHFDUiFWHUPDWHULDOFRPRSVtTXLFR\WDPELpQODHYDSRUDFLyQGHXQDLGHRORJtD8QDRUJDnización se crea con mucho esfuerzo por parte de
XQ JUXSR GH IXQGDGRUHV GHVSXpV VXV PLHPEURV
LQYLHUWHQPXFKRWLHPSR\HQHUJtDHQFRQVROLGDU
VXVRSHUDFLRQHV\HVWDEOHFHUXQOXJDUSDUDHOODHQ
ODFRPXQLGDG6HGHVDUUROODQWUDGLFLRQHVVHIRUPDQFRPLWpVVHHVWDEOHFHQLGHQWL¿FDFLRQHV7RGR
esto se pierde cuando la organización muere. Se
FXHQWDTXHFXDQGRXQGLDULRFRQFLHQDxRVGHKLVWRULDTXHEUyHQ0RQWUHDOODFRPXQLGDGHVWXYRGH
duelo como si hubiera muerto una persona imporWDQWHFRPRVLXQRUJDQLVPRYLYRDPDGRKXELHUD
GHMDGRGHH[LVWLU 0LQW]EHUJ 6RQUHDFFLRQHVFRPRpVWDV±\ORVHVIXHU]RVTXHODVSHUVRQDV
KDFHQSDUDVDOYDUODH[LVWHQFLDGHRUJDQL]DFLRQHV
DPHQD]DGDV HMHPSORV FHUFDQRV D QRVRWURV TXH
YLHQHQDODPHQWHVRQHOUHVFDWHGHOFLQH1XHYD
+HOYHFLD 8UXJXD\ R GHO &DIp GH ORV$QJHOLWRV
HQ%XHQRV$LUHV ±ORTXHVRVWLHQHGHIRUPDGH-
Esta cuestión está hoy en duda.
“…Así como enfrentamos el desafío de la polio con determinación y logramos erradicar esta amenaza para la
VDOXGGHQXHVWURVKLMRVHVWDPRVGHFLGLGRVDOXFKDUFRQWUDORVQDFLPLHQWRVSUHPDWXURV´UH]DODPLVLyQGHMarch
of Dimes.
5 - Gestión de objetivos y poder en la organización / 119
¿QLWLYD OD LGHD GH TXH XQD RUJDQL]DFLyQ HV DOJR \RUHVSRVLEOHVPD[LPL]DQGRDVtHOUHQGLPLHQWR
PiVTXHHOJUXSRGHSHUVRQDVTXHODIRUPDQ/DV GHODVLQYHUVLRQHV
En la literatura especializada sobre la direcorganizaciones constantemente parecen mostrar
FLyQ PLHQWUDV TXH OD H¿FLHQFLD HV XQ FRQFHSWR
señales de tener vida propia.
TXHVHDVRFLDD³KDFHUODVFRVDVGHIRUPDDGHFXDGD´ODH¿FDFLDVHDVRFLDD³KDFHUODVFRVDVDGH2. Eficiencia
FXDGDV´ 'UXFNHU (QRWUDVSDODEUDVXQD
8QVHJXQGRREMHWLYRLQWUtQVHFRGHORVVLVWHPDV RUJDQL]DFLyQSXHGHVHUH¿FLHQWHVLQVHUHIHFWLYD
OODPDGRV RUJDQL]DFLRQDOHV HV OD H¿FLHQFLD 6HU ±KDFLHQGRELHQODVFRVDVLQDGHFXDGDVFRPRHQOD
H¿FLHQWH VLJQL¿FD REWHQHU HO Pi[LPR SRVLEOH FRQRFLGDH[SUHVLyQ³DUUHJODUODVVLOODVGHFXELHUWD
GHFXDOTXLHUREMHWLYRTXHODRUJDQL]DFLyQGHVHH GHO7LWDQLF´±RSXHGHKDFHUODVFRVDVDGHFXDGDV
SHUVHJXLUHOPLVPRFUHFLPLHQWRHOPi[LPRGH GHIRUPDLQFRUUHFWDFRPRFXDQGRORVJDVWRVSDUD
VDWLVIDFFLyQ SDUD ORV HPSOHDGRV OD PHMRU FDOL- KDFHUXQDSHOtFXODVREUHSDVDQHQXQVXSUHGDG/DH¿FLHQFLDVLJQL¿FDHOEHQH¿FLRPi[LPR supuesto.
1RH[LVWHQSRUVXSXHVWRYDORUDFLRQHVDEVRGDGRXQQLYHOGHFRVWRV3XHVWRTXHORVUHFXUVRV
QRWDQVyORHOGLQHUR\HOPDWHULDOVLQRWDPELpQ OXWDV SDUD GHWHUPLQDU TXp FRVDV VRQ correctas:
HO WLHPSR KXPDQR \ OD HQHUJtD HQ XQ PXQGR las cosas son correctas o incorrectas sólo desde
FRPSHWLWLYRVRQVLHPSUHOLPLWDGRVODH¿FLHQFLD HOSXQWRGHXQGHWHUPLQDGRDJHQWHFRQLQÀXHQGHEHVHUXQREMHWLYRSDUDWRGDRUJDQL]DFLyQFR- FLD /R TXH SXHGH VHU DSURSLDGR SDUD ORV SURPHUFLDO\QRFRPHUFLDO\SRUWDQWRHVXQRGHORV pietarios o los clientes puede no serlo para los
REMHWLYRVGHVLVWHPDV(QUHDOLGDGODH¿FLHQFLD trabajadores o para los grupos ecologistas. Por
SXHGHVHUODLGHDDOUHGHGRUGHODTXHVHUH~QHQ WDQWRODHIHFWLYLGDGHVXQFRQFHSWRTXHOOHYDYDPXFKRVDJHQWHVFRQLQÀXHQFLD3DUDORVDJHQWHV ORUHV LQFRUSRUDGRV PLHQWUDV TXH HO GH H¿FLHQLQWHUQRVHQHVSHFLDOSDUDORVGLUHFWLYRVTXHYHQ FLDSRUHOFRQWUDULRHVWiRVWHQVLEOHPHQWHOLEUH
D OD VXSHUYLYHQFLD GH OD RUJDQL]DFLyQ FRPR OR GH YDORUHV VHJ~Q 6LPRQ ³HV FRPSOHWDPiVLPSRUWDQWHODH¿FLHQFLDSXHGHVHUXQPHGLR PHQWHQHXWUDO´ /RELHQTXHFDGDDJHQWHKDJD
SDUDORJUDUHVWDVXSHUYLYHQFLDSXHVODVRUJDQL- las cosas debería ser bastante independiente de
]DFLRQHVLQH¿FLHQWHVDJRWDQVXVUHFXUVRV\GHMDQ VLHVWDFRVDHVDGHFXDGDRQR7RGRHVWRVXJLHUH
de funcionar. Para los analistas de la tecnoestruc- TXH OD H¿FLHQFLD HV HO REMHWLYR SRU H[FHOHQFLD
WXUDODH¿FLHQFLDWLHQHXQDLPSRUWDQFLDHVSHFLDO HOTXHWRGDVODVGLUHFFLRQHVSHUVLJXHQFRQMXQWD\D TXH HV VX UD]yQ GH VHU VX WUDEDMR FRQVLVWH PHQWHFRQRWURVREMHWLYRV
Comenta Mintzberg un estudio realizado
en la construcción de sistemas para mejorar la
H¿FLHQFLDGHODRUJDQL]DFLyQ6LODH¿FLHQFLDQR por él4 en una escuela de negocios y consideIXHUDXQREMHWLYRHODQDOLVWDQRWHQGUtDWUDEDMR UDQGR TXH VH SODQWHDED TXH XQ UHVWDXUDQWH HUD
en la organización. Para el público en general y H¿FLHQWH¢HQTXpVHSHQVDEDLQPHGLDWDPHQWH"5
ORVJRELHUQRVHQSDUWLFXODUODH¿FLHQFLDVLJQL¿- ¢(QTXHODFRPLGDHUDEXHQDSRUHOSUHFLRTXH
FDSURGXFWLYLGDGODXWLOL]DFLyQSUXGHQWHGHORV VHFREUDED"¢(QTXpRWUDFRVD"6REUHFLQFXHQUHFXUVRV GH OD VRFLHGDG &XDOTXLHUD TXH VHD HO WD \ QXHYH HVWXGLDQWHV OD PD\RUtD ±FXDUHQWD \
REMHWLYRGHODRUJDQL]DFLyQHVPHMRUSHUVHJXLU- tres– mencionaron de una u otra forma el objeORFRQH¿FLHQFLD3DUDORVFOLHQWHVODH¿FLHQFLD WLYRPiVIiFLOPHQWHFXDQWL¿FDEOH6 ³VHUYLFLRUiSXHGHVLJQL¿FDUTXHORVSURGXFWRV\VHUYLFLRVVH SLGR´³DXVHQFLDGHFRODV´ 7UHFHVHUH¿ULHURQ
SURGXFHQGHODIRUPDPiVEDUDWDSRVLEOH\SDUD SRVLWLYDPHQWHDODFRPLGDFRQUHVSXHVWDVFRPR
ORVSURSLHWDULRVTXHORVEHQH¿FLRVVRQORVPD- ³EXHQDFRPLGD´³FRPLGDVDEURVD´SHURFLQFR
0LQW]EHUJ
(VWHHMHPSORLQHYLWDEOHPHQWHWUDHDODPHQWHORVGH.RWOHUVREUHFDOLGDGGHXQVHUYLFLRHQHOTXHVLJXHHVWHPLVPR
tipo de pedagogía problematizadoraHQHOVHQWLGRGH'HPLQJ \TXHUHPLWHHQ~OWLPDLQVWDQFLDD3ODWyQ±YpDVHSRU
HMHPSORHOGLiORJR³/DTXHV´ 6
(VWD IDFLOLGDG SDUD YHU R PHGLU OR REYLR HV OR TXH VH FULWLFD GH PXFKRV HVWiQGDUHV GH PHGLFLyQ GH FDOLGDG
TXH PD\RUPHQWH VH DSR\DQ HQ LQGLFDGRUHV GH HVWUXFWXUD &RPR FRPHQWy XQ DXWRU HVSDxRO HQ UHIHUHQFLD D ORV
FULWHULRVWUD]DGRUHVSDUDGHWHUPLQDUORVKRVSLWDOHV³7RS´HVSDxROHV³«PHGLPRVORUHOHYDQWHRPiVELHQGDPRV
UHOHYDQFLDDORTXHSRGHPRVPHGLUFRQIDFLOLGDG«´
4
5
120 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
GHHOORVVHUH¿ULHURQDFLUFXQVWDQFLDVQHJDWLYDV
³PDODFRPLGD´³PDOVHUYLFLR´8QRVSRFRVHVWXGLDQWHVVHUH¿ULHURQDORVSUHFLRVDODOLPSLH]DRODUHQWDELOLGDG(QODSUiFWLFDSRUWDQWROD
H¿FLHQFLDVHWHUPLQDDVRFLDQGRFRQIDFWRUHVVXVceptibles de medición. Y esto tiene tres grandes
FRQVHFXHQFLDV<D TXH ORV FRVWRV QRUPDOPHQWH
VRQPiVIiFLOHVGHPHGLUTXHORVEHQH¿FLRVOD
H¿FLHQFLDPX\DPHQXGRVHOLPLWDDODUHGXFFLyQ
GHFRVWRV/RVFRVWRVVHH[SUHVDQFRQPD\RUIDFLOLGDG TXH ORV EHQH¿FLRV HQ WpUPLQRV FXDQWLWDWLYRV GLQHURKRUDVGHWUDEDMRSRUHPSOHDGR
PDWHULDOHWF &RQIUHFXHQFLDHOUHVXOWDGRGHOD
REVHVLyQSRUODH¿FLHQFLDHVODUHGXFFLyQGHORV
FRVWRVWDQJLEOHVDH[SHQVDVGHORVEHQH¿FLRVLQWDQJLEOHV¢4XpFRQVHMRGLUHFWLYRGHXQDXQLYHUVLGDGQRSXHGHUHFRUWDUHQXQORVFRVWRVGH
IRUPDFLyQGHXQHVWXGLDQWHVLQTXHVHQRWHHIHFWRDOJXQRHQORVEHQH¿FLRVTXHVHGHVSUHQGHUiQ
de esta formación en el futuro? Incluso en las
HPSUHVDVDOGLUHFWRUHMHFXWLYROHUHVXOWDIiFLOUHGXFLUHOSUHVXSXHVWR VLPSOHPHQWHUHGXFLHQGRHO
JDVWRHQDFWLYLGDGHVFRQUHVXOWDGRVLQWDQJLEOHV
FRPR SRU HMHPSOR SXEOLFLGDG (O HIHFWR VREUH
ORVEHQH¿FLRVSXHGHQRREVHUYDUVHGXUDQWHYDULRVDxRV(VGHFLUTXHFRQGHPDVLDGDIUHFXHQFLDODH¿FLHQFLDVLJQL¿FDODUHGXFFLyQGHFRVWRV
VLHQGRSRUHVWRTXHKDJDQDGRPDODIDPD
(Q JHQHUDO ORV FRVWRV HFRQyPLFRV ORV UHFXUVRV WDQJLEOHV XWLOL]DGRV VRQ PiV IiFLOHV GH
PHGLUTXHORVFRVWRVVRFLDOHV ODVFRQVHFXHQFLDV
VREUH HO QLYHO GH YLGD 6REUH WRGR HQ ODV HPSUHVDVDXQTXHQRVyORHQHOODVHOpQIDVLVHQOD
mensurabilidad crea una tendencia a atribuir a la
RUJDQL]DFLyQVyORORVFRVWRVWDQJLEOHVPLHQWUDV
TXHORVFRVWRVLQWDQJLEOHVVRQGHVFDUWDGRVFRPR
externalidadesTXHVHFRQVLGHUDQUHVSRQVDELOLdad de toda la sociedad.
<DTXHORVEHQH¿FLRVHFRQyPLFRVVRQSRUOR
JHQHUDOPiVIiFLOHVGHPHGLUTXHORVEHQH¿FLRV
VRFLDOHVODH¿FLHQFLDFRQGHPDVLDGDIUHFXHQFLD
OOHYDDODRUJDQL]DFLyQDXQDPRUDOLGDGGHVGH
HOSXQWRGHYLVWDHFRQyPLFRTXHSXHGHLPSOLFDUXQDLQPRUDOLGDGGHVGHHOSXQWRGHYLVWDVRFLDO7RGDVODVDFWLYLGDGHVKXPDQDVFRQOOHYDQ
P~OWLSOHVEHQH¿FLRVGHVGHORVFODUDPHQWHWDQJLEOHV D ORV PX\ DPELJXRV 3HUR HO GLUHFWLYR
SUHRFXSDGRSRUODH¿FLHQFLDSUHIHULUiGHIRUPD
QDWXUDOORVSULPHURVORVTXHVHSXHGHQPHGLU
FRQIDFLOLGDG(VGHFLUTXHODREVHVLyQSRUOD
H¿FLHQFLD VLJQL¿FD TXH ORV EHQH¿FLRV WDQJLEOHVGHPRVWUDEOHV\PHGLEOHVVRQSUHIHULGRVD
ORVYDJRV\SRFRGH¿QLGRVLQFOXVRFXDQGRORV
primeros no son muy adecuados para ayudar a
WRPDUODGHFLVLyQ(OFULWHULRGHH¿FLHQFLDLPSOLFDLQWHQWDUREWHQHUHOPi[LPRSRVLEOHGHORV
REMHWLYRVPHGLEOHVSDUDXQDGHWHUPLQDGDXWLOLzación de los recursos. No es tanto la calidad
GHODFRPLGDORTXHFXHQWDFRPRODUDSLGH]FRQ
TXHHVVHUYLGD
3RUWDQWRODH¿FLHQFLDVXUJHVLQRHQODWHRUtDDOPHQRVHQODSUiFWLFDQRFRPRXQFRQFHSWR
QHXWURVLQRFRPRXQRDVRFLDGRFRQXQVLVWHPD
SDUWLFXODU GH YDORUHV ORV YDORUHV HFRQyPLFRV
(QUHDOLGDGODREVHVLyQSRUODH¿FLHQFLDSXHGH
VLJQL¿FDUODGRPLQDQFLDGHORVREMHWLYRVHFRQyPLFRVVREUHORVREMHWLYRVVRFLDOHVORTXHOOHYD
a la organización a realizar acciones correctas
GHVGHHOSXQWRGHYLVWDHFRQyPLFRSHURTXHSRdrían incluso ser inmorales desde el punto de
YLVWDVRFLDO
3. Control
(OWHUFHUREMHWLYRTXHSHUVLJXHQWRGDVODVRUJDQL]DFLRQHVFRPRVLVWHPDVTXHVRQHVLQWHQWDU
ejercer algún control sobre su propio entorno.
7RGD RUJDQL]DFLyQ H[SHULPHQWD XQD PXOWLWXG
GH IXHU]DV H[WHUQDV GLVHxDGDV SDUD UHVWULQgir y controlar sus acciones. “Al adaptarse a
VXHQWRUQRHOVLVWHPDLQWHQWDUiKDFHUIUHQWHD
ODVIXHU]DVH[WHUQDV\FRQWURODUODV«´ .DW]\
.DKQ /D RUJDQL]DFLyQ SXHGH OOHJDU D
obsesionarse tanto con las fuerzas dominantes
HQVXHQWRUQRTXHODE~VTXHGDGHODDXWRQRPtD
VHSDUHFHFDGDYH]PiVDODOXFKDSRUHOSRGHU
/DGLIHUHQFLDHQWUHODVGRV±HYLWDUTXHORVGHPiVLQWHU¿HUDQHQODSHUVHFXFLyQGHORVREMHWLYRVSURSLRVGHODRUJDQL]DFLyQRFRQWURODUGLUHFWDPHQWHORVREMHWLYRVGHORVGHPiV±SXHGH
ser muy difícil de detectar.
4. Crecimiento
7RGDVODVRUJDQL]DFLRQHVH[SHULPHQWDQIXHUWHV
SUHVLRQHVQDWXUDOHVDOFUHFLPLHQWRSRUXQDYDriedad de razones. El crecimiento puede ayudar
DODRUJDQL]DFLyQDFXPSOLUORVRWURVREMHWLYRV
HQ PXFKDV HVIHUDV GH OD DFWLYLGDG ODV RUJDQL]DFLRQHV SHTXHxDV VRQ YXOQHUDEOHV \ ODV PD\RUHVPiVVHJXUDV7RGRVORVDJHQWHVLQWHUQRV
SHURVREUHWRGRORVGLUHFWLYRVLQWHUPHGLRV\ORV
GLUHFWRUHV HMHFXWLYRV REWLHQHQ EHQH¿FLRV SHUVRQDOHVFRQHOFUHFLPLHQWRGHODRUJDQL]DFLyQ
HQWpUPLQRVGHVDODULRVPiVDOWRVGHPD\RUHV
RSRUWXQLGDGHV SDUD DVFHQGHU R PiV SRGHU \
5 - Gestión de objetivos y poder en la organización / 121
prestigio. El crecimiento también es una forPD SDUWLFXODUPHQWH HIHFWLYD GH VROXFLRQDU ODV
tensiones internas y puede ayudar a la organi]DFLyQ D FXPSOLU ORV RWURV REMHWLYRV VREUHYLYLUVHUH¿FLHQWH\FRQWURODUVXHQWRUQR(QPXFKDVHVIHUDVGHODDFWLYLGDGODVRUJDQL]DFLRQHV
SHTXHxDV VRQ YXOQHUDEOHV \ ODV PD\RUHV VRQ
más seguras. Estas últimas disponen de más reVHUYDV SDUD XWLOL]DU HQ ORV WLHPSRV GLItFLOHV \
PiVDJHQWHVH[WHUQRVLQWHUHVDGRVHQTXHODRUganización no desaparezca. El gobierno de los
(VWDGRV 8QLGRV SRGUtD LQWHUYHQLU SDUD VDOYDU
D &KU\VOHU PLHQWUDV GHMDUi VLQ SHVWDxHDU TXH
PLOHV GH SHTXHxDV HPSUHVDV YD\DQ D OD TXLHEUDFDGDDxR/DH¿FLHQFLDVHUHODFLRQDFRQHO
tamaño mediante las economías de escala. En
PXFKRV VHFWRUHV VREUH WRGR HQ DTXHOORV TXH
más se basan en sistemas técnicos complejos y
HODERUDGRV ODV RUJDQL]DFLRQHV GHEHQ FUHFHU \
VHUJUDQGHVSDUDVHUH¿FLHQWHV
$GHPiVFRPRVHxDOD-RKQ.HQQHWK*DOEUDLWK
HOWDPDxRFRQOOHYDPD\RUWDPDxRSDUDQR
SHUGHUHOFRQWUROODVRUJDQL]DFLRQHVGHEHQFUHFHU
FXDQGRODVRUJDQL]DFLRQHVTXHHMHUFHQLQÀXHQFLD
sobre ella crecen. Se necesitan grandes sindicaWRVSDUDKDFHUIUHQWHDODVJUDQGHVHPSUHVDVORV
JUDQGHVSURYHHGRUHVSURSLFLDQJUDQGHVFOLHQWHV\
YLFHYHUVDXQJRELHUQRJUDQGHVXUJHFRPRUHDFFLyQDODVHPSUHVDV\VLQGLFDWRVJUDQGHV\DVX
YH]IXHU]DDpVWRVDFUHFHUPiVSDUDKDFHUIUHQWHDVXLQÀXHQFLD6RQODVJUDQGHVXQLYHUVLGDGHV
ODV TXH PHMRU SXHGHQ HQIUHQWDUVH D ORV JUDQGHV
JRELHUQRV TXH ODV ¿QDQFLDQ 3HUR PLHQWUDV TXH
HOFUHFLPLHQWRSXHGHVHUXQREMHWLYRVXERUGLQDdo y una restricción para algunas organizaciones
±XQPHGLRGHVXSHUYLYHQFLDGHDOFDQ]DUXQQLYHO
DFHSWDEOHGHH¿FLHQFLDRGHHMHUFHUHOFRQWURO±VH
FRQYLHUWHHQXQREMHWLYRSULPDULRHQUHDOLGDGHO
REMHWLYRSULPDULRHQPXFKDVRWUDV
Y este fenómeno no se limita al sector priYDGR +R\ HQ GtD WRGR WLSR GH RUJDQL]DFLRQHV
SUHPLDQHOFUHFLPLHQWRLQFOXVRHQORVVHFWRUHV
GHVHUYLFLRVHQTXHODVGHVHFRQRPtDVGHHVFDOD
KDFHQ D ODV JUDQGHV HPSUHVDV LQH¿FLHQWHV SDUD
OOHYDU D FDER VX PLVLyQ ([LVWHQ XQLYHUVLGDGHV
\KRVSLWDOHVLQPHQVRVHVFXHODV\DVLORVJLJDQWHVTXHSDUHFHQPiVHOWHUUHQRGHEDWDOODVSROtWLFDVTXHLQVWLWXFLRQHVSDUDSUHVWDUXQVHUYLFLR
3IHIIHU\6DODQFLN SURSRUFLRQDQPXFKRV
HMHPSORV TXH PXHVWUDQ TXH LQFOXVR HQ ODV HP-
SUHVDVHOFUHFLPLHQWRVHGDDPHQXGRDH[SHQVDVGHORVEHQH¿FLRV$VtHOFUHFLPLHQWRVXUJH
FRPRXQREMHWLYRHQVtPLVPRVLHQGRHOWDPDxR
ODPHGLGDGHOp[LWRGHXQVLVWHPDHQHOPXQGR
de los grandes negocios.
/RVREMHWLYRVTXHKHPRVFRPHQWDGRVHSXHGHQLQWHUUHODFLRQDUGHYDULDVPDQHUDV(OFUHFLPLHQWRSXHGHVHUQHFHVDULRSDUDVREUHYLYLUGHOD
PLVPDIRUPDTXHODVXSHUYLYHQFLDHVREYLDPHQWHQHFHVDULDSDUDHOFUHFLPLHQWR8QFLHUWRJUDGR
de control puede también ser necesario para la
VXSHUYLYHQFLD DOPHQRVODVXSHUYLYHQFLDFRPR
HQWLGDG LQGHSHQGLHQWH \ SXHGH WDPELpQ TXH
SHUPLWDTXHVHGpHOFUHFLPLHQWR3RURWURODGR
HOFUHFLPLHQWRSXHGHVHUXQUHTXLVLWRSUHYLRSDUD
HO FRQWURO %DMR FLHUWDV FRQGLFLRQHV HO FUHFLPLHQWROOHYDDODH¿FLHQFLD\ODH¿FLHQFLDSXHGH
JHQHUDUORVH[FHGHQWHVQHFHVDULRVSDUDDSR\DUHO
FUHFLPLHQWR3HURODREVHVLyQSRUFXDOTXLHUDGH
HVWRV REMHWLYRV SXHGH HVWDU HQ FRQÀLFWR FRQ OD
REWHQFLyQGHFXDOTXLHUDGHORVGHPiV
5. La misión como objetivo de la organización
/RVREMHWLYRVGHVLVWHPDSDUHFHQVHUFRPXQHVD
WRGDVODVRUJDQL]DFLRQHVFRQLQGHSHQGHQFLDGH
ORVGHPiVREMHWLYRVTXHVHSHUVLJDQRLQFOXVRGH
ORV TXH GRPLQHQ /D VXSHUYLYHQFLD OD H¿FLHQFLD HO FRQWURO \ HO FUHFLPLHQWR VRQ LQHYLWDEOHPHQWHODVLQWHQFLRQHVTXHVHHQFXHQWUDQGHWUiV
de al menos algunas de las acciones de todas las
RUJDQL]DFLRQHV \ FRQ IUHFXHQFLD VH FRQYLHUWHQ
HQ REMHWLYRV SULPDULRV /D PLVLyQ GHVFULEH OD
principal función de la organización en la soFLHGDG OD UD]yQ GH VX H[LVWHQFLD D ORV RMRV GH
todo el mundo: la producción de determinados
SURGXFWRV R VHUYLFLRV 3HUR OD PLVLyQ SXHGH R
QRVHUHQVtPLVPDXQREMHWLYRGHODRUJDQL]DFLyQGHSHQGLHQGRGHVLVXDFWLYLGDGHVFHQWUDOR
VyORLQFLGHQWDOSDUDORVDJHQWHVTXHODFRQWURODQ
¢%DMRTXpFLUFXQVWDQFLDVVHFRQYLHUWHODPLVLyQ
HQHOREMHWLYRSULPRUGLDOGHODRUJDQL]DFLyQ"/D
PLVLyQWLHQGHDHQWUDUHQHOVLVWHPDGHREMHWLYRV
GH ODV RUJDQL]DFLRQHV TXH SHUVLJXHQ PLVLRQHV
distintas y contradictorias. La misión también
WLHQGHDVXUJLUFRPRXQRGHORVREMHWLYRVSULPDULRVDYHFHVHO~QLFRHQHOFDVRSDUWLFXODUGHODV
organizaciones profesionales. Esto sucede porTXHDOJXQRVGHORVRSHUDULRVSURIHVLRQDOHVTXH
WLHQHQEDVWDQWHSRGHUWLHQGHQDGHFDQWDUVHSRU
³DPHGLGDTXHHOHVWDQTXHYDFUHFLHQGRWDPELpQFUHFHODUDQD«´ 3HUURZ 122 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
OD H[FHOHQFLD SURIHVLRQDO FRPR REMHWLYR ±EiVLFDPHQWH OD FDOLGDG FRQ TXH VH OOHYD D FDER OD
PLVLyQ±DOJXQDVYHFHVDH[SHQVDVGHODH¿FLHQFLD\HQRFDVLRQHVLQFOXVRGHODVXSHUYLYHQFLD
/DPLVLyQ\HOREMHWLYRVHFRQYLHUWHQHQVLQyQLmos en la organización con una fuerte ideología.
Las organizaciones obsesionadas de este modo
por su misión son adecuadamente llamadas misionarias (Q HVWH WLSR GH RUJDQL]DFLRQHV FRQ
H[FHSFLyQTXL]iGHODVXSHUYLYHQFLDHQWLHPSRV
GHFULVLVQLQJ~QREMHWLYRSDVDGHODQWHGHODFRQVHUYDFLyQH[WHQVLyQ\SHUIHFFLRQDPLHQWRGHOD
PLVLyQ(QHORWURH[WUHPRVHKDOODQODVRUJDQLzaciones llamadas utilitaristas (W]LRQL /DPLVLyQQRWLHQHQLQJ~QVLJQL¿FDGRHVSHFLDO
SDUDHOODVQLQLQJ~QOXJDUHQVXVLVWHPDGHREMHWLYRV
6. Objetivos a la luz de la
teoría de la dirección
H[LVWLU XQ FRQMXQWR GH REMHWLYRV GHWHUPLQDGRV
$OJXQRVVXSXHVWRVVLUYLHURQGHEDVHDODVQXHYDVFRQFHSFLRQHV
Un agente, un objetivo
Enteramente nacida del cuño de la teoría económica
FOiVLFD6yORH[LVWHXQDJHQWHHQHOVLVWHPDGHSRGHU
RUJDQL]DFLRQDOXQDSHUVRQDTXHWRPDODVGHFLVLRQHVHQHVWHFDVRVHD¿UPDTXHODVRUJDQL]DFLRQHV
WLHQHQREMHWLYRV\HVSHFt¿FDPHQWHXQREMHWLYR±OD
E~VTXHGDGHEHQH¿FLRV±\VHWUDWDGHPD[LPL]DUOR
HOOODPDGRPRGHORGHOagente racional $KRUD ¢VRQ QHFHVDULDPHQWH ORV EHQH¿FLRV
HO REMHWLYR TXH EXVFD PD[LPL]DUVH" ¢3RU TXp
QR DOJ~Q RWUR REMHWLYR" 0XFKDV HPSUHVDV SRU
HMHPSOR PD[LPL]DQ VXV YHQWDV D H[SHQVDV GH
una restricción en su rentabilidad. O bien la emSUHVDSRGUtDPD[LPL]DUGLYHUVRVREMHWLYRV
Un agente, varios objetivos
/D WHRUtD GH OD GLUHFFLyQ H[SHULPHQWy HQ ORV
~OWLPRV y DxRV XQ FDPELR VXVWDQWLYR HQ
UHODFLyQ D ORV REMHWLYRV SDVDQGR GH OD WHRUtD
HFRQyPLFD FOiVLFD KDVWD DTXHOODV SRVWXUDV PiV
DSR\DGDVHQODTXLQWDHVHQFLDVRFLDOGHODVHPSUHVDVRHQRWURVWpUPLQRVGHVGHODQRFLyQGH
REMHWLYRVGDGRVDODGHXQÀXMRVXEWHUUiQHRGH
SRGHU HQ ODV RUJDQL]DFLRQHV \ VX HQWRUQR VLQ
HQHVWHFDVRDXQTXHORVREMHWLYRVIXHVHQP~OWLSOHV HO VXSXHVWR GH PD[LPL]DFLyQ VH PDQWHQtD
HVWR HV KD\ XQ VROR DJHQWH TXH SXHGH H[SUHVDU
ORVREMHWLYRVRUJDQL]DFLRQDOHV6LPRQVXJLULyHQ
UHODFLyQDHVWHSXQWRTXHODRUJDQL]DFLyQVDWLVIDFtDPiVTXHPD[LPL]DEDDVtODRUJDQL]DFLyQVH
enfrenta a un conjunto de restricciones y al tomar
XQD GHFLVLyQ FDGD REMHWLYR VH LQFRUSRUD D HVWH
proceso decisorio como una simple restricción.
UN AGENTE UN OBJETIVO
Tan solo un agente de poder
Uno solo que toma desiciones
H
HOSPITAL
UN SOLO OBJETIVO
La maximización del beneficio
¿Era necesariamente el beneficio el objetivo a maximizar?
¿Por qué no otro objetivo?
Cuadro 5.1: Un agente, un objetivo
9pDVHSRUHMHPSOR$OOLVRQ
9pDVHPiVVREUHHVWRHQWRPDGHGHFLVLRQHVHQHOFDStWXORFRUUHVSRQGLHQWH
5 - Gestión de objetivos y poder en la organización / 123
UN AGENTE, MULTIPLICIDAD DE OBJETIVOS
¿Cómo se atienden?
Los objetivos en realidad se entienden como
restricciones desde el exterior
SISTEMA CON RESTRICCIONES EXTERNAS MÚLTIPLES
H
HOSPITAL
ALGUNAS RESTRICCIONES SE TOMAN
EN CUENTA, OTRAS SE OBVIAN
Los objetivos emanan de la cima y son
elaborados y diferenciados por distintas
unidades y departamentos a medida
que fluyen hacía la base
Cuadro 5.2: Un agente, multiplicidad de objetivos
Varios agentes, varios objetivos
En un intento de conciliar teorías económicas y
FRQGXFWLVWD VH GHVDUUROOy OD LGHD WHyULFD VHJ~Q
OD FXDO ORV LQGLYLGXRV QHJRFLDEDQ HQWUH HOORV
SDUDGHWHUPLQDUORVREMHWLYRVGHODRUJDQL]DFLyQ
¢&yPR UHVSRQGH QR REVWDQWH OD RUJDQL]DFLyQ
DQWHLQFRQVLVWHQFLDVHQWUHREMHWLYRVRFXHVWLRQHV
GLQiPLFDV" /DV UHVROYtDQ HQ IRUPD VHFXHQFLDO
“…el proceso de negociación se da en forma
FDVLFRQWLQXDSODVPiQGRVHHQXQDODUJDOLVWDGH
FRPSURPLVRV«´ &\HUW 0DUFK ([LVWHQ IRFRV DUELWUDULRV GH LQWHUpV \ mercados
internos cuyas estructuras y procesos son el resultado de complejos procesos de acomodamienWRUHDOL]DGDVSRUDJHQWHVVXMHWRVDXQDYDULHGDG
GH LQFHQWLYRV \ SHUVLJXLHQGR XQD GLYHUVLGDG GH
REMHWLYRV(QGH¿QLWLYDVyORSRGUtDFRPSUHQGHUse el funcionamiento de la organización en térmiQRVGHODVPHWDVLQGLYLGXDOHVGHVXVDJHQWHVFRQ
LQÀXHQFLDFRPRXQmercadoHQHOTXHVHWUDQVDQ
RLQWHUFDPELDQREMHWLYRV11
$KRUDELHQFDEHSODQWHDUVHXQDVHULHGHSUHJXQWDVHQFDGHQDGDVFRPRKDFH0LQW]EHUJSRU
)LQDOPHQWHSXHGHODRUJDQL]DFLyQQRWHQHUREMH- HMHPSOR ¢FyPR VROXFLRQDQ ODV RUJDQL]DFLRQHV
WLYRV"6HKDDUJXPHQWDGR *HRUJLRX TXH HO SUREOHPD GH OD PXOWLSOLFLGDG GH REMHWLYRV"
ODVRUJDQL]DFLRQHVVRQXQiPELWRGHDFWLYLGDGSR- ¢([LVWH XQ REMHWLYR GRPLQDQWH" 6L H[LVWHQ YDOtWLFDVLQTXHWHQJDQREMHWLYRVSRUHOODVPLVPDV ULRV¢FyPRVHUHFRQFLOLDQHQWUHVt"¢4XL]iWUD-
Varios agentes, ausencia de objetivos
$QiORJD D OD SUHJXQWD IXQGDFLRQDO TXH VH KDFH %XQJH UHVSHFWR GH OD SODQL¿FDFLyQ (véase en el capítulo
correspondiente)VREUHVLHVSRVLEOHSDUDODRUJDQL]DFLyQQRSODQL¿FDUHQDEVROXWRHVGHFLUVyORGHMDUTXHODV
cosas sucedan…
11
(Q HVWH VHQWLGR WDPELpQ SRGUtD SODQWHDUVH VL OD SRVLFLyQ RULJLQDULDPHQWH LQGLYLGXDOLVWD GHO SHQVDPLHQWR
HFRQyPLFR HV FRPSDWLEOH FRQ OD VROLGDULGDG ±LQWHUFDPELR UHFtSURFR± TXH WRGD VRFLHGDG R HPSUHVD LQFOXVR
QHFHVLWD SDUD PDQWHQHU VX FRKHVLyQ (O SHQVDPLHQWR HFRQyPLFR SURSRQH GRV WLSRV GH UHVSXHVWDV 8QD H[FOX\H
GHODSUREOHPiWLFDHVSHFt¿FDPHQWHHFRQyPLFDDWRGDVODVFXHVWLRQHVTXHQRSXHGHQDERUGDUVHVLQDEDQGRQDUHO
SUHVXSXHVWR LQGLYLGXDOLVWD GHO SHQVDPLHQWR HFRQyPLFR WUDGLFLRQDO PLHQWUDV TXH OD RWUD SURSRQH OD FUHDFLyQ GH
QXHYRV PRGHORV FDSDFHV GH LQFOXLU HQ OD FLHQFLD HFRQyPLFD HO WUDWDPLHQWR GH FXHVWLRQHV \ VLWXDFLRQHV HQ ODV
TXHORVVXMHWRVHFRQyPLFRVLQGLYLGXDOHVQRDFW~DQFRQODUDFLRQDOLGDGWtSLFDGHOLQGLYLGXRPD[LPL]DGRU 9pDVH
SRU HMHPSOR )HUXOOR + 8QLYHUVLGDG GH 7XFXPiQ \ 8QLYHUVLGDG 6DQWR 7RPiV GH$TXLQR HQ ³/D LQFOXVLyQ GH
OD VROLGDULGDG HQ HO SHQVDPLHQWR HFRQyPLFR WUDGLFLRQDO´ 3XHGH WDPELpQ FRQVXOWDUVH VREUH HO SXQWR OD REUD GH
$FNHUORII \VXVFRQVLGHUDFLRQHVVREUHHOLQWHUFDPELRODERUDOFRPRXQobsequio.
124 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
VARIOS AGENTES Y MÚLTIPLES OBJETIVOS
Anarquías organizadas de CYERT Y MARCH
una arena política
El supuesto de racionalidad no se da
ni con mucho en la práctica,
en el mundo real.
H
HOSPITAL
¿CÓMO SE ATIENDEN?
¿Secuencialmente?
¿Se anulan unos a otros como
vectores o campos de fuerza?
Cuadro 5.3: Varios agentes, múltiples objetivos
WDQGRORVREMHWLYRVHQIRUPDVHFXHQFLDO"¢(VOD
organización instrumento de algún grupo –proSLHWDULRVVRFLHGDGRFXDOTXLHURWUR±TXHLPSRQHVXVREMHWLYRV"¢RHVXQiPELWRGHDFWLYLGDG
SROtWLFDHQHOTXHORVLQGLYLGXRVVHHVIXHU]DQSRU
FRQVHJXLUHOSRGHU"¢SDUDTXLpQH[LVWHODRUJDQL]DFLyQ"¢SDUDVXSURSLRELHQ"¢SDUDVXVSURSLHWDULRV"¢SDUDODVRFLHGDG"¢SDUDVXVFOLHQWHV"
¢SDUDVXVWUDEDMDGRUHV"¢SDUDVXVDGPLQLVWUDGRUHV"¢SDUDWRGRVHOORV"¢SDUDQLQJXQRGHHOORV"
¢VHSXHGHGHFLUTXHODRUJDQL]DFLyQWLHQHREMHWLYRVRVyORORVWLHQHQVXSDUWLFLSDQWHV"¢VHSXHGH
GHFLUTXHODRUJDQL]DFLyQFRPRHQWLGDGWHQJDXQ
REMHWLYR SURSLR FROHFWLYR" (VWR HV ¢SRGHPRV
sin más adscribir una suerte de intención colecWLYD HQ OD RUJDQL]DFLyQ R HOORV REMHWLYRV GH OD
PLVPDVRQVRORHOORVGHVXVLQWHJUDQWHV"
(Q SRFDV SDODEUDV OD RUJDQL]DFLyQ ¢WLHQH
XQDYLGDLQGHSHQGLHQWHGHODGHVXVLQWHJUDQWHV"
¢2 HO REMHWLYR PDJQR HV XQD HVSHFLH GH VXPD
YHFWRULDORIXQFLyQSROLQyPLFDUHVXOWDQWHGHOD
PXOWLSOLFLGDGGHYHFWRUHVFRQWUDSXHVWRVRH[SUHsiones en una fórmula?
¢&yPRVHWUDGXFHQORVREMHWLYRVSHUVRQDOHV
YDORUHVLQWHQFLRQHVQHFHVLGDGHV\H[SHFWDWLYDV
de los agentes en decisiones y acciones de la
RUJDQL]DFLyQ" ¢&XiO HV HO QH[R HQWUH ODV QHFHVLGDGHVLQGLYLGXDOHV\ODVDFFLRQHVTXHWRPDOD
organización?
%DMDQGRODySWLFDDOKRVSLWDO¢FXiOHVVRQVXV
REMHWLYRV"¢FXiOHVVRQODVIXQFLRQHVGHOKRVSLWDO"¢SDUDTXpRTXLpQH[LVWHXQKRVSLWDO"¢FXiO
HVODIXQFLyQGHXQVHUYLFLR"¢SDUDTXLpQH[LVWH
XQVHUYLFLR"¢SDUDTXLpQHVEXHQRXQVHUYLFLR"
¢SDUD ORV PpGLFRV OD VRFLHGDG ORV SDFLHQWHV
ORVGLUHFWLYRV"¢6yORSDUDVXMHIH"(véase la noción deVHUYLFLRFHQWULVPRen otra parte de esta
obra).
POLÍTICA
6XHOH UHIHULUVH DO DUWH FRQ TXH VH FRQGXFH XQ
asunto o se emplean los medios para alcanzar un
¿Q GHWHUPLQDGR 'LFH &ULFN TXH HV OD DFWLYLGDG
SRUODTXHLQWHUHVHVGLYHUJHQWHVGDGRVGHQWURGH
XQDXQLGDGGHOHJDOLGDG XQDFRPXQLGDGXRUJDQL]DFLyQSRUHMHPSOR VHFRQFLOLDQDWUDYpVGHXQ
UHSDUWR GHO SRGHU /D SROtWLFD VH UH¿HUH DO FRPSRUWDPLHQWR GH XQ LQGLYLGXR R JUXSR TXH WLHQH
QDWXUDOH]DLQIRUPDOFRQREMHWLYRVPX\GHOLPLWDGRVQRUPDOPHQWHGHFLVLYR\SRUHQFLPDGHWRGR
WpFQLFDPHQWHLOHJtWLPRTXHQRHVWiVRPHWLGRDOD
autoridad formal ni a la ideología aceptada ni a
OD KDELOLGDG GHPRVWUDGD ±DXQTXH SXHGH VHUYLUVHGHFXDOTXLHUDGHHVWRVVLVWHPDV± 0LQW]EHUJ
&RPR UHVXOWDGR GH OR DQWHULRU WLHQHQDWXUDOH]DWtSLFDPHQWHGLYLVRULDRFRQÀLFWLYD
5 - Gestión de objetivos y poder en la organización / 125
¿Se puede no tener objetivos?
¿Se puede no tener estrategia?
¿Existe en las organizaciones el vacío?
¿O NATURA ABHORRET VACUUM
también se aplica en este contexto?
H
HOSPITAL
???
Cuadro 5.4: Múltiples agentes, ausencia de objetivos
HQIUHQWDQGR D ORV LQGLYLGXRV R JUXSRV FRQWUD OD
organización o a unos contra otros. Las organizaciones son estructuras intrínsecamente políticas
HQHOVHQWLGRTXHGHEHQHQFRQWUDUODPDQHUDGH
KDOODU RUGHQ \ GLUHFFLyQ HQWUH JHQWH FRQ GLYHUVLGDGHVSRWHQFLDOHV\FRQÀLFWRVGHLQWHUHVHV/D
SROtWLFD RUJDQL]DWLYD VH PDQL¿HVWD FRQ FODULGDG
HQORVFRQÀLFWRV\MXHJRVGHSRGHU/DVRUJDQL]Dciones “no son ni con mucho entidades racionales
\ DUPRQLRVDV ±DXQTXH TXL]i WDPSRFR VLVWHPDV
DSRFDOtSWLFRV± \ IXQFLRQDQ PHGLDQWH HO UHSDUWR
de autoridad y la creación de un marco para el
HMHUFLFLR GHO SRGHU HV GHFLU VRQ XQ WLSR GH HQWLGDGHV SROtWLFRVRFLDOHV GRQGH FDGD YH] HV QHFHVDULRQHJRFLDUPiV«´ 'HL ³3RGHPRV
imaginar a las organizaciones como redes de personas de procedencia heterogénea con intereses
GLYHUJHQWHVTXHVHUH~QHQELHQSRUFRQYHQLHQFLD
ELHQSDUDOOHYDUDFDERVXSUR\HFWRGHYLGDUHDOL]DU VX FDUUHUD R ORJUDU VX DPELFLyQ X REMHWLYR
GHVHDGR«´ &RPR ORV LQWHUHVHV QR VRQ VLHPSUH
FRQYHUJHQWHV HVGHFLUODRUJDQL]DFLyQDEDUFDR
comprende muchas racionalidades para interpreWDUODUHDOLGDGFDGDXQDDVRFLDGDDXQFRQMXQWR
HVSHFt¿FRGHLQWHUHVHV\SRUORWDQWRDOUHFRQRFLPLHQWRGHODH[LVWHQFLDGHFRQÀLFWRVUHDOHVRYLUWXDOHV HQWUH ODV GLVWLQWDV SRVLFLRQHV TXH EXVFDQ
OD VROXFLyQ PiV FRQYHQLHQWH VHJ~Q VXV ySWLFDV
SDUWLFXODUHV HVQHFHVDULRXQFLHUWRXVRGLVFUHFLRQDOGHOSRGHUSDUDORJUDUTXHVHKDJDQODVFRVDV
1RVLHQGRSRVLEOHHVWDEOHFHUXQD~QLFDVROXFLyQ
ODTXHVHSRQJDHQSUiFWLFDWHQGUiTXHVXUJLUGHO
DFXHUGRODFRQFHUWDFLyQHOFRQVHQVRRGHRWUDV
IRUPDVGHFRRUGLQDFLyQGHYROXQWDGHV\HVQHFHVDULRTXHVHDQDUWLFXODGRVDWUDYpVGHXQSURFHVR
SROtWLFR GH QHJRFLDFLyQ LPSOtFLWR R H[SOtFLWR D
¿QGHORJUDUODVPHWDVRSHUDFLRQDOHVSURSXHVWDV
eVWHHVHQGH¿QLWLYDHOXVRSRVLWLYRGHODSROtWLFD
RUJDQL]DFLRQDO XQD VXHUWH GH PHFDQLVPR R GLVSRVLWLYRSDUDORJUDUDFXHUGRVTXHGHRWURPRGR
no se lograrían.
$XQTXHODSROtWLFDHVLPSUHVFLQGLEOHHQODRUJDQL]DFLyQ WLHQH WDPELpQ HIHFWRV DGYHUVRV ELHQ
descritos y conocidos. El primero es la gran cantiGDGGHWLHPSR\HQHUJtDTXHVHQHFHVLWDSDUDFXOWLYDUODTXHSXHGH\GHKHFKRGLVWUDHDOMHIHGLUHFWLYRRIXQFLRQDULRGHVXVREOLJDFLRQHVFRQFUHWDV
6HJXQGRODPHUPDHQODLQIRUPDFLyQOLEUHPHQWH
DFFHVLEOHTXHHQFRQGLFLRQHVPX\SROLWL]DGDVHV
OLPLWDGDRPDQLSXODGD7HUFHURODSHUFHSFLyQGH
ODUHDOLGDGVHGLVWRUVLRQD\DTXHODSURSLDIXHU]D
GHORVLQWHUHVHVVHVJDQQHJDWLYDPHQWHODREMHWLYLdad y racionalidad de la cognición.
PODER
(OSRGHUHVFRPRODSROtWLFDXQDIXHU]DLQWDQJLEOHHQODVRUJDQL]DFLRQHVSHURQDGLHGXGDGH
126 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
SISTEMA
DE AUTORIDAD
SISTEMA
DE IDEOLOGÍA
(CULTURA, MÍSTICA)
H
HOSPITAL
SISTEMA
DE POLÍTICA
(PODER)
SISTEMA
DE HABILIDAD
Cuadro 5.5: Los cuatro subsistemas clásicos de poder
VXH[LVWHQFLD7DPSRFRSXHGHGH¿QLUVHRFRQRFHUVHFRQSUHFLVLyQFRPRODHOHFWULFLGDGSHUR
como ella se usa ampliamente. Recordemos la
PDJLVWUDO FDUDFWHUL]DFLyQ GHO SRGHU TXH KDFH
0LFKHO)RXFDXOWFXDQGRGLFH
³(OSRGHUHVDOJRTXHFLUFXOD\IXQFLRQDHQ
FDGHQDSRUDVtGHFLU « QXQFDHVWiORFDOL]DGRDTXtQLDOOi « QXQFDHVWiHQODVPDQRVGH
QDGLHQXQFDHVDSURSLDGRFRPRXQDULTXH]DR
XQELHQ « IXQFLRQD\VHHMHUFHDWUDYpVGH
una trama reticulada y en sus mallas los indiYLGXRVQRVyORFLUFXODQVLQRTXHHVWiQSXHVWRV
HQODIXQFLyQGHHMHUFHUORRVXIULUOR « QXQFDVRQHOEODQFRLQHUWHRFyPSOLFHGHOSRGHU
son siempre sus elementos de recomposición.
(QRWUDVSDODEUDVHOSRGHUQRVHDSOLFDDORV
LQGLYLGXRV VLQR TXH WUDQVLWD D WUDYpV GH ORV
LQGLYLGXRV´
en la conducta de otro u otros. Considerado
FRPRPRGHORGHIXHU]DDVXPHTXHODVGHFLVLRnes son el promedio ponderado de los deseos
GH ORV DFWRUHV LQGLYLGXDOHV TXH WLHQHQ SRGHU
FRPR VXPD GH YHFWRUHV R ELHQ FRQVLGHUDGR
FRPRFR\XQWXUDOSRVLFLRQDO\FRPSRUWDPHQWDO
FDUiFWHU HVHVSHFt¿FRGHGRPLQLRRiUHD VH
SXHGHVHUSRGHURVRHQXQD\HQRWUDQR &RPR
PRGHORGHIXHU]DDVXPHTXHHOXVRGHOSRGHU
DIHFWD DO SRGHU ĺ KD\ XQD FXRWD ¿MD ¢FyPR
XQDFDQWLGDGGHSRGHUTXHVHDJRWD"RELHQ¢HV
XQDKDELOLGDGTXHDXPHQWDFRQHOHMHUFLFLRGHO
PLVPR"7DPELpQSXHGHHQWHQGHUVHFRPRPRGHORGHLQWHUFDPELRRQHJRFLDFLyQDVXPLHQGR
TXHODVDFWLWXGHVVRQUHODFLRQHVUHJXODGDVSRU
DOJ~QWLSRGHUHJOD ODVUHJODVGHOMXHJR FDGD
participante ingresa al juego con algún tipo de
UHFXUVR FRQRFLPLHQWR GLQHUR SURSLHGDG DFFHVRFRPSHWHQFLDHWF \WUDWDGHQHJRFLDUFRQ
A esto podría agregarse la idea de Barto- otros para mejorar su posición en el juego. La
ORPp GH TXH ORV GLUHFWLYRV VRQ servidores del DXWRULGDG HQ FDPELR VXUJH GH OD SRVLELOLGDG
poder y no sus maestros Harvard Business para tomar decisiones en nombre de la organiReview ,16($' (O SRGHU HV OD FD- ]DFLyQ\HVRUHTXLHUHFLHUWDIRUPDGHUHFRQRpacidad potencial o actual de imponer a los FLPLHQWR GH SDUWH GH DTXpOOD HV XQ FRQFHSWR
GHPiV OD SURSLD YROXQWDG HV OD FDSDFLGDG GH DQiORJRDOGHSRGHUSHURPiVUHVWULFWLYR7UHV
XQD SHUVRQD GH LQÀXLU GH OD PDQHUD GHVHDGD FDUDFWHUtVWLFDVORGH¿QHQ
)RXFDXOW0Genealogía del racismo/D3ODWD(G$OWDPLUD
Véase también la idea de juego socialGH0DWXVHQTeoría del juego social%XHQRV$LUHV(G81/D
5 - Gestión de objetivos y poder en la organización / 127
1. Se deposita en supuestos organizacionales:
la gente tiene autoridad no per se sino por los
SXHVWRVTXHRFXSD
/RVVXERUGLQDGRVDFHSWDQODDXWRULGDGSRUTXHODRUJDQL]DFLyQOHJLWLPDDTXLHQHVODGHtentan.
)OX\HDWUDYpVGHODOtQHDYHUWLFDOKDFLDDEDMR
QRKDFLDDUULEDRKDFLDORVFRVWDGRVFRPR
HOSRGHUTXHWLHQHOLEUHPRYLOLGDGFRPROD
GDPDHQHOMXHJRGHDMHGUH] /DDXWRULGDGIRUPDOHVDPHQXGRLQVX¿FLHQWH
SDUDORJUDUORVFRPSRUWDPLHQWRVTXHVHUHTXLHUHQ D~Q HO TXH SRGUtD FRQVLGHUDUVH XQR GH ORV
Pi[LPRV SRGHUHV HO GH GHVSHGLU DO VXERUGLQDGR SXHGH HVWDU VXSHGLWDGR D OD SRVLELOLGDG GH
ORJUDUXQUHHPSOD]RHQWLHPSR\IRUPDFRQOR
TXHHVWiVXMHWRDXQtiempo políticoQRHVRPQtPRGR1LQJXQDSHUVRQDRUJDQL]DFLyQRQDFLyQ
concentra de forma ilimitada y por siempre todo
HOSRGHUVLQRDORVXPRHVGHSRVLWDULRWUDQVLWRrio de aspectos del mismo.
/D DFWLYLGDG SROtWLFD HQ ODV RUJDQL]DFLRQHV
HVWiDWUDtGDSRUGRVH[WUHPRVSRODUHVHOSRORGH
acumulación de poder y el polo del uso del poGHU(OSULPHURHVHOSRGHUFRPR¿QSRUHOSRGHUPLVPRORTXH0DWXVOODPDHOpolo chimpancé del poder; el otro es el polo del uso del poder
FRPRPHGLRSDUDORJUDUDOJRFRPRLQVWUXPHQWRHOTXH0DWXVOODPDHOpolo Maquiavelo-Gandhi.143RGUtDLQFOXVRKDFHUVHODGLVTXLVLFLyQGHVL
H[LVWHHOSRGHUHQIRUPDLQGHSHQGLHQWHGHVXXVR
RVLVyORVHWUDQVIRUPDHQWDOHQDFWR
estos temas son tratados como ingenuas cadenas
causales –condenadas a una pobre linealidad las
PiVGHODVYHFHV±DODVTXHSUHVXQWXRVDPHQWHVH
DWULEX\HODYLUWXGGHH[SOLFDUFLHQWt¿FDPHQWH los
acontecimientos.
6LHPSUHVHKDDUJXPHQWDGRTXHHQODVOODPDdas ciencias del hombre o blandas es imposible
ODGXUH]DTXHVHrequiereDOHVWDWXVGHFLHQWt¿FR
VHJ~Q HO LPDJLQDULR SRSXODU GDGD OD DEVROXWD
unicidad o irrepetibilidad de los hechos socioKLVWyULFRV 'LItFLOPHQWH SXGLHUD VRVWHQHUVH TXH
WDOHV VXFHVRV QR VRQ ~QLFRV HV YHUGDG SHUR
¢QRHVpVWHXQUDVJRFRP~QDWRGRVORVREMHWRV
LQFOXVRORVPDWHULDOHV"7RGRREMHWRRH[LVWHQWH
VLVWHPDVXFHVRRSURFHVR HVKDVWDFLHUWRSXQto un unicumDOPHQRVHQFLHUWRDVSHFWR %XQJH 5HFXpUGHVH OR VHQWDGR SRU /HZLV \
/HZRQWLQ ODV FRVDV VRQ VLPLODUHV HVR KDFH
SRVLEOHODFLHQFLDODVFRVDVVRQGLIHUHQWHVHVR
KDFHQHFHVDULDODFLHQFLD$XQDFHSWDQGRTXHORV
hechos históricos son sideralmente más ricos
TXH ORV PDWHULDOHV \ HVWR ORV KDFH VXVFHSWLEOHV
GH XQ JUDGR PiV HOHYDGR GH HVSHFL¿FLGDG QR
TXLHUHGHFLUTXHRFXUUDQVyORXQDYH]HQWRGRV
VXV DVSHFWRV TXH VHDQ H[DFWD \ DEVROXWDPHQWH
irrepetibles. Sostener tal irrepetibilidad históriFDHVWDQDEVXUGRFRPRVRVWHQHUTXHODKLVWRULD
siempre se repite. Si los sucesos de índole históULFD IXHVHQ DEVROXWD \ HVHQFLDOPHQWH GLYHUVRV
entonces nada sería inteligible y todo el relato
KLVWyULFR SDUHFHUtD XQD QRYHOD LQFRPSUHQVLEOH
GHEHKDEHUSXHVXQDPDWUL]XQFRP~QGHQRPLQDGRUTXHORVLQVHUWHHQXQPDUFRGHLQWHOLJLELOLGDG HVWR HV VHJXUDPHQWH OD UHYROXFLyQ IUDQcesa tiene puntos en común con la rusa por más
TXHODSULPHUDHVWDOOySUHFLVDPHQWHHQ)UDQFLD\
QRHQ$XVWULD3UXVLD3RORQLDR,QJODWHUUDSRU
HMHPSOR EDMR FRQGLFLRQHV DQiORJDV R D~Q GH
PD\RUSREUH]D\VXPLVLyQVHJ~QSODQWHD*HRUge Rudé.
(MHPSORHVFODUHFHGRUGHHVWHHQIRTXHHVXQR
GHORVWH[WRVGH0DTXLDYHORVREUHODKLVWRULDGH
)ORUHQFLD FLWDGRSRU%XQJH 8Q FXHUSR GH GHVDUUROOR GH LGHDV PiV TXH
LQWHUHVDQWHVVREUHHOSRGHUVXWHRUtD\VXSUD[LV
HVHODSRUWDGRSRU0DULR7HVWD15TXLHQPHQFLRQDGRVHVWUDWHJLDVGHDFFHVRDOPLVPRTXHOODPD
asalto al poder y guerra de trincheras. Desde
XQD ySWLFD KLVWyULFD WHRUL]D 7HVWD VREUH HVWDV
LGHDVFRQVLGHUDQGRORVVXFHVRVYLQFXODGRVDOD
UHYROXFLyQ GH RFWXEUH GH HQ 5XVLD HQ HO
3DODFLRGH,QYLHUQRGHORV]DUHV
Hemos considerado en otro lugar16 TXH HO
análisis de los problemas históricos –apasionan³3HUGLy OD UHS~EOLFD GH )ORUHQFLD GHVSXpV
WHVSRURWUDSDUWH±VLUYHGHPRGHORSDUDFRP- GHODxR3LVD\RWUDVSREODFLRQHVFRQJUDQ
prensión de muchos fenómenos. Por lo general SDUWHGHVXWHUULWRULR\WXYRTXHJXHUUHDUFRQORV
0DWXV&Teoría del juego social op. cit.
7HVWD0Pensamiento estratégico y Lógica de programaciónFLWDGRHQODELEOLRJUDItD
16
/HPXV-'9$UDJHV\2UR]Epidemiología y Salud Comunitaria5RVDULR%XHQRV$LUHV(G&RUSXV
9pDVH5XGp*La Revolución Francesa$UJHQWLQD(GLWRULDO%
14
15
128 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
TXHORRFXSDEDQSHURVLHQGRpVWRVSRGHURVRV
la guerra era costosa y sin fruto. El aumento de
JDVWRVRFDVLRQDEDDXPHQWRGHWULEXWRV\pVWRV
LQ¿QLWDVTXHMDVGHOSXHEOR'LULJtDODJXHUUDXQ
&RQVHMRGHGLH]FLXGDGDQRVOODPDGRV/RV'LH]
GHOD*XHUUD\WRGRHOSXHEORHPSH]yDGHPRVWUDUOHVDYHUVLyQFXDOVLIXHUDQODFDXVDGHHOOD\
GHORVJDVWRVTXHRFDVLRQDEDSHUVXDGLpQGRVHGH
TXHVXSULPLGRHO&RQVHMRWHUPLQDUtDODJXHUUD
3DUD FRQVHJXLGR GHMDURQ H[SLUDU ORV SRGHUHV
de los consejeros sin elegir sucesores y concedieron dicha autoridad a la Señoría [el Consejo
6XSUHPR@´
/DFDGHQDFDXVDOGH0DTXLDYHORHVPiVTXH
VLPSOHSpUGLGDGHWHUULWRULRVTXHOOHYDDODĺ
JXHUUDTXHJHQHUDĺJUDQGHVJDVWRVTXHRFDVLRQDQ ĺ IXHUWHV LPSXHVWRV TXH OOHYDQ DO ĺ
GHVFRQWHQWRSRSXODUTXHSURGXFHODĺGLVROXción del Consejo de guerra. Si bien este tipo de
GHVFULSFLyQHVIiFLOGHHQWHQGHUHVWDPELpQXQD
VLPSOL¿FDFLyQ H[FHVLYD SXHV HQ UHDOLGDG FDGD
HVODEyQ GH OD FDGHQD HV SURGXFLGR SRU YDULRV
GHWHUPLQDQWHV GH ORV TXH VH H[WUDH \ VH PHQFLRQD VyOR HO SULQFLSDO $GHPiV OD QDWXUDOH]D
HVSHFt¿FDGHFDGDHVODEyQHQODFDGHQDLPSRUWD
tanto como la cadena en su totalidad; y esta naWXUDOH]DHVSHFt¿FDFDUDFWHUL]DGDFRPRHVWiSRU
una estructura peculiar y por leyes peculiares de
DXWRGHVDUUROORTXHGDIXHUDGHOQH[RFDXVDOTXH
HVHQJUDQPHGLGDH[WHUQR/DVFDGHQDVFDXVDOHV
QRVRQWDQDXWRH[SOLFDWLYDVFRPRVXHOHFUHHUVH
ORH[SOLFDWLYRQRHVODVHULHGHHVODERQHVHQVt
PLVPD VLQR OD PXOWLWXG GH KLSyWHVLV R DXQ GH
WHRUtDVTXHVHRFXOWDQWUDVODVSDODEUDV(OSULQFLSDO PRWLYR GH TXH ODV FDGHQDV FDXVDOHV VyOR
SXHGDQUHVXOWDUHQHOPHMRUGHORVFDVRVEXUGDV
DSUR[LPDFLRQHVGXUDQWHEUHYHVSHUtRGRVHVTXH
HOODVVXSRQHQXQDLVODPLHQWR¿FWLFLR3DUDSRGHU
considerar causal un proceso debemos separar
XQIDFWRUFDXVDORXQDGHODVFRQVHFXHQFLDVGH
toda una constelación de determinantes. Pero
HVWD VHSDUDFLyQ D~Q VLHQGR YiOLGD \ KDVWD LQGLVSHQVDEOHFRPRSURFHGLPLHQWRPHWRGROyJLFR
HVREMHWDEOHGHVGHHOSXQWRGHYLVWDRQWROyJLFR
(Q ULJRU SXHGH FRPSUREDUVH HPStULFDPHQWH
TXH WRGR VXFHVR HV SURGXFLGR HQ UHDOLGDG SRU
XQDFDQWLGDGGHIDFWRUHVRFXDQGRPHQRVHVWi
DFRPSDxDGR SRU PXFKRV RWURV VXFHVRV TXH VH
UHODFLRQDQ FRQ pO GH DOJXQD PDQHUD GH PRGR
TXHODVHSDUDFLyQLPSOLFDGDHQODLPDJHQGHOD
FDGHQDFDXVDOFRQVWLWX\HXQDDEVWUDFFLyQH[WUHma. Así como los objetos ideales no pueden ais-
ODUVHGHVXVUHVSHFWLYRVFRQWH[WRVORVH[LVWHQWHV
PDWHULDOHV UHYHODQ P~OWLSOHV LQWHUFRQH[LRQHV
GH GRQGH HO XQLYHUVR QR HV XQ F~PXOR GH REMHWRV VLQR XQ VLVWHPD GH VLVWHPDV LQWHUDFWXDQWHV &RPR FRQVHFXHQFLD HO HIHFWR SDUWLFXODU E
no sólo es el producto de la causa C sino tamELpQGHPXFKRVRWURVIDFWRUHVYLQFXODGRVFRQ&
en las situaciones reales siempre hay toda una
FRQVWHODFLyQGHGHWHUPLQDQWHV<DODLQYHUVD&
producirá no sólo E sino también muchas otras
consecuencias: con más razón si procedemos a
tomar en cuenta las causas llamadas remotas de
XQVXFHVRHQOXJDUGHODVSUy[LPDV3DUDH[SUHVDUORGHRWURPRGRKD\VLHPSUHYLQFXODFLRQHV
HQWUH PXFKRV FRQMXQWRV GH IDFWRUHV QXQFD HQWUH VXFHVRV \ FXDOLGDGHV DLVODEOHV \ VHSDUDGRV
FRPR VXSRQH OD QRFLyQ GH FDXVDOLGDG VHQFLOOD
OLQHDO\FRWLGLDQD<SRUHOORODKLSyWHVLVGHTXH
HOGHYHQLUHVXQDFDGHQDFDXVDOSDUHFHXQDVHlección unilateral –y hasta arbitraria según la
posición del analista– de una rica red de interFRQH[LRQHV 3HUR OD VHOHFFLyQ HIHFWXDGD SRU HO
SHQVDPLHQWRFDXVDOSRUPiVTXHVHDGHIHFWXRVD
GHVGHHOSXQWRGHYLVWDRQWROyJLFRHVLQHYLWDEOH
metodológicamente. La posibilidad de obtener
HPStULFDPHQWHDLVODPLHQWRVEDVWDQWHFRPSOHWRV
GHPRGL¿FDUXQIDFWRUVLQSURYRFDUDOWHUDFLRQHV
QRWDEOHVHQODVUHVWDQWHVYDULDEOHVUHIXWDODWHVLV
GH OD LQWHUFRQH[LyQ XQLYHUVDO sin restricciones
GHWRGRVORVHQWHVHQWRGRVORVUHVSHFWRV )iFLOPHQWHSXHGHDGPLWLUVHTXHVyORFRQRFHmos unas pocas leyes históricas universales, en el
sentido de pautas comunes a todos los períodos
\ D WRGRV ORV WLSRV GH RUJDQL]DFLyQ VRFLDO \ HQ
el formato de leyes estadísticas, tanto en el senWLGRGHTXHLPSOLFDQDJUXSDFLRQHVQXPHURVDVGH
KRPEUHVFRPRHQHOGHTXHQRULJHQSDUDWRGRV
y cada uno de los casos singulares sino en cierto
SRUFHQWDMHGHFDVRV(QVHJXQGROXJDUFDGDWLSR
GHRUJDQL]DFLyQVRFLDOH[LVWH\VHGHVHQYXHOYHGH
acuerdo con sus propias y peculiares leyes. Las
OH\HV KLVWyULFDV QR JUDYLWDQ GHVGH OR DOWR ROtPSLFDPHQWHSRUHQFLPDGHORVKRPEUHVVLQRTXH
VRQODVIRUPDVHQTXHORVKRPEUHVVHODVDUUHJODQ
a lo largo del tiempo. Aún así algunas leyes sociaOHVVHPDQWLHQHQFRQEDVWDQWHFRQVWDQFLDDWUDYpV
GHODKLVWRULD\ODH[LVWHQFLDGHHVWDVinvariantes
culturalesRSDXWDVFRQVWDQWHVGHFRPSRUWDPLHQWRVRFLDO±DOPHQRVSDUDFLHUWDVFXOWXUDVHQFLHUWRVSHUtRGRVGHWLHPSREDMRFLHUWDVFRQGLFLRQHV
GHWHUPLQDGDV± HV OR TXH SHUPLWH SRU HMHPSOR
DORVDQWURSyORJRVKDEODUGHel hombre\DORV
historiadores de la historia humana8QDGHHV-
5 - Gestión de objetivos y poder en la organización / 129
WDVLQYDULDQWHVSXGLHUDVHUHOSUHGRPLQLRDODUJR
SOD]RGHODVFRQGLFLRQHVPDWHULDOHV HFRQyPLFDV VREUHODVHVSLULWXDOHVRELHQHOTXHVLHQWDTXHORV
cambios profundos en el modo de producción
SURYRFDQDODODUJDODUHQRYDFLyQGHODHVWUXFWXUD
VRFLDORODWHVLVGHTXHODUHFROHFFLyQ\ODFD]D
SUHFHGHQ D OD GRPHVWLFDFLyQ GH ODV SODQWDV ORV
DQLPDOHV\ORVKRPEUHVODTXHDVXYH]SUHFHGHD
ODFLYLOL]DFLyQ8Q~OWLPRHMHPSORVXPDPHQWHLQWHUHVDQWHHVHOTXHHVWDEOHFHODGXUDELOLGDGDFRWDGDGHORVLPSHULRV LQFOXVRHOURPDQRFLWDGRSRU
+HDWKHU VLJXLHQGRFLQpWLFDVFRQRFLGDVSRU
DJRWDPLHQWR \ UHVTXHEUDMDGXUDV LQWHUQDV GDGRV
HO GUHQDMH FRQWLQXR GH UHFXUVRV SDUD OD JXHUUD
HOSHUPDQHQWHHVIXHU]REpOLFRODJUDQDPSOLWXG
JHRJUi¿FD GH ODV IURQWHUDV \ SULQFLSDOPHQWH OD
GHVFRQH[LyQGHFLHUWRVSRORVSHULIpULFRVGHSRGHU
GHO SRGHU FHQWUDO TXH TXHGDQ DVt DLVODGRV \ IRmentan la sedición por la desigual distribución de
EHQH¿FLRV\SUHEHQGDV
Además de lo considerado debe tenerse en
FXHQWDHOKHFKRGHTXHFXDOTXLHUWLSRGHOH\FLHQWt¿FDQRYDOHSDUDFDVRVFRQFUHWRVHVSHFt¿FRVH
LQGLYLGXDOHV HVWRHVIXQGDPHQWDOHQPHGLFLQD\
HSLGHPLRORJtD VyORULJHODOHJDOLGDGSDUDFODVHVGHREMHWRV\ODVFODVHVVyORWLHQHQH[LVWHQFLD
UHDOHQXQQ~PHUROLPLWDGRGHDVSHFWRVPLHQWUDV
TXHORVVLVWHPDVVXFHVRVSURFHVRVRFDVRVFRQFUHWRVWLHQHQXQQ~PHURLOLPLWDGRGHIDFHWDVGH
PRGRTXHSXHGHQSHUWHQHFHUVLPXOWiQHDPHQWHD
PXFKDV FODVHV GLYHUVDV /RV REMHWRV FRQFUHWRV
pueden considerarse como intersecciones de un
HOHYDGR \WDOYH]LQ¿QLWR Q~PHURGHOH\HV
5HVXPLHQGR H[LVWHQ OH\HV KLVWyULFDV WDQWR
XQLYHUVDOHVFRPRJHQHUDOHVVLQTXHHVWRVLJQL¿TXH TXH OD KLVWRULD VH UHSLWD ([LVWHQ QRUPDV
JHQHUDOHVGHFRPSRUWDPLHQWRFROHFWLYRSHUROD
PD\RUtDGHHOODVSRUVHUSHFXOLDUHVGHOWLSRGH
HVWUXFWXUDVRFLDOVHPRGL¿FDQDVXYH]FRQFDGD
transformación social radical. La mayoría de las
OH\HV HFRQyPLFDV VRFLDOHV FXOWXUDOHV H KLVWyULFDVQRFRQVLVWHQHQSDWURQHV¿MRVUHFXUUHQWHV
TXHDIHFWDQODtotalidad de una clase de sucesos
LQGLYLGXDOHVVRQHQFDPELRtendencias, RVHD
rumbos generales y a largo plazo. No se aplican
VLQH[FHSFLyQDWRGRVXFHVRLQGLYLGXDOGHFLHUWD
FODVH VLQR D XQ SRUFHQWDMH GDGR \ YDOHQ SDUD
clases de grandes FROHFFLRQHVGHVXFHVRVVRQ
HQVtQWHVLVUHJXODULGDGHVFROHFWLYDV
1LDOO)HUJXVRQHistoria Virtual0DGULG7DXUXV
Sobre el así llamado determinismo histórico
PHQFLRQDUHPRVSDUDWHUPLQDU\\DTXHKDVLGR
XQFDPSRGHJUDQLQWHUpVHOGHVDUUROORGHOOODPDdo contrafactualismo histórico(QXQH[FHOHQWH
libroFerguson compila una serie de trabajos
VREUHHVWHWHPDDOTXHFRQFLEHHQVXVSURSLDV
SDODEUDV FRPR XQD teoría caótica del pasado
HVWR HV OD construcción de escenarios alternativos; qué habría ocurrido de haber o no haber
pasado tal cosa. Por ejemplo: ¿y si Napoleón
QRKXELHVHVLGRGHUURWDGRHQ:DWHUORR"2¢\VL
.HQQHG\QRKXELHVHVLGRDVHVLQDGR"¢6LUYHSDUD
DOJRKDFHUVHHVWHWLSRGHSUHJXQWDV"UHÀH[LRQD
)HUJXVRQ¢RHVXQVLPSOHHMHUFLFLROLWHUDULRXQ
juego de salón? Al parecer no podemos resistirnos a imaginar escenarios alternativos a las
cosas que efectivamente pasaron; este proceder
parece formar parte esencial de nuestra manera
de aprenderRLQFOXVRGHWUDPLWDUDFRQWHFLPLHQtos traumáticos pasados; esto pensaba Freud del
KHFKRGHTXHSRUFDVRORVSDFLHQWHVJUDYHPHQWH
OHVLRQDGRV HQ DFFLGHQWHV IHUURYLDULRV XVXDOHV
HQ OD VHJXQGD PLWDG GHO VLJOR ;,; UHFUHDEDQ
fantasmáticamente en su imaginación una y otra
YH]HOWUDXPDDSHVDUGHHVWDUpVWHLQWHQVDPHQWH
FDUJDGRGHHPRFLRQHVDQJXVWLDQWHVFRPRHQXQ
LQWHQWRGHODPHQWHWDQUHFXUUHQWHFRPRLQ~WLO
GHHQFRQWUDURWUDVDOLGDXQDDOWHUQDWLYDDORTXH
realmente había ocurrido.
En nuestra vida diaria nos hacemos constantemente esta clase de pregunta contrafactual. ¿Y
VLKXELHUDYLDMDGRHQHODYLyQTXHVHDFFLGHQWy"
¿Y si nunca hubiera conocido a mi mujer o mi
marido?
'DGRTXHODVGHFLVLRQHVVREUHHOIXWXURHVWiQ
en general basadas en una ponderación de las
FRQVHFXHQFLDVSRWHQFLDOHVGHGLYHUVRVFXUVRVGH
DFFLyQHVVHQVDWRFRPSDUDUORVUHVXOWDGRVGHOR
TXHHQHIHFWRKLFLPRVHQHOSDVDGRFRQUHVXOWDGRV FRQFHELEOHV VREUH OR TXH SRGUtDPRV KDEHU
hecho.
A menudo suceden hechos de importancia
FUXFLDOTXHGHSHQGHQGHXQDSHUVRQDRGHFLUFXQVWDQFLDV PX\ SDUWLFXODUHV FRPR HO FOLPD
(VWR SRQH HQ HYLGHQFLD FRQ FUXGH]D OD GHELOLGDG GHO GHWHUPLQLVPR KLVWyULFR HQ HO FRQWH[WR
TXHHVWDPRVDQDOL]DQGR(OGHYHQLUKLVWyULFRHV
XQIHQyPHQRH[WUHPDGDPHQWHFRPSOHMRVHJ~Q
KHPRV YLVWR \ FRPR WDO WLHQH FDUDFWHUtVWLFDV
caóticas. 8QR GH ORV IDFWRUHV pudo haber sido
130 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
GLIHUHQWHSHUR¢VHKDEUtDQPDQWHQLGRWRGRVORV
GHPiV")HUJXVRQGLFHTXH³&RPRHOSHUVRQDMH
7¶VXL3rQGH%RUJHVHQ³(OMDUGtQGHVHQGHURV
TXH VH ELIXUFDQ´ HO KLVWRULDGRU VH HQIUHQWD D
XQQ~PHURLQ¿QLWRGHbifurcaciones.2ELHQVHJ~Q$QGUp0DXURLV³«H[LVWHQXQDLQ¿QLGDGGH
SDVDGRVWRGRVLJXDOPHQWHYiOLGRV«HQWRGRV\
FDGDXQRGHORVLQVWDQWHVGHOWLHPSRSRUEUHYHV
TXH ORV VXSRQJDPRV OD OtQHD GH ORV DFRQWHFLmientos se bifurca como el tronco de un árbol al
TXHOHQDFLHUDQUDPDVJHPHODV«HOKLVWRULDGRU
WLHQH TXH VLWXDUVH FRQVWDQWHPHQWH HQ XQ SXQWR
GHOSDVDGRHQHOTXHORVIDFWRUHVFRQRFLGRVSDUH]FDQSHUPLWLUUHVXOWDGRVGLYHUVRV«VLHVFULEH
VREUH6DODPLQDWLHQHTXHKDFHUORFRPRVLD~Q
IXHUDSRVLEOHXQDYLFWRULDSHUVD«´
(OHQIRTXHFRQWUDIDFWXDOHVUHVLVWLGRSRUYDULHGDG GH KLVWRULDGRUHV FRPR &DUU SDUD TXLHQ
HVWRQRHVPiVTXHXQGLYHUWLPHQWR$VXMXLFLR
ODFXHVWLyQGHFRQWHPSODUODVFRVDVTXHSRGUtDQ
KDEHUSDVDGRHVUHWyULFD\HQRWURVHQWLGRDGHPiVORTXHHIHFWLYDPHQWHRFXUULyHV tan improEDEOHRH[WUDxRFRPRORTXHQRRFXUULyDXQTXH
QRVSDUH]FDQRUPDOMXVWDPHQWHSRUHOKHFKRGH
TXH RFXUULy /D KRVWLOLGDG DO HQIRTXH FRQWUDIDFWXDOVHDGYLHUWHWDPELpQHQ7KRPVRQTXLHQ
KDEODGH³¿FFLRQHVFRQWUDIDFWXDOHV´(QGH¿QLWLYD\TXL]ipVWDVHDODOHFFLyQPiVLPSRUWDQWH
DOGHFLUGH)HUJXVRQ³1RGHEHPRVVXEHVWLPDU
QXQFDODDFFLyQGHODFRQWLQJHQFLDGHOD]DUGH
ORTXHORVPDWHPiWLFRVOODPDQµFRPSRUWDPLHQWR
HVWRFiVWLFR¶´(QGH¿QLWLYDOD+LVWRULDQRWLHQH
un rumbo preestablecido. Continuamente actúan
IDFWRUHVTXHSRGUtDQKDEHUVLGRGLIHUHQWHVDOWHrando de modo notable los resultados. Sin embargo al mismo tiempo, junto al carácter aleaWRULRGHOSURFHVRKLVWyULFRKD\WHQGHQFLDVSURIXQGDV ¢atractores extrañosGHXQPRYLPLHQWR
FDyWLFR" TXHFRQGXFHQDVLWXDFLRQHVanálogas,
DXQTXHVXFHGDQHQFLUFXQVWDQFLDVGLIHUHQWHV VH
KDEUtDOOHJDGRDXQD8QLyQ(XURSHDFRQJXHUUD
o sin ella; España habría desarrollado una economía abierta y un sistema democrático mucho
DQWHV\VLQJXHUUDFLYLOFRPRORKL]R¿QDOPHQ
WH 3RU~OWLPRODKLVWRULDreal es a menudo inWHUSUHWDGD GH PDQHUDV WDQ GLIHUHQWHV LQFOXVR
RSXHVWDV TXHDOPLVPRWLHPSRSXHGHFRQVLGHrarse ella misma también virtual.
9ROYLHQGRD7HVWD\DODVDOWRDO3DODFLRGH,QYLHUQRHQRFWXEUHGHHQODFLXGDGGH6DQ
3HWHUVEXUJR PiVWDUGH/HQLQJUDGR HVWHKHFKR
SDUWLFXODUtVLPRVLUYHGHDQDORJtDDOFRQFHSWRPLVPR\ODIRUPDGHDGTXLVLFLyQGHOSRGHU8QRGH
ORVPHQFLRQDGRVVXSXHVWRVLPSOtFLWRVHVTXL]iOD
FRQIXVLyQGHXQHSLVRGLRKLVWyULFRFRQODKLVWRULD
TXHHQHOWHUUHQRLQWHOHFWLYRHVODLQWHUSUHWDFLyQ
de lo abstracto como concreto. Complementando
ORTXHDQWHVGLMLPRVXQHSLVRGLRKLVWyULFRHVXQD
DEVWUDFFLyQSRUTXHHVWiGHVSRMDGRGHVXVP~OWLSOHVGHWHUPLQDFLRQHVTXHGDQGRVRPHWLGRDXQD
~QLFD GHWHUPLQDFLyQ OD FLUFXQVWDQFLD TXH SRQH
en marcha el episodio. Esta abstracción deshistoriza OD KLVWRULD OD WUDQVIRUPD HQ XQD VLPSOH
VHFXHQFLDGHKHFKRVDQHFGyWLFRVPiVPHQRVLQWHUHVDQWHVSHURGHVKLOYDQDGRVVLQXQDOyJLFDTXH
los interconecte en una secuencia probable (véase
más arriba lo comentado por Bunge en este sentido)(OVHJXQGRJUDQVXSXHVWRLPSOtFLWRHVTXH
HQWHQGLGR HO HSLVRGLR KLVWyULFR FRPR KLVWRULD
entonces la lógica del primero se transforma en
ODOyJLFDGHODVHJXQGDFRQORTXHVHFRPSOHWD\
perfecciona el saber de la estrategia de asalto al
poder6LHODVDOWRDO3DODFLRGH,QYLHUQRFRPHQWDGRHQHVWHFRQWH[WRSRU7HVWDHVHQWHQGLGRQR
FRPRVLPSOHDQpFGRWDVLQRFRPRODFRQFUHFLyQ
KLVWyULFDGHODOXFKDUHYROXFLRQDULDHQWRQFHVOD
HVWUDWHJLDGHHQIUHQWDPLHQWRWRWDOHVH¿FD]SDUD
FRQTXLVWDU HO SRGHU \ WUDQVIRUPDU OD VRFLHGDG
¢&XiOHV VRQ ODV GHULYDFLRQHV GH HVRV VXSXHVWRV
HQ FXDQWR SUiFWLFDV" VH SUHJXQWD 7HVWD < UHVSRQGH³«ODSUiFWLFDHVHOHQIUHQWDPLHQWRWRWDO
HQWHQGLGRFRPRHQIUHQWDPLHQWRItVLFRPDWHULDO
SXHVWRTXHVHWUDWDGHRFXSDUHO3DODFLRSDUDKDFHUHIHFWLYDODFRQTXLVWDGHOSRGHU(OVDEHU\OD
SUiFWLFDGHVFULWRVFLHUUDQHOFtUFXORSHUIHFWRTXH
FODXVXUDODKLVWRULDODFRQTXLVWDGHOSRGHUVyOR
SXHGHKDFHUVHHIHFWLYDDVDOWiQGROR´
“«DGLIHUHQFLDGH1HZWRQRGH6KRSHQKDXHUQRFUHtDHQXQWLHPSRXQLIRUPHDEVROXWR&UHtDHQLQ¿QLWDVVHULHVGH
WLHPSRHQXQDUHGFUHFLHQWH\YHUWLJLQRVDGHWLHPSRVGLYHUJHQWHVFRQYHUJHQWHV\SDUDOHORV«HVWDWUDPDGHWLHPSRV
TXHVHDSUR[LPDQVHELIXUFDQVHFRUWDQRTXHVHFXODUPHQWHVHLJQRUDQDEDUFDQWRGDVODVSRVLELOLGDGHV1RH[LVWLPRV
HQODPD\RUtDGHHVRVWLHPSRVHQDOJXQRVH[LVWH8G\QR\RHQRWURV\RQR8G(QRWURVORVGRVHQHVWHTXHXQ
IDYRUDEOHD]DUPHGHSDUD8GKDOOHJDGRDPLFDVDHQRWURV8GDODWUDYHVDUHOMDUGtQPHKDKDOODGRPXHUWR«´ JL
%RUJHV³(OMDUGtQGHVHQGHURVTXHVHELIXUFDQ´Obras Completas%V$V(GLWRULDO(0(&(.
Esto es determinado por el azar.
5 - Gestión de objetivos y poder en la organización / 131
/D SURSXHVWD DOWHUQDWLYD D pVWD VH FRQR‡ Poder mediante la resolución de contingence como la guerra de trincheras y se trata
cias críticas o estratégicas: hablando en téren esencia de una forma de lucha desde poPLQRVJHQHUDOHVHVSRVLEOHFRQVLGHUDUODLQVLFLRQHV DGYHUVDV D ODV GRPLQDQWHV SHUR TXH
IRUPDFLyQHOFRQRFLPLHQWR\ODVKDELOLGDGHV
HQ OXJDU GH SULYLOHJLDU XQD DFFLyQ UiSLGD \
especiales como tipos de recursos en una
GHILQLWLYD SODQWHD OD RFXSDFLyQ SDXODWLQD GH
organización.
HVSDFLRV TXH YDQ VLHQGR WUDQVIRUPDGRV SDVR ‡Sustituibilidad: la capacidad para solucionar
a paso en posiciones firmes –trincheras– desproblemas críticos o suministrar recursos esGH GRQGH HV SRVLEOH UHDOL]DU QXHYRV DYDQFHV
casos a una empresa proporciona claramente
D PHGLGD TXH VH SUHVHQWHQ FR\XQWXUDV IDYRXQD EDVH GH SRGHU 6LQ HPEDUJR FXDQGR OD
UDEOHV R VLPSOHPHQWH PDQWHQHU OD SRVLFLyQ
organización puede sustituir de alguna maesperando la oportunidad. ¿Cuál es el saber
QHUDHVWDVKDELOLGDGHVFRQRFLPLHQWRVWpFQLFRV\UHFXUVRVODVSHUVRQDVRGHSDUWDPHQWRV
TXHVRVWLHQHHVWDSRVWXUD"(VODFRQYLFFLyQGH
pierden poder.
TXH OD VRFLHGDG PRGHUQD EULQGD ORV HVSDFLRV
VRFLDOHV YLUWXDOHV TXH SXHGHQ FRQYHUWLUVH HQ ‡(OSRGHU\ODXELFDFLyQHQODHPSUHVD HOOODPDdo poder de Antonio PérezIDPRVRVHFUHWDULR
ORV HVSDFLRV UHDOHV GH OXFKD SROtWLFD TXH QR
GHOPRQDUFDHVSDxRO)HOLSH,, ¢FXiQWDVYHFHV
VHHQFXHQWUDQFHUUDGRVORVFDPLQRVGHDYDQFH
VHLQWHQWDSRUHMHPSORFRQVHJXLUODDWHQFLyQ
hacia propuestas transformadoras.
GHXQUHVSRQVDEOHGHGHFLVLRQHVFODYHSRUFXDO(QRWURFRQWH[WR%LDQFRQL6DQFKH]\FRO
TXLHU PRWLYR \ DOJXQD VHFUHWDULD R DVLVWHQWH
KDEODQ GH ³JULHWDV´ FLWDQGR D 5RYHUH HQ XQD
LPSLGHDFFHGHUDHVWDSHUVRQD"/RVLQGLYLGXRV
FRPXQLFDFLyQSHUVRQDOGHKDFLHQGRDOXVLyQ D TXH HO DYDQFH HQ SUR\HFWRV R WDUHDV VH
TXHRFXSDQWDOHVSXHVWRVsubalternos a menuKDFHSRUGRQGH\GHODPDQHUDTXHSHUPLWHOD
GRHMHUFHQSRGHUSRUTXHFRQWURODQHODFFHVRD
UHDOLGDGHQIUHQWDQGRRURGHDQGRORVDEVWiFXORV
GLFKDSHUVRQD HOOODPDGRacceso político y llegando hasta donde se puedan hacer cosas
RVHDJRWDODHQHUJtDGHORVDFWRUHVLQGLYLGXD- ¿De qué forma se ejerce el poder?
OHV &LWDGRHQ&DOLGDG\6DOXG0LQLVWHULRGH ‡Autoridad formal: forma de poder legitima6DOXGGHOD&LXGDG$XWyQRPDGH%XHQRV$LUHV
GR UHVSHWDGD \ UHFRQRFLGD SRU DTXHOORV HQ
ORVTXHREUDUHFtSURFDPHQWHSHURGHEHDSR\DUVHHQDOJRPiVFRPR1DSROHyQIUHQWHDO
ejército de Italia.
Fuentes de poder
‡Control de recursos escasos blandos: estrucWXUDV\SURFHGLPLHQWRVUHJODV\UHJODPHQWRV
$XQTXH DOJXQDV UHODFLRQHV GH GHSHQGHQFLD \
de la organización
alguna capacidad para solucionar problemas
FUtWLFRVHVWiQDVRFLDGDVFRQODMHUDUTXtDIRUPDO ‡Control del conocimiento y la información
‡Control de la tecnología
RUJDQL]DWLYDQRVLHPSUHHVDVtDOJXQDVSHUVRQDVTXHVHHQFXHQWUDQHQORVQLYHOHVLQIHULRUHV ‡$OLDQ]DVLQWHUSHUVRQDOHVUHGHV\FRQWUROGHOD
GHODRUJDQL]DFLyQSXHGHQREWHQHUXQSRGHUTXH
organización informal
D SULPHUD YLVWD SDUHFHUtD LQFRQVLVWHQWH FRQ VX ‡Control de las llamadas contraorganizaciones
posición. El poder puede encontrar sus bases
‡6H[R\FRQWUROGHODVUHODFLRQHVGHVH[R
HQDOPHQRV
‡ Poder mediante el control de recursos: ge- Tipología del poder de French y Raven
QHUDOPHQWH ORV LQGLYLGXRV R GHSDUWDPHQWRV
TXHFRQWURODQUHFXUVRVFUtWLFRVRHVFDVRVHQ (OWUDEDMRFOiVLFRGH)UHQFK\5DYHQHQXPHUD\
una organización pueden poseer un tremen- GHVFULEH GLYHUVDV EDVHV GHO SRGHU SUHVHQWHV HQ
do poder.
las organizaciones.
³'HEHPRV DQDOL]DU OD PDQHUD HQ OD FXDO ORV IHQyPHQRV ODV WpFQLFDV ORV SURFHGLPLHQWRV GH SRGHU IXQFLRQDQ
HQ ORV QLYHOHV PiV EDMRV PRVWUDU FyPR HVRV SURFHGLPLHQWRV VH WUDVODGDQ VH H[WLHQGHQ VH PRGL¿FDQ SHUR
VREUH WRGR PRVWUDU FyPR IHQyPHQRV PiV JOREDOHV ORV LQYLVWHQ \ VH ORV DQH[DQ \ FyPR SRGHUHV PiV JHQHUDOHV
REHQH¿FLRVHFRQyPLFRVSXHGHQLQVHUWDUVHHQHOMXHJRGHHVWDVWHFQRORJtDVGHSRGHUUHODWLYDPHQWHDXWyQRPDVH
LQ¿QLWHVLPDOHV«´)RXFDXOW0op. cit.
132 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
Poder racional o legal
6XUJHGHODDFHSWDFLyQGHXQDSHUVRQDGHTXHVX
ejercicio por parte de otra persona está de acuerGRFRQFLHUWRFRQMXQWRGHUHJODVRSURWRFRORTXH
DPEDVSDUWHVFRQVLGHUDQOHJtWLPR'HKHFKROD
legitimidad de este poder proporciona un nomEUHHVSHFt¿FRSDUDHVWDEDVHGHSRGHUHOSRGHU
OHJtWLPR*HQHUDOPHQWHHOSRGHUUDFLRQDOROHJDOUHVXOWDGHOWLSRGHSXHVWRTXHXQRRFXSD\
GHODSRVLFLyQTXHXQRRFXSDHQODMHUDUTXtDRUJDQL]DWLYD8QDJHQWHSROLFLDOWLHQHHOSRGHUGH
poner multas y de arrestar a la gente debido a las
UHJODV\DOSURWRFRORVRFLDOTXHOHDVLJQDQGLFKD
UHVSRQVDELOLGDG/RVVXSHUYLVRUHVSRVHHQSRGHU
legal o racional sobre sus subordinados debido
DOSRGHUTXHOHVFRQFHGHVXSXHVWRUHVSHFWLYR
Las condiciones de legitimidad son una funFLyQGHODFXOWXUDTXHHVLQVWUXPHQWDODODKRUD
GHGH¿QLUODVQRUPDVVRFLDOHV3RUHMHPSORHQ
países del lejano Oriente está legitimado mostrar
más deferencia a los miembros de un grupo de
HGDGPiVDYDQ]DGD \SRUORWDQWRVHOHVRWRUJD
PiVSRGHU TXHDORVPLHPEURVPiVMyYHQHV(Q
RWUDVFXOWXUDVHVWRQRWLHQHSRUTXpVHUDVt([LVWHQ RWURV IDFWRUHV TXH SXHGHQ UHVWDU YDORU D OD
edad y pueden ser fuentes de poder más potenWHVWDOFRPRSXHGHREVHUYDUVHFXDQGRHOSRGHU
VHHQFXHQWUDHQHOFRQRFLPLHQWRODFDSDFLGDGX
otro factor.
YLVRUSDUDORJUDUTXHORVVXERUGLQDGRVUHDOLFHQ
WDUHDVTXHTXL]iVQRUHDOL]DUtDQGHRWUDPDQHUD
–si bien como comentamos en detalle en otra
SDUWHGHHVWDREUDHQUHODFLyQDORVLQFHQWLYRV
el económico puede no ser el más importante de
ellos en algún caso. En la utilización del poder
GH UHFRPSHQVD WDPELpQ HV LPSRUWDQWH TXH OD
SHUVRQDTXHFRQWURODSRVHDFLHUWRVPHGLRVSDUD
GHWHUPLQDUVLVHKDFRPSOHWDGRODWDUHDUHTXHULGD$XQTXH HVWR SXHGH SDUHFHU EDVWDQWH REYLR
QRHVIiFLOOOHYDUDFDERHOSURFHVRGHHYDOXDFLyQ
del rendimiento y éste suele ser propenso a distorsiones e imprecisiones. Éste es el caso conFUHWRGHORVWUDEDMRVRWDUHDVTXHVHFDUDFWHUL]DQ
por su ambigüedad o incertidumbre.
Poder coercitivo
La capacidad para coaccionar o castigar a otra
persona es un fuerte fundamento de poder e inÀXHQFLD(VWDEDVHGHSRGHUSURSRUFLRQDDPHQXGRXQDIXHUWHPRWLYDFLyQ\SXHGHGHGLVWLQWDV
PDQHUDVFRQVLGHUDUVHFRPRHODQYHUVRGHOSRGHUGHUHFRPSHQVD0LHQWUDVTXHODLPSRUWDQFLD
del poder de recompensa se basa en la adminisWUDFLyQ GH SUHPLRV OD H¿FDFLD GHO SRGHU FRHUFLWLYR GHSHQGH GH VX FDSDFLGDG GH DGPLQLVWUDU
FDVWLJRV/DH¿FDFLDGHOSRGHUFRHUFLWLYRGHSHQGHGHODQDWXUDOH]DGHOFDVWLJRVXLPSDFWRSHUFLELGRODSUREDELOLGDGGHXVR\ODPHGLFLyQGH
ODV FRQGXFWDV GHVHDGDV (O 3RGHU FRHUFLWLYR HV
Poder de recompensa
PHQRVSRWHQWHVLODSHUVRQDDODTXHVHOHDSOLFD
(O SRGHU TXH SURYLHQH GH OD SURSLD FDSDFLGDG QRFRQFLEHHOFDVWLJRFRPRWDOVLORFRQVLGHUD
SDUDFRQWURODU\RWRUJDUEHQH¿FLRVDRWURVVHGH- UHODWLYDPHQWHVXDYHRVLODSUREDELOLGDGGHTXH
nomina poder de recompensa. El controlador de se utilice es escasa.
EHQH¿FLRVSRVHHODFDSDFLGDGGHPROGHDUODFRQducta de los demás por el simple hecho de ofre- Poder referente
FHURQHJDUHVWRVEHQH¿FLRV/DIXHU]DGHOSRGHU (OSRGHUUHIHUHQWHSXHGHGH¿QLUVHFRPRHOSRGHU
GHUHFRPSHQVDYLHQHSULQFLSDOPHQWHGHWHUPLQD- TXH$SRVHHVREUH%SRUTXHVHLGHQWL¿FDFRQ$
da por dos fuerzas principales: el tamaño de la (VWHVHQWLGRGHLGHQWL¿FDFLyQKDFHTXH$VHDFDUHFRPSHQVD\ODFUHHQFLDGHTXHVHUiFRQFHGLGD SD]GHLQÀXLUHQODFRQGXFWDGH%DXQTXHHVSR'LFKR GH RWUR PRGR HO SRGHU GH UHFRPSHQVD VLEOHTXHQL$QL%VHDQFRQVFLHQWHVGHOVHQWLGR
GH$VREUH%DXPHQWDDPHGLGDTXHDXPHQWDHO GHLGHQWL¿FDFLyQ(VWHWLSRGHSRGHUSXHGHLOXVWDPDxRGHORVEHQH¿FLRV(QLJXDOGDGGHFRQGL- WUDUVHHQHOFDVRGHODYHQHUDFLyQDXQKpURH
FLRQHVXQDUHFRPSHQVDPD\RUSURSRUFLRQDDOD
SHUVRQDTXHODRWRUJDPD\RUSRGHUVREUHHOEH- Poder carismático
QH¿FLDULRTXHVLODUHFRPSHQVDIXHUDPHQRU8Q (OSRGHUFDULVPiWLFRSXHGHGH¿QLUVHFRPRODLQVXSHUYLVRUTXHSRVHDFRQWUROVREUHORVDXPHQWRV ÀXHQFLDRHOSRGHUEDVDGRHQODSURSLDSHUVRQDGH VDODULR \ ERQL¿FDFLRQHV GHO VXERUGLQDGR QR OLGDG([LVWHQSHUVRQDVTXHSRVHHQXQDFXDOLGDG
VyOR REWLHQH HO SRGHU OHJtWLPR GH VX SRVLFLyQ PDJQpWLFD FDVL LQGH¿QLEOH HQ VX SHUVRQDOLGDG
VLQRTXHWDPELpQSRVHHSRGHUGHELGRDVXFDSD- TXH DWUDH D ORV GHPiV SDUD TXH ORV VLJDQ /DV
cidad de conceder o negar los mismos. Cuanto SHUVRQDOLGDGHVFDULVPiWLFDVWDQWRODVSRVLWLYDV
más grande sea el aumento de sueldo o la boni- FRPRODVQHJDWLYDVFRQVHUYDQDPHQXGRVXSR¿FDFLyQPD\RUVHUiHOSRGHUTXHWHQJDHOVXSHU- GHUGHLQÀXHQFLDLQFOXVRPXFKRGHVSXpVGHTXH
5 - Gestión de objetivos y poder en la organización / 133
la persona haya abandonado la empresa o haya
muerto. Este poder es potente y posee una enorPHLQÀXHQFLDHQODVRUJDQL]DFLRQHV/RVVHJXLdores de los líderes carismáticos siguen a éstos
GHELGRDODQDWXUDOH]DLUUHVLVWLEOH\FRQYLQFHQWH
del líder.
Poder experto
([LVWHQSHUVRQDVTXHSRVHHQSRGHUGHELGRDVXV
conocimientos o habilidades especiales. Son resSHWDGRVSRUHVWRVFRQRFLPLHQWRVRKDELOLGDGHV
con independencia de su posición en la empresa.
$TXpOORVTXHDGPLUDQVXFRQRFLPLHQWRWpFQLFR
R ORV TXH OR QHFHVLWDQ SDUD UHVROYHU SUREOHPDV
están dispuestos a subordinarse a él a cambio
GHODD\XGDTXHUHFLEHQGHOH[SHUWR3RUHMHPSORXQFLHQWt¿FRXQHVSHFLDOLVWDHQVLVWHPDVGH
LQIRUPDFLyQRXQWpFQLFRSXHGHQHMHUFHUSRGHU
más allá del asociado típicamente a su puesto
debido a sus conocimientos técnicos. Esta base
GHSRGHUHVLPSRUWDQWH\HV~QLFDSRUTXHHVLQGHSHQGLHQWH GH OD MHUDUTXtD RUJDQL]DWLYD /DV
SHUVRQDVTXHVHKDOODQHQORVQLYHOHVLQIHULRUHV
de la empresa pueden ejercer poder basado en
los conocimientos técnicos.
(QVXOLEUR0RUJDQDJUHJDODVTXHFRQVLGHUD
WtSLFDV HVWUDWHJLDV SDUD REWHQHU SRGHU VHDQ IHmeninas o masculinas:
Estrategias femeninas
‡/DUHLQD,VDEHOGRPLQDFRQPDQR¿UPHURdeándose cuanto es posible de hombres suPLVRVDOHVWLOR0DUJDUHW7KDWFKHU
‡La primera dama: se conforma con ejercer el
poder detrás del trono: una táctica adoptada
por muchas esposas corporativas así como
VHFUHWDULDVHMHFXWLYDV\D\XGDQWHVHVSHFLDOHV
‡ /D PXMHU LQYLVLEOH DGRSWD XQ SHU¿O EDMR \
SURFXUD PH]FODUVH FRQ ORV TXH QRV URGHDQ
HMHUFLHQGR LQÀXHQFLD GH FXDOTXLHU PDQHUD
TXHSXHGH
‡ Dalila: utiliza el poder de seducción para
FRQYHUWLU D ¿JXUDV FODYH HQ KRPEUHV GRPLnados.
‡Juana de Arco: utiliza el poder de modelar cauVDV\PLVLRQHVTXHWUDQVFLHQGHQHOKHFKRGH
VHUPXMHUREWHQLHQGRHODSR\RPDVFXOLQR
‡La hija: encuentra un padre típico dispuesto a
actuar con patrocinador y mentor.
‡(OUH\(QULTXH9,,,XWLOL]DXQSRGHUDEVROXWR
SDUDREWHQHUORTXHTXLHUHDWUD\HQGR\GHVcartando apoyos femeninos de acuerdo con
su utilidad.
‡El play boy: utiliza el sex appeal para ganar el
apoyo de las colegas femeninas.
Juegos de poder
/DPHMRUIRUPDGHYLVXDOL]DUHOVLVWHPDGHSROtWLFD
y poder de la organización es considerarlo como
XQDVHULHGHDFWLYLGDGHVXQFRQMXQWRGHjuegos
TXHWLHQHQOXJDUHQODFRDOLFLyQLQWHUQD±³FRPR
XQDVREUHSRVLFLyQLQWULQFDGDVXWLO\VLPXOWiQHD«
$OOLVRQ ±XQDHVSHFLHGHFLUFRFRQPXFKDV
SLVWDV´(VWRVMXHJRVSROtWLFRV³«QRVRQWDQLQdependientes unos de otros como pudiera parecer
DSULPHUDYLVWD6HJXtDQSRUGHWHUPLQDGDVUHJODV
DOJXQDVVRQH[SOtFLWDVRWUDVLPSOtFLWDV$OJXQDV
VRQEDVWDQWHFODUDVRWUDVFRQIXVDV$OJXQDVVRQ
muy estables; otras cambian con frecuencia. Pero
HOFRQMXQWRGHUHJODVGH¿QHHOMXHJR«´(QSULPHUOXJDUODVUHJODVHVWDEOHFHQODVSRVLFLRQHVOD
IRUPDHQTXHFDGDSHUVRQDDFFHGHDXQDSRVLFLyQ
HOSRGHUGHFDGDSRVLFLyQORVFDQDOHVGHDFFLyQ
(QVHJXQGROXJDUODVUHJODVUHVWULQJHQHOiPELWR
aceptable de decisiones y acciones. Algunos de
los principales juegos son:
‡ -XHJRV GH UHEHOGtD MXHJRV SDUD UHVLVWLU D OD
DXWRULGDG
‡-XHJRVGHDQWLUHEHOGtD MXHJRVSDUDFRQWUDUUHVWDUODUHVLVWHQFLDDODDXWRULGDG
‡-XHJRGHSDWURQD]JR FRQVXSHULRUHV
‡ -XHJR GH FRQVWUXFFLRQHV GH DOLDQ]DV HQWUH
LJXDOHV
‡ -XHJR GH FRQVWUXFFLyQ GH LPSHULRV FRQ VXERUGLQDGRV
‡-XHJRSUHVXSXHVWDULR FRQUHFXUVRV
‡-XHJRVGHKDELOLGDG FRQFRQRFLPLHQWR\KDELOLGDGHV
‡-XHJRGHPDQGR FRQODDXWRULGDG
‡ -XHJR GH ORV GLUHFWLYRV LQWHUPHGLRV versus
personal especializado
‡-XHJRHQWUHJUXSRVULYDOHV
‡Juego de los proyectos estratégicos
‡Juego del delator
‡Juego de los jóvenes rebeldes
Los llamados juegos de rebeldía es habiWXDOTXHVHXWLOLFHQHQSULPHUWpUPLQRSDUDUH‡(OSDGUHEXVFDDSR\DUDPXMHUHVMyYHQHVTXH VLVWLUVH D OD DXWRULGDG DXQTXH WDPELpQ SXHGHQ
VHUMXJDGRVSDUDUHVLVWLUVHDOSRGHUGHULYDGRGH
EXVFDQDVXYH]DXQPHQWRU
Estrategias masculinas
134 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
OD KDELOLGDG R GH OD LGHRORJtD \ WDPELpQ SDUD
DIHFWDUDOJ~QFDPELRTXHVHHVWpUHDOL]DQGRHQ
ODRUJDQL]DFLyQ(VWRVMXHJRVYDQGHVGHODOLJHra resistencia al poder legítimo y de la distorVLyQ GH REMHWLYRV DO YHUGDGHUR PRWtQ =DOG \
%HUJHU 1RUPDOPHQWHVHSUDFWLFDQHQOD
IDVHHMHFXWRULDGHODWRPDGHGHFLVLRQHVFXDQdo algún agente recibe la orden de implementar
XQDGHFLVLyQWRPDGDHQQLYHOHVVXSHULRUHVGHOD
MHUDUTXtD 6LHQGR OD GHFLVLyQ XQ FRPSURPLVR D
DFWXDU HQWUH HO FRPSURPLVR \ OD DFFLyQ H[LVWH
LQHYLWDEOHPHQWHODSRVLELOLGDGGHXQFRPSRUWDPLHQWR DUELWUDULR HV GHFLU QR H[LVWH OD FHUWH]D
DEVROXWDGHTXHODDFFLyQVHOOHYDUiDFDERDOSLH
GHODOHWUD(OHQFDUJDGRGHOOHYDUODDFDERSXHGHGLVWRUVLRQDUODSDUDDGHFXDUODDVXVREMHWLYRV
SHUVRQDOHV(QODVGHFLVLRQHVFRQODVTXHHVWiGH
DFXHUGRHODJHQWHSXHGH³VREUHSDVDUHOHVStULWX
GHODRUGHQ´SHURSDUDODVTXHQRIDYRUHFHQVXV
LQWHUHVHV SXHGH ³PDQLREUDU´ SDUD UHWUDVDU VX
UHDOL]DFLyQRLQFOXVR³GHVREHGHFHUDELHUWDPHQWHODRUGHQ´ $OOLVRQ (QHORWURH[WUHPRORVDJHQWHVTXHRVWHQWDQ
autoridad dentro de la organización intentan reaccionar ante los juegos de rebeldía. En la China
LPSHULDOVHVHJXtDQWUHVRSFLRQHVGLVWLQWDVD DXPHQWDUODVHYHULGDGGHORVFDVWLJRVSDUDORVFRPSRUWDPLHQWRVLUUHJXODUHVE DXPHQWDUODVSRVLELlidades de detectar y hacer pública la identidad
de los responsables de estos comportamientos
LUUHJXODUHVF PHMRUDUORVPHGLRVGHVXSHUYLVLyQ
\ FRQWURO 6WHUED (V GHFLU TXH SDUD VRlucionar la resistencia a la autoridad se imponía
PiVDXWRULGDG±DVtFRPROD,JOHVLDH[FRPXOJDR
TXHPD±UHIRU]DQGRHOFRQWUROVREUHORVVXERUGLnados. Pero en realidad los problemas se debían
a “un diseño incorrecto de la organización más
TXHDODGHELOLGDG\IDOLELOLGDGGHORVDJHQWHV´\
SRUORWDQWRODVROXFLyQLQWHQWDGDQRIXQFLRQDED
Pero la sola autoridad es a menudo inadecuada
SDUDFRQWUDUUHVWDUODUHVLVWHQFLDSROtWLFDGHPRGR
TXHODGLUHFFLyQGHEHFRPEDWLUIXHJRFRQIXHJR
utilizando conjuntamente sus habilidades polítiFDV SHUVXDGLHQGR KDODJDQGR \ QHJRFLDQGR FRQ
ORVRSHUDULRV(VPX\LQWHUHVDQWHODREVHUYDFLyQ
GH1HXVWDGWHQVXWUDEDMRVREUHODSUHVLGHQFLDGH
ORV((88VREUHODQHFHVLGDG±GHOSUHVLGHQWH±GH
H[WUDHU HO SRGHU HIHFWLYR GH ORV LQWHUHVHV GH ORV
demás agentes y de inmiscuirse en los detalles
SDUDHYLWDUVHUPDQLSXODGRSRUVXERUGLQDGRVPHMRULQIRUPDGRVDOPLVPRWLHPSRHOHMHFXWLYR HO
MHIH ³«GHEHHVWLPXODUODFRPSHWHQFLDHQWUHVXV
VXERUGLQDGRVSDUDVHUYLUVHGHHOORV«´0HQFLRQD HQ SDUWLFXODU D 5RRVYHOW GH TXLHQ FRPHQWD
1HXVWDGW “…mantenía concesiones incompletas de
DXWRULGDG MXULVGLFFLRQHV LQFLHUWDV SULYLOHJLRV
superpuestos. El resultado de esta teoría comSHWLWLYD GH OD RUJDQL]DFLyQ HUD IUHFXHQWHPHQWH
ODFRQIXVLyQ\ODH[DVSHUDFLyQSHURHQXQDJUDQ
EXURFUDFLDFRQPXFKRVDJHQWHVTXHTXLHUHQLQÀXLUHQODVGHFLVLRQHVQLQJ~QRWURPpWRGRSRGtD
JDUDQWL]DUWDQWRTXHHOSRGHUTXHGDVHHQPDQRV
GHOSUHVLGHQWH«´
6HPHQFLRQDWDPELpQHOFDVRGH-75DQGDOO
MHIHGHOODERUDWRULRGHItVLFDGHO.LQJ¶V&ROOHJH
HQORViPELWRGHDFFLyQGHODFLHQWt¿FDLQYLVLEOH GHO$'1 5RVDOLQG )UDQNOLQ 5DQGDOO HUD
DOJRDVtFRPRXQKpURHGHJXHUUD\DTXHVXLQYHQWRGHOPDJQHWUyQGHFDYLGDGKDEtDVLGRLQYDlorable para hundir submarinos alemanes. Randall era realmente bueno en hacer encajar una
DJORPHUDFLyQKHWHURJpQHDGHSHUVRQDVDWUDYpV
GHXQVLVWHPDGHEHFDV\VXEVLGLRVORTXHGLR
RULJHQDTXHHOODERUDWRULRIXHUDFRQRFLGRFRPR
el circo de Randall SHUR HUD PHQRV EXHQR HQ
indicar a esta gente sus responsabilidades. Solía
comunicarse con sus subalternos por medio de
QRWDVGHMDGDVHQSDSHOHVEODQFRVRURVDV\HUD
VHJ~QPXFKRVPDQLSXODGRUFRQXQDPSOLRPDQHMRSROtWLFRGHODVVLWXDFLRQHV\JXVWDEDHFKDU
a unos contra otros. Era casi un showmanFRQ
WUDMHVDPHULFDQRVKHFKRVDPHGLGDXQPRxRSRU
FRUEDWD\XQDÀRUIUHVFDHQVXRMDOFDGDGtDHUD
IDPRVRSRULPSRQHUXQDHVWULFWDGLVFLSOLQDSHUR
SHUPLWLyTXHODHQHPLVWDGGH:LONLQV\)UDQNOLQ
se enconara durante dos años sin dejar claro a
)UDQNOLQTXH:LONLQVHUDVXVXSHULRU
(OSURSLR:LONLQVFRPHQWDQGRGpFDGDVGHVpués la falta de comunicación de Randall sobre
HOHVWDWXVGH)UDQNOLQHQODXQLGDG\HOKHFKRGH
(QWUH SHUVRQDMHV PiV FRQRFLGRV SDUD QRVRWURV SXHGH FRQVXOWDUVH OD PDJQt¿FD REUD GH -RVHSK 3DJH VREUH HO
JHQHUDO3HUyQTXHKDFHDOXVLyQDHVWUDWHJLDVGHHVWHPDQGDWDULRGHPDQHMRGHSHUVRQDV\VLWXDFLRQHVDQiORJDVDODV
TXHVHFRPHQWDQHQUHODFLyQD5RRVYHOW 3HUyQXQDELRJUDItD$UJHQWLQD0RQGDGRUL &LWDGRSRU6D\UH$Rosalind Franklin and the DNA1HZ<RUN+DUSHU
5 - Gestión de objetivos y poder en la organización / 135
TXH GHVSXpV QR DIURQWDUD FRQ GHFLVLyQ VX FRQGXFWDOOHJyDSUHJXQWDUVHVHULDPHQWHVLHQ5DQGDOOQRKDEtDWHQLGRXQHQFRQDGRULYDOPX\ELHQ
disimulado.
A continuación mencionaremos una serie de
MXHJRVSROtWLFRVTXHVHSUDFWLFDQSDUDFRQVWUXLU
bases de poder. Los tres primeros utilizan para
KDFHUORDJHQWHVGHGLVWLQWRVQLYHOHV HQHOSULPHURORVVXSHULRUHVHQHOVHJXQGRORVDJHQWHVGHO
PLVPR UDQJR HQ HO WHUFHUR ORV VXERUGLQDGRV .DQWHUDUJXPHQWDTXHTXLHQHVGHVHDQDOJ~QSRder real en la organización deben practicar uno
GH HVWRV WUHV MXHJRV ³ORV DJHQWHV VLQ SDWURQHV
VLQ FRQH[LRQHV FRQ VXV FRPSDxHURV R TXH QR
cuentan con la colaboración de sus subordinados permanecen en una situación de dependenFLDEXURFUiWLFD«´ .DQWHU Los juegos de patronazgo son simples. El
agente se une a otro agente prometedor en el
seno de la organización –o a algún agente cuyo
poder ya está consolidado– y le profesa su lealWDG D FDPELR GH DOJ~Q IDYRU (V GHFLUTXH HO
patronazgo supone un contrato implícito: un
VHUYLFLRDFDPELRGHXQDFHVLyQGHSRGHU(OSDWUyQ QRUPDOPHQWH HV HO MHIH R¿FLDO GHO DJHQWH
DXQTXH QR WLHQH SRU TXp VHU VLHPSUH DVt DXQTXH VLHPSUH H[LVWH XQ JUDGR GH VXERUGLQDFLyQ
.DQWHU GHVFULEH D XQ YHQGHGRU TXH WHQtD XQ
patrón cuatro eslabones más arriba en la jerarTXtDHQODVRUJDQL]DFLRQHVSURIHVLRQDOHVFRPR
ODVXQLYHUVLGDGHVRORVKRVSLWDOHVXQSURIHVLRnal de alto estatus por lo general será el patrón
GHXQRPiVMRYHQ $VtHOSDWURQD]JRQRHVXQ
FRQWUDWRHQWUHLJXDOHVVLQRHQWUHXQDJHQWHFRQ
más poder y uno con menos. El primero obtiene
ODSDUWHGHOOHyQHQODUHSDUWLFLyQGHOSRGHUHO
VHJXQGRODVPLJDMDV TXHVLQHPEDUJRSXHGHQ
D~Q UHSUHVHQWDU XQ SRGHU VXVWDQFLDO (VWH MXHJR VH FRQFHSWXDOL]D D YHFHV FRPR XQ HVTXHPD
RSDWUyQRGLVSRVLWLYRduque-siervo y tiene una
FLHUWDFXDOLGDGTXHVHKDOODPDGRvampírica en
La meritocracia es
probablemente la
configuración básica
del poder más
identificable en el
hospital
H
El poder se conceptúa
como una fuerza
subyacente en cualquier
relación interpersonal
HOSPITAL
No es un atributo de los actores,
sino una relación de intercambio.
No se regala ni se cede.
Se conquista o se negocia.
Meritocracia federativa en
entornos estables y predecibles,
forma de trabajo
relativamente estable
DIRECCIÓN
Meritocracia colaboradora,
propia de entornos muy
inestables. Se acerca a la
concepción de adhocracia.
¿Qué es un buen hospital?
¿Qué es un buen servicio?
¿Para quién?
¿Quién lo valora?
JERARQUÍA
LA ORGANIZACIÓN SE DISEÑA PARA SERVIR
A SUS MIEMBROS, DE TAL SUERTE QUE EL
PODER FLUYE HACIA LOS EXPERTOS, HACIA
LOS POSEEDORES DE LOS CONOCIMIENTOS
Los objetivos de las meritocracias son objetivos ligados
a la misión, que es un término vago ya que es difícil
o imposible medir el resultado real de la asistencia sanitaria
coalición externa
poderosa
configuración del poder basada en
conocimientos y habilidades hace
diferentes a médicos y enfermeras,
médicos y otros profesionales
y entre los propios médicos
MERITOCRACIA FEDERATIVA
En las burocracias
profesionales.
Los especialistas
tienen gran poder.
reparto no igualitario
por lo que es
meritocracia
y no democracia
LA BUROCRACIA PROFESIONAL SE CREA COMO
UNA ORGANIZACIÓN PERO SUS PARES SE COMPORTAN
COMO SI FUERAN UNA FEDERACIÓN
Sirven a sus clientes con un alto grado
de autonomía y responsabilidad
el poder se basa en
la posesión de
conocimientos críticos
de la organización
Sus resultados
no se pueden
regular
Dependen poco de
la organización y
pueden cambiar con
facilidad de empresa
Poseen un
dominio
considerable
sobre su trabajo
Cuadro 5.6: Sumario esquemático del ejercicio del poder en el hospital
³«HOVLVWHPDHMHFXWLYRHQXQDHPSUHVDHVWiIRUPDGRGHFRPSOHMDVUHODFLRQHVSDWUyQSURWHJLGR«´0DUWLQ 6LPPV
136 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
HOVHQWLGRGHTXHHOduque-vampiro no reconoce
al siervo-víctima como un otro sino sólo como
un apéndice utilitario.
El juego de construcción de alianzasFRPR
ORGHVFULEH0LQW]EHUJHVMXJDGRSRUDFWRUHVHQ
XQQLYHODQiORJRGHMHUDUTXtDHLPSOLFDODFRQcertación de contratos implícitos para apoyarse
unos a otros. $Vt PDQGRV PHGLRV LQWHQWDUiQ
crear una red relacional con puestos estratégiFRVDQiORJRVEXVFDQGRDOLDGRVHQFRQGLFLRQHV
GHSURSRUFLRQDUOHVUHFXUVRVSRUHMHPSOR\Eisicamente información. La alianza crecerá hasta
TXHVHWHUPLQHQORVDJHQWHVGLVSXHVWRVDXQtUVHOHKDVWDTXHVHORJUHHOGRPLQLRRKDVWDTXHVH
WRSHFRQRWUDDOLDQ]DULYDO&RPRKDQREVHUYDGR
RWURVDXWRUHVDGHPiVHOFDQMHODQHJRFLDFLyQ
HOUHJDWHRHOFRQÀLFWR\WDPELpQHOFRPSURPLso son formas típicas de comportamiento entre
HMHFXWLYRV GHGLFDGRV D HODERUDU HVWD relación
lateral.
El juego de construcción de imperiosSRUVX
SDUWH HV VLPLODU DO DQWHULRU VyOR TXH VH OOHYD D
cabo con actores de menor rango dentro de la organización; es un intento de crear soberanías inGHSHQGLHQWHVFRQHVIHUDVGHLQÀXHQFLD$OLJXDO
TXHHQHOPXQGRDQLPDO\HQHOGHODVQDFLRQHV
WDPELpQHQHOFRQWH[WRRUJDQL]DFLRQDOODFRQVtrucción de imperios es una lucha por el territoULR TXH HQ HVWH FDVR HVWi IRUPDGR SRU SXHVWRV
\XQLGDGHV(IHFWLYDPHQWHQRVyORORVVXHOGRV
GH ORV GLUHFWLYRV HVWiQ EDVDGRV HQ OD FDQWLGDG
GHVXERUGLQDGRVTXHWLHQHQVLQRTXHWDPELpQOD
asignación de recursos depende de los puestos
TXHFRQWURODQ
El juego presupuestario es similar al de
FRQVWUXFFLyQ GH LPSHULRV VLHQGR VX REMHWLYR
EiVLFR REWHQHU PiV SRVLFLRQHV PiV HVSDFLR
PiVHTXLSRPiVUHFXUVRVGHFXDOTXLHUWLSR\
SXHVWRTXHHVWRVUHFXUVRVVHVLJQDQFRQSUHVXSXHVWRpVWHVHFRQYLHUWHHQHOSXQWRFHQWUDOGHO
juego. La táctica es conocida: debe conseguirse
ODPD\RUDVLJQDFLyQSRVLEOHVLHPSUHGHEHSHGLUVHSRUHQFLPDGHORQHFHVDULR\¿QDOPHQWH
KD\TXHDVHJXUDUVHGHTXHVHXVDKDVWDHO~OWLPRFHQWDYRGHORDVLJQDGR±DVtVHPDOJDVWH±\D
TXHORQRXVDGRVHUiUHWLUDGRGHOSUy[LPRSUHsupuesto.
El de la línea media versus la asesoría especializada FRQ¿JXUD XQ MXHJR GH SRGHU FOiVLFR
(QIUHQWD ODV GHFLVLRQHV GH OD OtQHD PHGLD TXH
WLHQH DXWRULGDG IRUPDO FRQWUD ORV HVSHFLDOLVWDV
GH OD WHFQRHVWUXFWXUD TXH WLHQHQ SRGHU JUDFLDV
a sus habilidades especiales. La autoridad de
HVWRV~OWLPRVHVSRUGH¿QLFLyQQRGLUHFWDHVGHFLUHOSHUVRQDOHVSHFLDOL]DGRQRGHEHLQIRUPDU
D ORV DQWHULRUHV VLQR D QLYHOHV PiV DOWRV GH OD
MHUDUTXtD3RUORWDQWRDPERVJUXSRVWLHQHQXQ
HVWDWXVSDUHFLGR SRGUtDPRVUHEDXWL]DUHVWHMXHgo como la rivalidad entre primos hermanos (VWiFODURTXHHOREMHWLYRGHOMXHJRHVFRQWURODU
ODV GHFLVLRQHV WUDWDQGR ORV GLUHFWLYRV GH UHWHner su capacidad de actuar discrecionalmente y
ORV HVSHFLDOLVWDV GH HOLPLQDU HVWD SUHUURJDWLYD
Esto pueden hacerlo los últimos de dos maneras: como consejeros pueden tratar de controlar
ODLQIRUPDFLyQTXHJXtDODVGHFLVLRQHVRFRPR
diseñadores pueden imponer normas burocráticas para limitar las posibilidades de los otros.
En un sentido es un enfrentamiento entre poder
formal e informal; unos tratan de mantener el
MXHJRHQXQQLYHOGHPDQGR\RWURVHQXQRGH
autoridad. Los asesores de la tecnoestructura se
PXHYHQDGHPiVFRQOLEHUWDGHQWUHORVQLYHOHV
PiVDOWRVGHODMHUDUTXtDGHTXLHQHVGHSHQGHQ
GLUHFWDPHQWH DSHODQGR D YHFHV D la estrategia
de la ropa sucia 0XPIRUG\3HWWLJUHZ SXHVFRPRSDUWHGHVXVLQYHVWLJDFLRQHVHQRWURV
GHSDUWDPHQWRVSXHGHQGHVFXEULULQH¿FLHQFLDVH
incompetencias de otros para utilizar luego este
FRQRFLPLHQWRHQFRQWUDGHVXVHYHQWXDOHVULYDOHV$GHPiVORVDQDOLVWDVTXHVHHQFXHQWUDQIXHUDGHODMHUDUTXtDSXHGHQDPHQXGRSUHVHQWDUVH
ante la dirección para conseguir el apoyo para
HOGHVDUUROORGHVXVSODQHVPLHQWUDVTXHODOtQHD
PHGLDHYHQWXDOPHQWHQRSXHGHQLVLTXLHUDSRQHUVHHQFRQWDFWRFRQORVTXHVHHQFXHQWUDQSRU
HQFLPDGHHOOD /LWWHUHU El juego de los proyectos estratégicos se basa
HQ XQ LQGLYLGXR R JUXSR GH LQGLYLGXRV SURPRYLHQGR VX SURSXHVWD R SUR\HFWR TXH VH PXHYH
GHVGHODFRDOLFLyQLQWHUQDDODH[WHUQDHQEXVFD
de apoyo.
Los juegos descritos no interactúan en forma
VLVWHPiWLFD VLQR TXH SXHGHQ FRH[LVWLU FRQ ORV
³«ORVGLUHFWLYRVLQWHUPHGLRVLQWHQWDQGHVDUUROODUXQDUHGGHUHODFLRQHVFRQRWURVSXHVWRVHVWUDWpJLFRVURGHiQGRVH
GHDOLDGRVTXHHVWpQHQFRQGLFLRQHVGHSURSRUFLRQDUOHVUHFXUVRVGHGLYHUVRWLSR«FRQODD\XGDGHHVWRVDOLDGRV
SRGUiQH[SDQGLUVXLQÀXHQFLD\YHQFHUODVOLPLWDFLRQHVHVWUXFWXUDOHVGHVXIXQFLyQ«´ ,]UDHOL 6D\OHV/FLWDGRHQODELEOLRJUDItD
5 - Gestión de objetivos y poder en la organización / 137
FUNCIONES DEL
JEFE DE UNA UNIDAD
ORGANIZACIONAL
INTERPERSONAL
DECISIONAL
El más empresarial
INFORMACIONAL
FIGURA DESTACADA
Símbolo de la unidad
Funciones legales, sociales
y ceremoniales
LÍDER
Motivar a atraer
y retener
Alienta, reprende,
sanciona,
estimula
MONITOR
PORTAVOZ
Sensa
(Transmite
información
del entorno (FODA, información fuera
de su unidad)
oportunidades,
amenazas)
DIFUSOR
Info hacia
dentro de su
organización
o unidad
POLÍTICA
ENLACE
Relaciones fuera de
su área o sector
Enlaza a la organización
con el entorno
Crea red de
contactos
CONTROLADOR
DE DISTURBIOS
NEGOCIADOR
EMPRESARIAL
ENTREPRENEUR
EMPRENDEDOR
Búsqueda de nuevos
proyectos para su unidad
expansión de su unidad
ASIGNADOR DE
RECURSOS
Cuadro 5.7: Funciones clásicas del director (tomado de Mintzberg)
VLVWHPDVOHJtWLPRVGHLQÀXHQFLDSXHGHQVHUDQWDJRQLVWDVGHORVVLVWHPDVOHJtWLPRVGHLQÀXHQcia o pueden incluso sustituir a los sistemas legíWLPRVGHLQÀXHQFLDSRUODGHELOLGDGGHpVWRV
En otra parte de esta obra hemos comentado
TXHODOODPDGDPHULWRFUDFLDHVODFRQ¿JXUDFLyQ
GHSRGHUWtSLFDGHOKRVSLWDOVLHQGRFDUDFWHUtVWLFD
en organizaciones con un sistema técnico comSOHMR 0HQFLRQDPRV \D SHUR UHSHWLUHPRV SDUD
FRQWH[WXDOL]DUDFiTXHKD\GRVIRUPDVEiVLFDV
GHPHULWRFUDFLDODVIHGHUDWLYDV–entorno estable
\IiFLOGHSUHGHFLUORVH[SHUWRVSXHGHQDSOLFDU
de forma directa procesos estandarizados a las
necesidades de los clientes y trabajar en forma
UHODWLYDPHQWH DXWyQRPD HQ HO Q~FOHR RSHUDWLYR–\ODVFRODERUDWLYDV–las necesidades no pueGHQ¿MDUVHGHDQWHPDQR\HQFRQVHFXHQFLDORV
H[SHUWRVGHEHQGHGLFDUHVIXHU]RV\KDELOLGDGHV
para solucionar cada caso. La burocracia profeVLRQDOHVXQDPHULWRFUDFLDGHWLSRIHGHUDWLYR\D
TXHORVH[SHUWRVVRQFRQWUDWDGRVSRUODRUJDQL]DFLyQDODTXHFRQVLGHUDQHQHOIRQGRXQDDUHQD
FRQYHQLHQWHHQODTXHSXHGHQSUDFWLFDUVXSURIHVLyQ/RVH[SHUWRVWLHQHQFRQWUROFRQVLGHUDEOH
VREUHVXSURSLRWUDEDMR\DTXHpVWHHVGHPDVLDdo complejo como para poder ser controlado por
ORV GLUHFWLYRV R SRU ORV DQDOLVWDV WDPSRFR ORV
UHVXOWDGRVVHSXHGHQUHJXODUSRUTXHQRVHWUDWD
GHREMHWLYRVRSHUDWLYRV3RUWRGDVHVWDVUD]RQHV
en las meritocracias el sistema de autoridad tienGHDVHUUHODWLYDPHQWHGpELO(OSRGHUGLVWULEXLdo en base a la habilidad puede recordarnos en
FLHUWDPDQHUDDXQDGHPRFUDFLDSHURHQUHDOLdad la palabra meritocracia es más adecuada ya
TXHORTXHYHUGDGHUDPHQWHLPSRUWDHVHOWLSRGH
KDELOLGDGTXHVHSRVHHVLHQGRTXHHVHSRGHUQR
VHGLVWULEX\HHQIRUPDHTXLWDWLYDVLQRGHPRGR
desigual en base a las habilidades y conocimientos críticos para la organización. En las meritoFUDFLDVODGLVWULEXFLyQGHVLJXDOGHSRGHUSXHGH
HQFRQWUDUVHHQXQDYDULHGDGGHQLYHOHVGHELGR
D TXH GLVWLQWRV WLSRV GH H[SHUWRV WLHQHQ GLVWLQWRV QLYHOHV GH KDELOLGDG GHVDUUROOiQGRVH HQWUH
HOORV MHUDUTXtDV FRPR VXFHGH HQWUH GRFWRUHV \
HQIHUPHUDVRLQFOXVRHQWUHORVFLUXMDQRV\RWURV
PpGLFRV$TXHOORVTXHQRWLHQHQQLQJXQDKDELOLGDGHVSHFLDOFRPRSRUHMHPSORORVHPSOHDGRV
QRHVSHFLDOL]DGRVVHHQFXHQWUDQHQORVQLYHOHV
138 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
GDGGHFDPELDUOR1RHQWRGRVORVSDtVHVH[LVWH
XQGLUHFWRUPpGLFRHVWRHVXQUHVSRQVDEOHPi[Lmo de la acción médica en el hospital. En donde
VtH[LVWHHVXQSURIHVLRQDOTXHKDGHMDGRODDFWLYLGDGDVLVWHQFLDO\VHGHGLFDDODJHVWLyQ PXFKDV
YHFHV VLQ QLQJXQD FDSDFLGDG R IRUPDFLyQ SDUD
ella 6XSRVLFLyQHVHQPXFKDVRFDVLRQHVODGH
Poder en el hospital
XQVDQGZLFKTXHGHEHFRQFLOLDUODVSRVLFLRQHVGH
ORVPpGLFRVFRQODVGHODHVIHUDSROtWLFDTXHORFR6HKDGLFKRTXHHOKRVSLWDOHVXQDRUJDQL]DFLyQ ORFyHQHOFDUJRGHPRGRTXHWUDLFLRQDVXRULJHQ
RXQPRQVWUXR GHPXFKDVFDEH]DVPiVGHODV si es mero transmisor de las políticas o traiciona
TXHVHSXHGHQHQFRQWUDUHQLQVWLWXFLRQHVTXHSD- D TXLHQ OR XELFy VL VH DOLQHD D XOWUDQ]D FRQ ORV
UHFHQ VLPLODUHV FRPR XQLYHUVLGDGHV HVFXHODV pedidos de los médicos.
HVWXGLRV HWF 6L ELHQ HO REMHWLYR princeps de
XQDHPSUHVDFOiVLFDPHUFDQWLOFRQ¿QGHOXFUR
Las funciones básicas del director o más ames obtener renta y repartirla entre los accionis- SOLDPHQWHGHOMHIHGHFXDOTXLHUXQLGDGRUJDQL]DWDV HV LPSRVLEOH GH VLWXDU FRQ SUHFLVLyQ HO GH WLYDSXHGHQVHJ~Q0LQW]EHUJUHVXPLUVHHQODV
XQ KRVSLWDO FRPR KHPRV \D FRPHQWDGR /RV siguientes:
REMHWLYRV GHO KRVSLWDO SDUHFHQ WHUPLQDU VLHQGR
ORVGHVXVDJHQWHVFRQLQÀXHQFLDRSRGHU\FDGD Roles interpersonales
XQRGL¿HUHGHORWUR/DVXPDGHORVREMHWLYRVGH ‡ ¿JXUHKHDG±¿JXUDGHVWDFDGDFDEH]DYLVLEOH
ORVJUXSRVSRGHURVRVSXHGHVHUFXDOTXLHUFRVD ‡ ODFDEH]DGHODXQLGDG
DXQTXHHQJHQHUDOWHQGHUiDVHUFHUR\DTXHORV ‡ HOVtPEROR±HOGLUHFWRUes el hospital
REMHWLYRV FRQWUDSXHVWRV FRPR VXPDV YHFWRULD‡ FXPSOHFRQDFWLYLGDGHVOHJDOHVRVRFLDOHVGH
OHVWLHQGHQDDQXODUVHHQWUHVt1RREVWDQWHSRU
naturaleza ceremonial
segmentos cortos puede predominar uno u otro.
/tGHU leader
¿Cuáles son los actores poderosos
‡ PRWLYDGLULJHFDSDFLWD DFiVHWUDVODSDFRQ
en el ámbito del hospital?
el de resource allocator
‡ GH¿QHHOFOLPDRUJDQL]DFLRQDO
El propietario: (Q XQ KRVSLWDO SULYDGR VLQ ‡ LPSULPHVXVHOORDOVHUYLFLRXQLGDGHWF
GXGDHOGXHxRGHWHQWDHOSRGHUSHURDXQDVtYD‡ WDPELpQFDVWLJDUHSUHQGHVDQFLRQDHVWLPXODSUHPLDHVGHFLU
len muchos –si no todos– de los juegos descritos
‡ HMHUFHODDXWRULGDG\HOSRGHU«
con anterioridad.
LQIHULRUHVGHODMHUDUTXtDVLQQLQJ~QVHQWLPLHQto de participación y son tratados como simples
instrumentos. Incluso entre profesionales se dan
GLIHUHQWHV QLYHOHV MHUiUTXLFRV FRPR ORV PpGLFRVGHFRQVXOWRULRVH[WHUQRV\ORVGHVDODRORV
GHiUHDVFUtWLFDV Enlace
El consejo de administración: Presente en
‡ «PDQWLHQH FRQWDFWRV IXHUD GH VX FDGHQD
especial en hospitales de comunidad o de muWXDOLGDGFDEDOJDHQWUHODVOODPDGDVSRU0LQW]HUJ
YHUWLFDOGHPDQGR
FRDOLFLRQHV LQWHUQD ORV HPSOHDGRV GH SODQWLOOD
GHQWURGHODQyPLQDGHOKRVSLWDO \H[WHUQD DJHQ- Roles informacionales
WHV FRQ LQÀXHQFLD FRPR DFFLRQLVWDV R SURYHH‡ PRQLWRU
dores presentes por fuera de la estructura formal
‡ SRUWDYR]
GHOKRVSLWDO 3XHGHFRQFHUWDUGLIHUHQWHVWLSRVGH ‡ GLIXVRU
pactos FRQ DPEDV FRDOLFLRQHV \ VHU GRPLQDGD
GRPLQDQWHRSDVLYD
Roles decisionales
‡ HPSUHQGHGRU
El Director: La base de la autoridad y poder
‡ FRQWURODGRU GH SHUWXUEDFLRQHV disturbance
GHOGLUHFWRUVHSRQHGUDPiWLFDPHQWHHQHYLGHQFLD
handler «DYHFHVVyORGHMDKDFHU«
DOFRQVLGHUDUORVFRQÀLFWRVTXHGHVDWDODQHFHVL‡ PDQWLHQHXQDWHQVLyQySWLPD
&RPRGLFHHODIRULVPR\GDGRTXHPXFKRVGLUHFWRUHVSURYLHQHQGHODexpertiseTXLU~UJLFD³«OORUDHOKRVSLWDO
SRUXQEXHQFLUXMDQROORUDHOKRVSLWDOSRUXQPDOGLUHFWRU«´
5 - Gestión de objetivos y poder en la organización / 139
Los jefes de servicio: $SDUHFH HVWD ¿JX‡ VyORLQWHUYLHQHFXDQGRODVDQJUHOOHJDRHVWi
UD HQ VX Pi[LPR HVSOHQGRU HQ )UDQFLD FRQ ORV
por llegar al río
tradicionales y todopoderosos chiefs de service
‡ DVLJQDGRUGHUHFXUVRV resource allocator
Pi[LPR SRGHU GHQWUR GH OD HVSHFLDOLGDG 6XH‡ QHJRFLDGRU negociator
len acceder a su cargo por su carrera y calidad
La función del director está plagada FLHQWt¿FRWpFQLFD\DVLVWHQFLDO\HQPXFKRPHGH OR TXH VH KDQ GHQRPLQDGR GHVLQFHQWL- nor grado –si alguno– por su capacidad organiYRV SDUD OD HILFLHQFLD ±R LQFHQWLYRV SDUD OD ]DWLYD\GHDGPLQLVWUDFLyQHQODTXHVXHOHQVHU
ineficiencia. En primer lugar está al frente mediocres. Debería ser una autoridad holística
GH XQD LQVWLWXFLyQ OODPDGD D OD LQPRUWDOLGDG HQ VX VHUYLFLR SHUR D PHQXGR VyOR OR HV HQ OD
TXH QR SRGUtD TXHEUDU R IXQGLUVH FRQG~]FDOD IDVHFLHQWt¿FD/DDXWRULGDGFUHFLHQWHGHODHQpOFRPRODFRQGX]FDDXQTXHVtSXHGHQFHUUDUVH fermería también ha limitado la autoridad de los
KRVSLWDOHV SRU FXHVWLRQHV SROtWLFDV QR KD\ DF- MHIHV 8QD JUDQ GHELOLGDG TXH SRVHHQ HV VX LQFLRQHVTXHFRWLFHQHQEROVD\VXGHVWLQRQRHVWi GLYLGXDOLVPR PXFKDV YHFHV HVWiQ HQIUHQWDGRV
DWDGRDORVEHQH¿FLRVRUHQWDTXHFRQVLJD6HOH entre sí constituyendo reinos o feudos (véase en
paga de modo desproporcionadamente bajo en otra parte de esta obra) TXH DXWRH[SDQVLRQDQ
UHODFLyQDODVIXQFLRQHVTXHGHEHUtDFXPSOLU\D VLHQGRGLItFLODJUXSDUORVHQSRVGHORVREMHWLYRV
ODVUHVSRQVDELOLGDGHVTXHWLHQHFRQORTXHVHOR JHQHUDOHVGHODRUJDQL]DFLyQVHDQpVWRVFXDOHV
condena también a él al pluriempleo; se le da un IXHUHQ R VH PLGDQ FRPR VH TXLHUD (O síndroHTXLSR KXPDQR LQVX¿FLHQWH ±TXHUUtD PiV± \ D PHGHODWRUUHGHFULVWDORGHPDU¿OJUD¿FDHVWD
ODYH]LQH¿FLHQWH±TXHUUtDPHQRV±WHQLHQGRHQ WHQGHQFLD DO DLVODFLRQLVPR \ DXWRVX¿FLHQFLD D
GH¿QLWLYDTXHKDFHUORTXHSXHGHFRQORTXHWLH- YHFHVLQFOXVLYHSUHVXSXHVWDULD TXHWLHQHQHVWRV
QHPiVDOOiGHTXHODLQVWLWXFLyQTXHSUHVLGHHV MHIHVGDQGROXJDUDORTXHDSURSLDGDPHQWHVHKD
LQPRUWDOpOPLVPRHVPX\IUiJLO\QRSUHFLVD- llamado serviciocentrismo.
mente por su grado de desempeño funcional sino
Los médicos: &RPR HV REYLR VLQ HOORV QR
SRUORVFRQÀLFWRVSROtWLFRPHGLiWLFRVTXHSXHGD
alcanzar su administración; no controla –por KDEUtDPHGLFLQD6RQRSHUDULRVFDOL¿FDGRVDOWDFRPSOHWRDOPHQRV±QLHOSHUVRQDO UHFXpUGHVH PHQWHFDOL¿FDGRVPXFKDVYHFHVWLHQHQXQDSRPiVGHOGHORVUHFXUVRVSUHVXSXHVWDULRVGHO VLFLyQ DPELYDOHQWH FXDVL HVTXL]RIUpQLFD HQWUH
KRVSLWDO QLORVLQVXPRVPiVLPSRUWDQWHV FX\D VXVHQWLGRGHFODVH\VXOXFKDODERUDOSDWHQWHHQ
FRPSUDVXHOHFHQWUDOL]DUVH VLDGPLQLVWUDELHQ especial a la hora de dirimir negociaciones coHO 0LQLVWHULR OH TXLWDUi SDUWLGDV HQ HO SUy[LPR OHFWLYDVHQODVTXHKDQGXGDGRHQWUHKDFHUIUHQSHUtRGR SDUD WUDQVIHULU D DOJ~Q KRVSLWDO TXH te común con el resto del personal del hospital o
bien librar su propia guerra.
agotó las suyas.
Como mínimo la dirección puede ejercerse
La enfermería: 6LHQGR XQD YHUGDGHUD SURDWUDYpVGHXQDVHULHGHWpFQLFDVQRHOHJLEOHVD
YROXQWDGVLQRLQWHUGHSHQGLHQWHVTXHKDQSDVDGR fesión por derecho propio y no meramente un
DVHUIXHQWHUHODWLYDGHDWHQFLyQDSDUWLUGHTXH DX[LOLDU WLHQH LPSRUWDQWHV YHQWDMDV D VX IDYRU
ésta se desplazó de las cuestiones económicas. XQDPD\RUFRKHVLyQ\HVStULWXGHFXHUSRTXHORV
/DVWpFQLFDVGHHMHUFLFLRGHODIXQFLyQGLUHFWLYD PpGLFRVKRUDVGHSHUPDQHQFLDHQHOKRVSLVRQ SRU PRWLYDFLyQ SRU GHOHJDFLyQ ±GH¿QLGR WDOPXFKRPiVWUDWRtQWLPRFRQHOHQIHUPR(O
por la cesión o depósito de tareas y misiones a SRGHUtR GH OD HQIHUPHUD TXHGD UHÀHMDGR HQ OD
DOJXLHQPiV±SRUREMHWLYRV±EDVDGRHQODLGHD imagen de la matronLQJOHVDTXHEDMR7KDWFKHU
de posibilitar una precisa medición de la con- HQHO5HLQR8QLGROOHJyDWHQHUHOPi[LPRSRWULEXFLyQ UHODWLYD GH ORV GLIHUHQWHV HOHPHQWRV GHUGHHVWHWLSRTXHVHYLRHQ(XURSD
SDUD OD FRQVHFXFLyQ GH REMHWLYRV HVWDEOHFLGRV
Las asociaciones y los sindicatos: Los em\ SRU WDQWR OR TXH FDGD VHFFLyQ \ KDVWD FDGD
SURIHVLRQDOKDDSRUWDGR±SRULQWHUYHQFLyQSRU SOHDGRVTXHFRQVWLWX\HQODPD\RUtDGHORVDJHQUHVXOWDGRVSRUVLVWHPDV\DOJXQDVRWUDVPHQRV WHV LQWHUQRV FRQ LQÀXHQFLD D PHQXGR GHFLGHQ
ejercerla desde fuera de los límites de la orgaestudiadas.
6HJ~Q0DUWtQ\0DUWtQ:RUNVKRS%XHQRV$LUHV8&(6
140 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
QL]DFLyQ ODOODPDGDFRDOLFLyQH[WHUQD /RVVLQGLFDWRV TXHVXHOHQUHSUHVHQWDUDORVHPSOHDGRV
PHQRVFXDOL¿FDGRV \ODVDVRFLDFLRQHVSURIHVLRQDOHV TXHUHSUHVHQWDQDORVHPSOHDGRVPiVSUH-
SDUDGRV \ DO SHUVRQDO H[SHUWR GH ODV RUJDQL]DFLRQHV SHUPLWHQDORVWUDEDMDGRUHVDFWXDUFRPR
FROHFWLYRHVWRHVFRQVHJXLUTXHVXSHVRFRPR
grupo tenga peso en la organización.
6
VARIABLES CLAVE EN LA ADMINISTRACIÓN
DE LOS SISTEMAS DE SERVICIOS Y DE LAS
ORGANIZACIONES DE ATENCIÓN DE LA SALUD
/D236 FLQFRWHFODV FRQVLGHUDYDULDEOHVHVHQciales en la administración a:
‡+DFHQLPSDFWRVREUH
- los resultados de salud
- el desarrollo económico
‡3XHGHQVHUVHQVLEOHVDOFLFORHPSUHVDULDO\DO
desarrollo económico a largo plazo.
‡/D)LQDQFLDFLyQ
‡/RV0HFDQLVPRVGHSDJR
‡/D2UJDQL]DFLyQ
¢3RU TXp QRV LQWHUHVD FyPR VH XWLOL]DQ ORV
‡/D5HJXODFLyQ
‡/D&RPXQLFDFLyQVRFLDO TXHLQÀX\HVREUHOD PHFDQLVPRVGH¿QDQFLDFLyQ"3RUTXH
‡7LHQHQUHSHUFXVLyQVREUH
FRQGXFWDSHUVRQDO
- la posibilidad de control político
- la rendición de cuentas política
- la aceptación social
LA FINANCIACIÓN
- la posibilidad de implementar
ORVUHTXHULPLHQWRVDGPLQLVWUDWLYRV
6RQRSFLRQHVSDUDOD¿QDQFLDFLyQGHODDWHQFLyQ
ODIDFWLELOLGDG¿QDQFLHUD\SROtWLFD
de salud:
‡Pagos del paciente (honorarios al usuario)
‡Ingresos impositivos generales
‡Seguridad Social (Impuestos al salario)
‡Seguro privado
‡Cuentas de ahorros para gastos médicos
‡Financiación comunitaria
La mayoría de los países utilizan una combinación de opciones.
¢3RUTXpQRVLQWHUHVDTXpPHFDQLVPRVGH¿QDQFLDFLyQVHXWLOL]DQ"3RUTXH
‡7LHQHQUHSHUFXVLyQVREUHODFDSDFLGDGGHOVLVtema de atención de salud de:
- reunir fondos
EULQGDUSURWHFFLyQFRQWUDORVULHVJRV¿nancieros
‡,QÀX\HQVREUH
ORVFRVWRVWRWDOHV\DGPLQLVWUDWLYRVGHO
sistema
ODGLVWULEXFLyQGHODFDUJD¿QDQFLHUD
&RQFOXVLRQHV DFHUFD GH ORV PHFDQLVPRV ¿nancieros:
‡1RH[LVWHXQVLVWHPD¿QDQFLHURSHUIHFWR
‡7RGRHOGLQHURSDUDODDWHQFLyQGHVDOXGSURYLHQHHQ~OWLPDLQVWDQFLDGHORVFLXGDGDQRV
‡ (O GHVDUUROOR HFRQyPLFR GHWHUPLQD FXiQWR
puede costear una sociedad.
‡1RKD\PHFDQLVPR¿QDQFLHURTXHSXHGDUHVROYHUHOSUREOHPDGHODSREUH]D
ASPECTOS ACTUALES DEL FINANCIAMIENTO
DE LOS SISTEMAS DE SALUD
El escenario de los cambios
en la financiación
$SDUWLUGHPHGLDGRVGHODGpFDGDGHOVHKDDVLVWLGRDXQLPSRUWDQWHGHVDUUROORHQOD¿QDQFLDFLyQGH
ORVVLVWHPDV\VHUYLFLRVGHVDOXGHQWRGRHOPXQGR
142 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
En la 41ª Asamblea Mundial de la Salud
VHUHFRQRFLyHOHQRUPHFUHFLPLHQWRGHO
JDVWR HQ VDOXG HVSHFLDOPHQWH HQ DWHQFLyQ VHcundaria.
Muchos países en desarrollo comenzaron a
OOHYDUDFDERSURJUDPDVGHDMXVWHHVWUXFWXUDOFRQ
gran realismo e independientes de su origen o su
YLQFXODFLyQ SROtWLFRLGHROyJLFD 6H GHVDUUROODURQ LPSRUWDQWHV SURFHVRV GH GHVFHQWUDOL]DFLyQ
HQOXJDUGHIXHUWHVVLVWHPDVGHFRQWURO\¿QDQFLDFLyQ FHQWUDO \ ORV PHFDQLVPRV QR JXEHUQDPHQWDOHVVHFRQYLUWLHURQHQLPSRUWDQWHVLQVWUXmentos de cambio de política.
1LYHOHVFUHFLHQWHVGHHGXFDFLyQPHMRUDVHQ
ODVFRPXQLFDFLRQHVRSWLPL]DFLyQGHOWUDQVSRUWH MXQWR D XQ PD\RU SOXUDOLVPR SROtWLFR \ XQ
PD\RU pQIDVLV HQ HO LQGLYLGXR KDQ SURGXFLGR
FRPR UHVXOWDGR FDPELRV HQ ODV SROtWLFDV HQ OD
RUJDQL]DFLyQ HQ OD JHVWLyQ \ HQ ORV VHUYLFLRV
GLVSRQLEOHVHQWRGRVORVVHFWRUHV\HQJHQHUDO
HVSUREDEOHTXHHVWRVFDPELRVKD\DQDXPHQWDdo las demandas sobre los sistemas de atención
integral de salud.
Si bien han obtenido resultados consideraEOHVHQWpUPLQRVGHDYDQFHVHQODVDOXGORVSURgramas gubernamentales pueden hallarse sujetos a la ley de los rendimientos decrecientes. Los
JRELHUQRVKDQWHQLGRTXHEXVFDUQXHYDVIRUPDV
GH ¿QDQFLDU OD DWHQFLyQ \ PHMRUDU OD H¿FLHQFLD
HQ IXQFLyQ GHO FRVWR FRQ XQ SDUDOHOR GHELOLWDPLHQWRGHODRSRVLFLyQS~EOLFRSULYDGR
3HUR HVWDV QXHYDV IRUPDV GH ¿QDQFLDFLyQ
han tenido un rápido limite; la imperfección del
mercadoREOLJDDODLQWHUYHQFLyQGHORVJRELHUQRVD¿QGHPHMRUDUODH¿FLHQFLDODFDOLGDGOD
VROLGDULGDG\IXQGDPHQWDOPHQWHODHTXLGDG/DV
imperfecciones del mercado más comunes en el
sector salud se deben a uno o más de los siguientes fenómenos:
‡DWHQFLyQFXUDWLYDFDGDGtDPiVFRPSOHMD
‡WHFQRORJtDVLQDSURSLDGDV
‡SRFRpQIDVLVHQODSUHYHQFLyQ
‡DWHQFLyQSULPDULDGHVDOXG
‡EXURFUDFLD
‡WUDQVSDUHQFLD
‡LPSDFWRGHORVSURJUDPDV
/RVFDPELRVHQOD¿QDQFLDFLyQHQORV~OWLmos años han incidido en la relación entre los
tres actores; las organizaciones intermedias de
¿QDQFLDFLyQ REUDV VRFLDOHV SUHSDJDV HWF han logrado reducir la incertidumbre frente a
ODV SpUGLGDV ¿QDQFLHUDV GHELGDV D OD HQIHUPHGDGSHUPLWLpQGROHDOVXEVHFWRUS~EOLFRIDFLOLGDGHVHQVXEVLGLDUSURSRUFLRQDURJDUDQWL]DUOD
atención.
3HURKR\H[LVWHXQFUHFLHQWHLQWHUpVHQsepaUDUDOSURYHHGRU\ODVIXQFLRQHVGH¿QDQFLDFLyQ
D¿QGHSURPRYHUODFRPSHWHQFLD6HIXHDYDQzando en un enfoque integralGHOD¿QDQFLDFLyQ
TXHWRPDHQFXHQWDDWRGDVODVSDUWHVDIHFWDGDV\
DODHYDOXDFLyQ¿QDOGHORVUHVXOWDGRV
‡QLYHOGH¿QDQFLDFLyQGHO3%,\VXEVLGLRV
indirectos
‡HTXLGDGIXHUWHVGLIHUHQFLDOHVVHJ~Q1%,LQgresos y geografía
‡H¿FLHQFLDWpFQLFD FRVWREHQH¿FLR \GLVWULEXWLYD GLVWULEXFLyQ \ IDOWD GH HFRQRPtD GH
HVFDODHQREUDVVRFLDOHV\SULYDGRV
‡YLDELOLGDGUHFKD]RDORVFDPELRVRIDOWDGH
sostenibilidad
‡LPSDFWRVREUHODVDOXGFRQRFLPLHQWRLPSHUfecto de los consumidores acerca de cantidad
y calidad
Cambios en las fuentes de financiación
Financiación pública:VHUHÀHMDXQFDPELRPiV
SOXUDOLVWD \ PL[WR SDUD ORV VLVWHPDV GH VDOXG
HOSDSHOGHOD¿QDQFLDFLyQGHOJRELHUQRVHHVWi
KDFLHQGR PiV UHDFWLYR \ PHQRV SURJUDPiWLFR
WUDQVIRUPDFLyQ GHO PRGHOR GH ¿QDQFLDPLHQWR
desde uno de integración pública a otro de contrato público.
Financiación privada: en la mayoría de los
FDVRVORVSDtVHVKDQDGRSWDGRHVWUDWHJLDVGHSULRazones adicionales serían la pobreza y la ne- YDWL]DFLyQOLPLWDGDV1RVHVDEHD~QFRQFHUWH]D
FHVLGDGGHSURSRUFLRQDUELHQHVRVHUYLFLRVFX\R VLODVSULYDWL]DFLRQHVHQHOPXQGRDXPHQWDURQOD
YDORU VRFLDO VXSHUH HO YDORU TXH ORV LQGLYLGXRV H¿FLHQFLDSXHVHQORVHVWXGLRVQRHVWiFODURFXiO
puedan atribuirles. Pero también hay imperfec- HVODXQLGDGGHSURGXFFLyQRWLSRGHVHUYLFLRRVX
FLRQHVHQODLQWHUYHQFLyQGHORVJRELHUQRV
FDOLGDG\VLORVEHQH¿FLDULRVVRQVHPHMDQWHV
‡ IDOWD GH LQFHQWLYRV SDUD VXPLQLVWUDU bienes
públicos
‡ GHVDWHQFLyQ GH ODV externalidades o bienes
meritorios
‡ DXVHQFLD GH FRQVXPLGRUHV ELHQ LQIRUPDGRV
free rider - comportamiento sin restriccioQHV
6 - Variables clave en la administración de los sistemas de servicios y de las organizaciones... / 143
Financiación por la seguridad social: la tenGHQFLDIXHWRPDUXQDFREHUWXUDSULYDGDDGLFLRQDO6HOHKDFULWLFDGRORVFRVWRVDGPLQLVWUDWLYRV
GXSOLFDFLyQ\VXSHUSRVLFLyQHLQHTXLGDGUXUDO
Financiación externa: aplicación de recurVRVDLQVWDODFLRQHVXUEDQDVGHDOWDFRPSOHMLGDG
como hospitales y clínicas especializadas y no
en atención primaria.
/RVFDPELRVTXHKR\DIHFWDQDORVGLIHUHQWHV
DFWRUHVGHOD¿QDQFLDFLyQVRQGHYDULRVWLSRV
‡(QODDSHUWXUDGHOPHUFDGRGHDWHQFLyQGHOD
VDOXGTXHDIHFWDQHQSDUWLFXODUDOJUDGRGH
competencia
‡ (Q OD GLVSRQLELOLGDG GH LQIRUPDFLyQ TXH
también afectan al ejercicio de las opciones
en el mercado
‡(QORVSDSHOHVJHUHQFLDOHV\HQHOSDWUyQGH
prestación de cuentas
‡(QODRUJDQL]DFLyQLQWHUQD\H[SUHVLyQGHORV
propios actores
‡(QHODPELHQWHUHJXODGRU
7RGRVHVWRVFDPELRVSRUORVSRFRVDxRVGH
LQWURGXFFLyQ KDQ VLGR REMHWR GH UHODWLYDPHQWH
SRFRDQiOLVLVFUtWLFRVDXQTXHVHGHVFULEHQEHQH¿FLRVLPSRUWDQWHVFRPRODPD\RUSDUWLFLSDFLyQ
ORFDODXPHQWRGHODHTXLGDG\GHODH¿FLHQFLD
Papel del estado en los cambios en el
financiamiento en los sistemas de salud
El cambio en el papel del gobierno es uno de los
DVSHFWRVPiVHYLGHQWHVGHORVFDPELRVJHQHUDOHV TXH KDQ WHQLGR OXJDU VREUH OD ¿QDQFLDFLyQ
+DUHGXFLGRHQJHQHUDOVXSDSHOFRPR¿QDQFLDGRU SHUR SURSRUFLRQDQGR IRQGRV VXVWDQFLDOHV
en la priorización de los bienes públicos y en
ODVSHUVRQDVPiVYXOQHUDEOHVDXQFRQWUDWDQGRD
WHUFHURVSDUDODSURYLVLyQGHVHUYLFLRV+DFRQWLnuado ocupando un papel central en términos de
UHJXODFLyQLQFOXLGDVODIRUPXODFLyQGHODSROtWLFD\ODSURYLVLyQGHLQIRUPDFLyQ
Ha seguido siendo el principal actor en el
PHUFDGRGHODVDOXG\HO~QLFRDJHQWHTXHSXHGH
HVWDEOHFHUVXEVLGLRVLPSXHVWRVRGLVSRVLFLRQHV
legales regulatorias.
Papel de los gobiernos en la coordinación y
regulación. Grupo de estudio de la OMS, 1993
FRQ LQGHSHQGHQFLD GH ORV FDPELRV HQ OD ¿QDQFLDFLyQ GH VLVWHPDV \ VHUYLFLRV VLJXH VLHQGR
responsable de establecer prioridades e instruPHQWRV SDUD DOFDQ]DU ORV REMHWLYRV VXVWDQWLYRV
nacionales.
/RVFDPELRVTXHVHHVWiQHIHFWXDQGRUHTXLHren de una posición gubernamental más fuerte
FRPRDJHQWHUHJXODGRUVHDDWUDYpVGHOFRQWURO
GHSUHFLRVGHODJDUDQWtDGHFDOLGDG\HOFRQWURO
GHODFDQWLGDG\ODGLVWULEXFLyQORTXHVXSRQHXQ
mayor fortalecimiento. El estado debe optimi]DUHODFFHVRDODLQIRUPDFLyQ\DTXHHOFRQRFLPLHQWRGHOFRPSRUWDPLHQWRGHORVSURYHHGRUHV
SULYDGRV\ORVIDFWRUHVTXHORULJHQHVQHFHVDULR
para diseñar e implantar un sistema de regulaFLyQH¿FLHQWH
(QVtQWHVLVVHSXHGHGHFLUTXHKDQRFXUULGR
FDPELRVHVSHFWDFXODUHVHQOD¿QDQFLDFLyQHQORV
VLVWHPDV GH VDOXG HQ FDVL WRGR HO PXQGR SURGXFLHQGRDVXYH]WUDQVIRUPDFLRQHVHQORVUROHV
GHORVGLVWLQWRVDJHQWHVTXHDFW~DQHQHOVLVWHPD
de atención de salud o sumándose a otros camELRV WDO FRPR OD GHVFHQWUDOL]DFLyQ TXH WLHQHQ
una razón fundamental propia y complementan
ORVTXHHVWiQHQPDUFKDHQOD¿QDQFLDFLyQGHOD
atención de la salud.
(QUHDOLGDGQRH[LVWHQRSFLRQHVVLPSOHVHQWUH ORV SRVLEOHV FDPELRV HQ OD ¿QDQFLDFLyQ GH
la salud; las transformaciones pueden complementarse mutuamente o pueden tener un efecto
QHJDWLYRODVXQDVVREUHODVRWUDV3RUHOORGHEHQ
VHULQFUHPHQWDOHVSURJUHVLYDV\SRWHQFLDOPHQWH
UHYHUVLEOHV ORV VLVWHPDV GH VDOXG VRQ SOXUDOLVWDV\PL[WRVFRH[LVWHFLHUWRQ~PHURGHIXHQWHV
GLIHUHQWHVGH¿QDQFLDFLyQPHFDQLVPRVGHSDJR
\FRPSUDGRUHV\SURYHHGRUHV(OUHWRTXHDIURQtan los gobiernos es el de cómo administrar y coRUGLQDUHVWDVGLYHUVDVHVWUXFWXUDVD¿QGHORJUDU
armonía en el sistema en su conjunto.
Muchos países en desarrollo están hoy deFLGLHQGRFyPRUHJXODU\RGHVUHJXODUORVVHFWRUHV SDUDHVWDWDO \ SULYDGR ±TXH \D VRQ H[WHQVRV
\TXHHVWiQD~QFUHFLHQGRFRQUDSLGH]±\FyPR
transformar el sector público. Pero en todos los
FDVRV XQ HOHPHQWR DO SDUHFHU HVHQFLDO HQ HVWD
GHFLVLyQGHELHUDVHUHOGHWHUPLQDUHQTXpOXJDU
GHO VLVWHPD GH DWHQFLyQ GH VDOXG VRQ PiV YXOQHUDEOHVORVFRQVXPLGRUHVHVGHFLUSRQHUDORV
EHQH¿FLDULRVHQHOFHQWURGHORVFDPELRV
El papel del gobierno en la coordinación y regu- Mecanismos de pago al proveedor
ODFLyQSUREDEOHPHQWHVHDYLWDOSDUDHOp[LWRGHO ([LVWHQ GRV VHULHV DPSOLDV GH SURYHHGRUHV GH
sector de la atención de salud en su conjunto; atención de salud:
144 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
‡3URYHHGRUHVLQVWLWXFLRQDOHV
- hospitales
- clínicas
‡3URYHHGRUHVLQGLYLGXDOHV
- médicos
RGRQWyORJRVHQIHUPHURVDVLVWHQWHVVRFLDOHVHWF
- otros trabajadores de salud
,GHDFODYHobtiene lo que paga
¢3RUTXpVRQLPSRUWDQWHVORV033"
‡/RV033LQÀX\HQ
- las decisiones clínicas y la calidad de la
atención
ODH¿FLHQFLDGHODSUHVWDFLyQGHOVHUYLFLR
- los costos de atención de salud
- la elección de la especialidad y la ubicaFLyQJHRJUi¿FD
- la distribución del ingreso
/DFRQGXFWDGHOSURYHHGRUDIHFWDHOGHVHPpeño.
/RV033SXHGHQSURGXFLULQFHQWLYRVSDUDHO
cambio:
‡FDQWLGDGGHVHUYLFLRVEULQGDGRV
‡FDQWLGDGGHSDFLHQWHVDWHQGLGRV
‡GXUDFLyQGHODHVWDGtD
‡FDOLGDGFOtQLFDGHODDWHQFLyQ
‡FDOLGDGGHOVHUYLFLRGHDWHQFLyQ
‡GHULYDUSDFLHQWHV
‡DWHQGHUSDFLHQWHVPiVVDQRV
Cambios en los mecanismos de pago
Se consolidaron siete métodos puros: pago diUHFWRSDJRSRUHOFDVRFDUJRGLDULRWDVD~QLFD
FDSLWDFLyQ VXHOGR R SUHVXSXHVWRV JOREDOHV 6H
GH¿QLyXQDVHULHFRPSOHMDGHLQFHQWLYRVHQXQD
relación triádica; las opciones disponibles han
SHUPDQHFLGRUHODWLYDPHQWHHVWDEOHVHQOD~OWLPD
GpFDGDH[FHSWR
MECANISMO
Presupuesto
Capacitación
Día
&DVR(SLVRGLR
+RQRUDULRGHVHUYLFLR
Salario
Ejemplo: Presupuesto
‡3DJRVSRUFDVRHQORVOODPDGRVgrupos relacionados de diagnóstico; consecuencia DGR
creep
‡3DJRVSRUFDVRHQODVOODPDGDVescala de valor relativo basado en los recursos. El pago
SRUXQVHUYLFLRHVWiFRQFHELGRGHIRUPDTXH
UHÀHMH HO YDORU GH ORV UHFXUVRV UHTXHULGRV
SDUDSURGXFLUHOVHUYLFLR
‡0DQDJHGFDUH; consecuencia médico guardaYDOODV
Los presupuestos globales son especialmente
utilizados para el pago en los hospitales y a los
SURIHVLRQDOHVVHWUDWDGHHYLWDUXQFRVWRWRWDOVRbredimensionado por sus consecuencias sobre la
FDOLGDG\ODH¿FLHQFLDGLVWULEXWLYDHQWDQWRsin
H¿FLHQFLDQRSXHGHKDEHUHTXLGDG
‡5LHVJR¿QDQFLHURGHULYDGRGHOJUDQXVR
SURYHHGRU KRVSLWDO
‡,QFHQWLYRV
- Gastar cada partida del presupuesto íntegro
1RKD\LQFHQWLYRVSDUDGDUOHUHVSXHVWDV
a los clientes.
1R KD\ LQFHQWLYRV SDUD EULQGDU EXHQD
calidad de atención.
‡&RQVHFXHQFLDV
- certidumbre presupuestaria
- potencialmente bueno para la contención de costos
HVFDVDH¿FLHQFLD
- escasa satisfacción del paciente
- posiblemente mala calidad
- no hay selección de riesgo de paciente
‡(QVHxDQ]DVLQWHUQDFLRQDOHV
- Los médicos pueden inducir a la demanda.
/DVFRQGXFWDVFOtQLFDVGHORVSURYHHGRUHVVHYHQLQÀXHQFLDGDVHQIRUPDVLJQL¿FDWLYDSRUORVLQFHQWLYRV\SRUHOULHVJR
HOSPITALES
-
Tabla 6.1: Mecanismos alternativos de pago. ¿Dónde se aplican?
MÉDICOS
6 - Variables clave en la administración de los sistemas de servicios y de las organizaciones... / 145
/RVKRQRUDULRVSRUVHUYLFLRVVRQLQÀDcionarios en términos de costos.
‡1RH[LVWHVLVWHPDGHSDJRVSHUIHFWR
Desde el surgimiento de la economía de la
VDOXGFRQODSXEOLFDFLyQGHODUWtFXORGH$UURZ
VREUH OD LQFHUWLGXPEUH \ HO DQiOLVLV GHO
ELHQHVWDUGHODVSUHVWDFLRQHVPpGLFDVVHDEULyOD
discusión sobre el carácter diferente de la atención en salud frente a los demás bienes. Luego
de estudiar las características de la demanda de
VHUYLFLRVGHVDOXGVHWUDWyGHLGHQWL¿FDUODFDQWLGDGGHVHUYLFLRVPpGLFRVTXHODVSHUVRQDVHVWiQ
GLVSXHVWDV D FRPSUDU \ D SDJDU \ VH GHPRVWUy
TXHHVDGHPDQGDHVGHFDUiFWHUH[yJHQRSXHV
muchas de las decisiones relacionadas con la
cantidad y el tipo de consumo son tomadas por
HO PpGLFR \ QR SRU HO SDFLHQWH DGHPiV FXDQGRVHQHFHVLWDDWHQFLyQPpGLFDODVUHVWULFFLRQHV
HFRQyPLFDV GH SUHFLRV ULTXH]D \ UHQWD QR VRQ
XQDEDUUHUDWDQHIHFWLYDFRPRHQHOFRQVXPRGH
otros bienes.
El problema surge por la asimetría de inforPDFLyQ HQWUH HO PpGLFR \ HO SDFLHQWH VREUH HO
estado de salud de este último y la mejor manera
GHPHMRUDUOR6HFRQVLGHUDTXHHVWDDVLPHWUtDR
ignorancia del consumidor es una de las princiSDOHV IDOODV GHO PHUFDGR GH VHUYLFLRV GH VDOXG
'HELGRDHOODHOSDFLHQWHVXHOHGHOHJDUHQHOPpdico las decisiones de consumo y la utilización
GHUHFXUVRV\HOPpGLFRVHFRQYLHUWHHQDJHQte del paciente. Si la relación de agencia fuese
FRPSOHWDHOPpGLFRDFWXDUtDWHQLHQGRHQFXHQWD
~QLFDPHQWHHOLQWHUpVGHOSDFLHQWH3HURFRPR
FRQVHFXHQFLDGHOSDSHOGXDOGHOPpGLFRTXHDFW~D FRPR RIHUHQWH \ GHPDQGDQWH HVWD UHODFLyQ
suele ser imperfecta. El médico puede actuar en
interés del paciente pero también en su propio
LQWHUpV LQFHQWLYDQGR HO FRQVXPR GH DWHQFLyQ
SDUDPD[LPL]DUVXLQJUHVRPLQLPL]DUHOULHVJR
GHGHPDQGDVDXPHQWDUVXSUHVWLJLRHWF
3RUVXVLPSRUWDQWHVLPSOLFDFLRQHV¿QDQFLHUDVHVWDFDUDFWHUtVWLFDGHODUHODFLyQPpGLFRSDFLHQWHHQODTXHODRIHUWDLQGXFHODGHPDQGDQR
se puede dejar de lado en el análisis de la enfermedad renal crónica. La demanda inducida coUUHVSRQGHDODSDUWHTXHVROLFLWDHOPpGLFR\TXH
HO SDFLHQWH QR KDEUtD DFHSWDGR VL WXYLHVH LJXDO
LQIRUPDFLyQ$XQTXHVHDUJXPHQWDTXHODpWLFD
SURIHVLRQDO LPSRQH IUHQRV ORV HVWLORV GH SUiFWLFDPpGLFDíWDQGLIHUHQWHVVHJ~QHOVLVWHPDGH
UHPXQHUDFLyQGHORVPpGLFRVíUHVWDQSHVRDHVWH
argumento. Hay un intenso debate teórico sobre
la inducción a la demanda por sus implicaciones
\VXLPSRUWDQFLDHQODSROtWLFDS~EOLFDH[LVWHQ
QXPHURVRV HVWXGLRV HQ IDYRU \ HQ FRQWUD TXH
enfrentan problemas metodológicos para contrastar empíricamente las funciones de utilidad
GH ORV PpGLFRV \ GH ORV SDFLHQWHV 8QR GH ORV
primeros estudios sobre inducción a la demanda
IXHUHDOL]DGRSRU0LOWRQ5RHPHUHQHQpO
PRVWUyTXHHQiUHDVGRQGHORVKRVSLWDOHVWHQtDQ
XQDPD\RURIHUWDGHFDPDVVHFRQVXPtDQPiV
VHUYLFLRVKRVSLWDODULRVHVWHKDOOD]JRGLRRULJHQ
DORTXHKR\VHFRQRFHFRPRODLey de Roemer:
XQDFDPDFRQVWUXLGDVLJQL¿FDXQDFDPDRFXpada. Posteriormente se desarrollaron modelos
PiVVR¿VWLFDGRVSDUDHOHVWXGLRGHODLQGXFFLyQ
a la demanda; entre los estudios clásicos está el
GH(YDQV TXHHQFRQWUyXQDFRUUHODFLyQ
SRVLWLYDHQWUHWDULIDVPpGLFDV\WDVDGHPpGLFRV
por habitante en algunas regiones de Canadá; el
GH )XFKV TXH HQFRQWUy TXH XQ DXPHQWR GHO HQ HO Q~PHUR GH FLUXMDQRV OOHYDED
D XQ LQFUHPHQWR GHO HQ ODV RSHUDFLRQHV HQ
DOJXQDV ]RQDV JHRJUi¿FDV GH (VWDGRV 8QLGRV
luego de relacionar la oferta de cirujanos con
ODGHPDQGDGHRSHUDFLRQHVHQWUH\
0iV DGHODQWH 5LFH \ /DEHOOH HQFRQWUDURQTXHEDMRFRQGLFLRQHVGHFRQWUROGHSUHFLRV
\KRQRUDULRVODVWDVDVGHXWLOL]DFLyQGHVHUYLFLRV
de salud tienden a aumentar junto con la canWLGDG GH PpGLFRV (VWRV HVWXGLRV VXJLHUHQ TXH
DGLIHUHQFLDGHORVELHQHVQRUPDOHVHODXPHQWR
de la oferta de cirujanos no baja el precio sino
TXHDXPHQWDHOQ~PHURGHRSHUDFLRQHV 6WLJOLW]
0F*XLUH SUHVHQWD XQD UHYLVLyQ
JHQHUDOGHODWHRUtDGHODGHPDQGDLQGXFLGDTXH
H[SOLFDFyPRODRIHUWDGHVHUYLFLRVGHVDOXGHQ
OXJDU GH EDMDU ORV SUHFLRV LQGXFH D XQ PD\RU
consumo.
Organización
6LELHQHVWHWHPDVHUiWUDWDGRHQH[WHQVRHQRWUR
FDStWXORLQWURGXFLUHPRVDTXtXQDVtQWHVLVGHVXV
implicancias para la administración.
‡2UJDQL]DFLyQPDFUR
¢4XLpQKDFHTXpHQHOVLVWHPDGHSUHVtación?
- ¿Cómo se organiza éste?
‡2UJDQL]DFLyQPLFUR
¢&yPRVHRUJDQL]DQLQWHUQDPHQWHDTXHllas instituciones?
146 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
Temas macro-organizacionales:
‡6LVWHPDVGHSUHVWDFLyQFHQWUDOL]DGRVvs. Descentralizados
‡,QWHJUDFLyQYHUWLFDOvs. Integración horizontal
GHORVVHUYLFLRV
‡3URYHHGRUHVS~EOLFRVvs.3URYHHGRUHVSULYDGRV
‡0RQRSROLRvs. Competencia
‡5HJODPHQWDFLyQvs./RVLQFHQWLYRV
Temas micro-organizacionales:
‡¢4XpWLSRGHSURYHHGRUHVS~EOLFRV"
8QLGDGHVSUHVXSXHVWDULDV
- Autónomas
- Corporatizadas
‡2UJDQL]DFLyQLQWHUQDGHODVLQVWLWXFLRQHV
LQFHQWLYRV
- rendición de cuentas
LQFHQWLYRV \ FRQWURO VREUH HO SHUVRQDO
GLUHFWLYR
PRWLYDFLyQKDELOLGDGHVUHFXUVRV\SRder de decisión de la dirección
LQFHQWLYRV GHVWUH]DV \ PRWLYDFLyQ GHO
personal
Reglamentación
6XLQÀXHQFLDHVFODYHHQODDGPLQLVWUDFLyQ$VXPH
‡(VWDEOHFHUFRQGLFLRQHVSDUDORVPHUFDGRV
‡0HUFDGRLPSHUIHFWR
- ignorancia del cliente
- monopolio
HIHFWRVH[WHUQRV
‡0HUFDGRFRUUHFWR
HTXLGDG
YDORUHVFRPXQLWDULRV
7HPDVUHJODPHQWDULRV
‡¢TXpKDFHODUHJODPHQWDFLyQ"
‡¢TXpVHUHJODPHQWD"
‡¢TXpLQIRUPDFLyQVHUHFRJH"
‡¢TXpVDQFLRQHVVHLPSRQHQ"
,GHDFODYH³(VGLItFLOLPSRQHUFRQGXFWDVVL
QRKD\XQFXPSOLPLHQWRYROXQWDULRDPSOLR´
¢&yPR JDUDQWL]DU TXH OD UHJODPHQWDFLyQ VH
cumpla?
/RV RUJDQLVPRV TXH KDFHQ HO WUDEDMR SUHFLsan una dirección interna sólida y rendición de
FXHQWDVH[WHUQD
/DFDSDFLGDGWpFQLFDGHODPRWLYDFLyQGHORV
LQFHQWLYRVDOSHUVRQDOHVFODYH
Los sistemas funcionan mejor cuando se perciEHTXHORVREMHWLYRV\ORVPpWRGRVVRQOHJtWLPRV
Comunicación Social
6XLPSRUWDQFLDSDUDODDGPLQLVWUDFLyQUDGLFDHQTXH
‡,QÀX\HVREUHODVFRQGXFWDVSHUVRQDOHV
- Qué:
Promoción de salud
8VRGHORVVHUYLFLRV
- Cómo:
Información
Persuasión
,QFHQWLYRV
Reglamentos
,GHDFODYH³1RHVventa sino responder a los
GHVHRV\DODVQHFHVLGDGHVGHORVEHQH¿FLDULRV´
La OPS recomienda usar las teclas: desde el
diagnóstico a la elaboración de opciones.
‡Ir de los problemas a las teclas
‡Para cada problema pregunte ¢SRUTXp" cinco veces
‡,GHQWL¿TXHODVFDXVDVVXE\DFHQWHVGHORVSURblemas
‡Vincule las causas de los problemas con las
soluciones posibles
‡Pregunte: ¿qué tecla de control del sector saOXGSRGUtDHQFDUDUFDGDFDXVD"
‡ Evalúe la factibilidad de las soluciones posibles:
- Política
- Económica
- Social
- Administrativa
7
GESTIÓN CLÍNICA:
UNA NUEVA FORMA DE ENTENDER LA GESTIÓN SANITARIA
Mario González González
Gerente. Hospital Universitario Central de Asturias. Servicio de Salud del Principado de Asturias
Juan Ortiz Fuente
Subdirector gerente. Hospital Universitario Central de Asturias. Servicio de Salud del Principado de Asturias
INTRODUCCIÓN
diferentes componentes y diferentes circunstancias
TXHKDQFRODERUDGRDTXHODVHVWUDWHJLDVVDQLWDULDV
/D UHDOLGDG HQ OD PD\RU SDUWH GH ORV VLVWHPDV YD\DQFRQÀX\HQGRHQHOUHGLPHQVLRQDPLHQWRGHO
VDQLWDULRVVHFDUDFWHUL]DHQODDFWXDOLGDGSRUOD papel de gestores y profesionales sanitarios y la neH[LVWHQFLD GH GLIHUHQWHV SUREOHPDV TXH UHTXLH- FHVLGDGGHEXVFDUOtQHDVGHDFWXDFLyQFRQYHUJHQWHV
ren soluciones; el crecimiento constante del gas- TXHSHUPLWDQXQDPHMRUDHQUHVXOWDGRVHFRQyPLWRVDQLWDULRODFDOLGDGGHODDWHQFLyQVDQLWDULD FRV\SRUVXSXHVWRDVLVWHQFLDOHV
ODVHJXULGDGGHORVSDFLHQWHVHOIHQyPHQRGHOD
JOREDOL]DFLyQDOTXHQRHVDMHQDODUHDOLGDGVDQLWDULDODVGHPDQGDVFUHFLHQWHVGHXQDSREODFLyQ LA GESTIÓN COMPARTIDA ENTRE PROFESIONALES
FDGDYH]PiVLQIRUPDGDODVQXHYDVWHFQRORJtDV SANITARIOS Y GESTORES
\ORVFDPELRVHQODVRFLHGDGWDQWRDQLYHOGHPRJUi¿FR FRPR HVWUXFWXUDO KDFHQ TXH VHD XQ 9LYLPRV VLQ GXGD XQD QXHYD UHDOLGDG TXH QRV
GHEHUGHVGHODJHVWLyQODE~VTXHGDGHDOWHUQDWL- REOLJDDGDUQXHYDVVROXFLRQHVDYLHMRVSUREOHYDVH¿FDFHVTXHSHUPLWDQGDUUHVSXHVWDDODSUR- mas; tradicionalmente la organización de los
EOHPiWLFDTXHVHQRVSUHVHQWD
VHUYLFLRV VDQLWDULRV KD YLYLGR GH HVSDOGDV D OD
&RQ HVWD SUREOHPiWLFD SODQWHDGD KDEODU GH VRFLHGDG \ D VXV UHTXHULPLHQWRV DGRSWDQGR HO
JHVWLyQ FOtQLFD VLJQL¿FD KDEODU GH XQD UHDOLGDG VLVWHPD VDQLWDULR XQ SDSHO QR DFRUGH D ODV H[TXHVHHVWiUHYHODQGRDWUDYpVGHVXDSOLFDFLyQ SHFWDWLYDV TXH VH JHQHUDEDQ IUXWR TXL]iV GH
HQ GLIHUHQWHV VLVWHPDV VDQLWDULRV FRPR HO JUDQ XQD VLWXDFLyQ GH SUHSRQGHUDQFLD HQ YLUWXG GHO
GLQDPL]DGRU\WUDQVIRUPDGRUTXHHVWiSRVLELOL- FRQRFLPLHQWRTXHHVWDEOHFtDXQDVHSDUDFLyQFODtando la mejora de la atención sanitaria y la ne- UDHQWUHSDFLHQWH\SURIHVLRQDOFRQXQRVFODURV
FHVDULD LPSOLFDFLyQ DFWLYD GH ORV SURIHVLRQDOHV componentes paternalistas.
GH OD VDQLGDG HQ ORV SUREOHPDV GH JHVWLyQ OR
6LQ HPEDUJR OD QXHYD UHDOLGDG H[LVWHQWH HQ
TXH UHVXOWD GH OD PD\RU WUDVFHQGHQFLD GDGR HO este milenio ha cambiado de modo radical las
LPSRUWDQWHSDSHOTXHMXHJDQHQHOSURFHVRGHOD FRVDV QXHVWUD VRFLHGDG IXQGDPHQWDOPHQWH D
DWHQFLyQVDQLWDULDHQVXGREOHIDFHWDSXUDPHQWH WUDYpV GH OD LQIRUPDFLyQ KD SXHVWR DO SDFLHQWH
DVLVWHQFLDO\ODGHULYDGDGHODWUDVFHQGHQFLDHFR- FRPR HMH LQGLVFXWLEOH GH QXHVWUR VLVWHPD FRPR
QyPLFDTXHJHQHUDQVXVDFWRV
pieza alrededor de la cual nuestro sistema debe
5HVXOWD LQWHUHVDQWH DQDOL]DU ODV UD]RQHV TXH JLUDU EXVFDQGR VROXFLRQHV \ GDQGR DOWHUQDWLYDV
KDQFRQGXFLGRDTXHODVSDODEUDVTXHKDQVXVFLWD- D ORV SUREOHPDV TXH QRV YD\D SODQWHDQGR /RV
do mayor grado de consenso en materia de gestión FLXGDGDQRVKDQGHMDGRGHVHUVXMHWRVSDVLYRVHQ
sanitaria sean las de gestión clínica. ¿Es esto fruto XQDUHODFLyQSDWHUQDOLVWDHQYtDVGHH[WLQFLyQHO
GHO D]DU R GH XQD QXHYD FR\XQWXUD HFRQyPLFD \ QXHYRSDFLHQWHH[LJHLQIRUPDFLyQFDSDFLGDGGH
VRFLDO"/DUHVSXHVWDQRHVVHQFLOOD\TXL]iVH[LVWDQ HOHFFLyQ FDOLGDG \ XQD DWHQFLyQ TXH VDWLVIDJD
148 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
WRGDVVXVH[SHFWDWLYDVFDGDYH]PiVFUHFLHQWHV
Esto debe contrapesarse con el papel fundamental
TXHWLHQHQORVSURIHVLRQDOHVVDQLWDULRVHQHOSURceso de atención médica. Representan la cara del
VLVWHPDFXHQWDQFRQWRGRHOSRGHUGHGHFLVLyQ\
DGHPiV FXHQWDQ FRQ HO FRQRFLPLHQWR TXH GHEH
asistir su toma de decisiones. Nos encontramos
por tanto en una situación de una gran compleMLGDG HQ OD TXH WUDWDPRV GH HQFRQWUDU HO GLItFLO
HTXLOLEULR LQHVWDEOH HQWUH SDFLHQWHV PpGLFRV \
gestores.
$QWH HVWH SDQRUDPD FRPSOHMR TXH VH QRV
SODQWHDQRVHQFRQWUDPRVFRQTXHODVLWXDFLyQ
hasta el momento se caracterizaba por una conYLYHQFLD HQWUH PpGLFRV \ JHVWRUHV HQ OD TXH
todos se daban la espalda. Es clásico el desHQFXHQWURHQWUHPpGLFRV\JHVWRUHVSRUYDULDV
razones:
‡+DH[LVWLGRWUDGLFLRQDOPHQWHXQDDXVHQFLDGH
sensibilización hacia el uso de recursos saniWDULRV\VXLPSRUWDQFLDDVSHFWRHQHOTXHQR
VHKDKHFKRQLQJ~QHVIXHU]RDQLYHOIRUPDWLYRGHORVSURIHVLRQDOHVHQQLQJXQDGHVXV
YHUWLHQWHVSUH\SRVJUDGXDFLyQ
‡7DPSRFRKDH[LVWLGRXQOHQJXDMHFRP~QTXH
VLUYLHUD GH FRPXQLFDFLyQ HQ HVWH DVSHFWR
TXL]iV OD LPSODQWDFLyQ GH VROXFLRQHV TXH
SHUPLWHQ PHGLU HO SURGXFWR KRVSLWDODULR
FRPRHOFDVRGHORV*5'KDFRQWULEXLGRDO
acercamiento de lenguajes.
‡3RURWURODGRKDKDELGR\HQSDUWHD~QSHUGXUDXQDIDOWDGHUHFRQRFLPLHQWRGHORVYDORUHV
de gestión.
1RGHEHPRVROYLGDUTXHDOPLVPRWLHPSR
OD FUHGLELOLGDG \ HYDOXDFLyQ GH ORV JRELHUQRV
dependen en gran medida de su capacidad para
dar respuesta y satisfacer las demandas de la
SREODFLyQ KHFKR GLItFLOPHQWH FRPSDWLEOH FRQ
la tendencia creciente del gasto sanitario en
WRGR HO PXQGR /D VROXFLyQ SDVD SRU QXHYDV
IyUPXODVGHRUJDQL]DFLyQODQHFHVLGDGGHUHLQYHQWDUODVUHVSRQVDELOLGDGHV\ODVUHFRPSHQVDV
GHODJHVWLyQ\SRUGDUXQDSDUWLFLSDFLyQDFWLYD
DODVRFLHGDGWRGRHOORHQXQPDUFRTXHQHFHsariamente debe tener como ejes principales de
VXHVWUXFWXUDODWUDQVSDUHQFLDODÀH[LELOLGDGOD
pWLFDODFDOLGDG\ODRULHQWDFLyQDUHVXOWDGRV\
todo ello dentro de un marco de disminución
GH OD YDULDELOLGDG PHUFHG DO XVR FUHFLHQWH GH
KHUUDPLHQWDVEDVDGDVHQODHYLGHQFLDFLHQWt¿FD
y en la información.
Gestión clínica y libertad clínica
<HVTXHODUHDOLGDGGHPXHVWUDTXHODVGHFLVLRQHV
PpGLFDV QR WHQtDQ HQ FXHQWD HQ PRGR DOJXQR
ORVYDORUHVTXHUHJtDQODSUiFWLFDGHORVJHVWRUHV
FRPRH[SUHVD:KLWHGHXQDIRUPDFUXGDORVPpdicos tienen un importante papel en el uso de reFXUVRVHQORVFDPELRVGHWHQGHQFLDGHGHPDQGD
VDQLWDULD\VRQH[WUHPDGDPHQWHYXOQHUDEOHVDQWH
la irrupción creciente de la tecnología; al mismo
tiempo juegan un papel importante en la selecFLyQ GH SHUVRQDO DQWHSRQLpQGRVH HQ RFDVLRQHV
los intereses personales a los institucionales.
(O ULHVJR GH HVWD VHSDUDFLyQ GH YLVLRQHV HQtre los gestores y los profesionales se traduce en
XQULHVJRGHFRUWHHQODFDGHQDGHDXWRULGDGTXH
H[LVWHHQORVFHQWURVVDQLWDULRV\DTXHQRKD\TXH
ROYLGDUODWUHPHQGDHVSHFL¿FLGDG\WUDVFHQGHQFLD
GHODVGHFLVLRQHVFOtQLFDVQRVyORHQVXHVWULFWR
ámbito asistencial sino en la esfera económica.
En este marco es donde los gestores deben
LQWHQWDU DGDSWDUVH EXVFDQGR LQWHJUDU GHQWUR GH
ODV DFWXDFLRQHV PpGLFDV ORV FRQFHSWRV GH UHVSRQVDELOLGDG VRFLDO PiV TXH LQGLYLGXDO HQ OD
DVLJQDFLyQGHUHFXUVRVODQHFHVLGDGGHHVWDEOHFHUODLQIRUPDFLyQ\ODHYLGHQFLDFRPRXQPHFDQLVPRGHPHMRUDGHODFDOLGDGGHORVVHUYLFLRV
DSUHVWDU\ODQHFHVLGDGGHTXHORVSURIHVLRQDOHV
sanitarios acepten la responsabilidad de su gesWLyQDWRGRVORVQLYHOHV
&RPRD¿UPD:KLWH³H[LVWHXQDJUDQGLVFRUGDQFLDHQWUHODSODQL¿FDFLyQGHJHVWLyQ\¿QDQFLHUD\ODSUiFWLFDFOtQLFD$PEDVVRQOHJtWLPDV
SHUR D YHFHV SDUHFHQ LQFRPSDWLEOHV´ (VWR VH
MXVWL¿FD SRUTXH ORV PpGLFRV UHFHODQ GH OD JHVtión por cuanto presumen puede suponerles una
pérdida de poder e incluso de libertad clínica.
<HVTXHDOJXQRVPpGLFRVHQWLHQGHQODOLEHUWDG
clínica como una responsabilidad de tipo personal con el diagnóstico y el tratamiento de sus
SDFLHQWHVFRQDXVHQFLDWRWDOGHUHVSRQVDELOLGDG
DQWHFRPSDxHURVJHUHQFLDRDXWRULGDGVDQLWDULD
SRUVXVGHFLVLRQHVFOtQLFDVOOHJDQGRDFRQVLGHrarse sus propios gerentes. Ahí surge la necesiGDGGHHVWDEOHFHUOtPLWHV\DTXHODOLEHUWDGVLQ
OtPLWHV QR H[LVWH HQ QLQJ~Q VLWLR (VRV OtPLWHV
deberán estar adecuados a:
‡/H\
‡(VWiQGDUHVFOtQLFRVDFHSWDGRV
‡$MXVWDGRDOFRQWUDWRHVWDEOHFLGRHQWUHODVSDUWHV
‡&RQFyGLJRVpWLFRVGHFRQGXFWD
‡$MXVWDGRDORVUHFXUVRVGLVSRQLEOHV
7 - Gestión clínica: una nueva forma de entender la gestión sanitaria / 149
0XFKRVGHORVFRQÀLFWRVGHDKRUD\GHVLHPSUHHQWUHORVJHVWRUHV\ORVPpGLFRVVHFHQWUDQ
HQUHVROYHUTXLpQWLHQHODDXWRULGDGSDUDGHFLGLU
OD SULRULGDG FXDQGR ORV UHFXUVRV GH ORV TXH VH
GLVSRQH VRQ OLPLWDGRV FLUFXQVWDQFLD FDGD YH]
más presente ante la realidad económica actual.
/DLQFXUVLyQHQXQWHUUHQRTXHHUDcoto de la
profesión médica y las demandas de una mayor
responsabilidad en el uso de recursos son rechazados por los médicos usando como escudo a
ODOLEHUWDGFOtQLFDTXHDXQTXH\DVHWUDWDGHXQ
HVFXGRPX\GHVWUR]DGRHLQRSHUDQWHVLJXHFRQVHUYDQGRXQDJUDQHPRFLRQDOLGDG
<HVTXHHOPpGLFRKDDSUHQGLGRDGHVDUUROODU
VXWUDEDMRDWUDYpVGHXQVLVWHPDGHDSUHQGL]DMH
TXHHVWiOHMRVGHXWLOL]DUWpUPLQRVGHH¿FLHQFLD
6LHQGRHVWRDVtSDUHFHOyJLFRSODQWHDUVHODSUHJXQWD DFHUFD GH ¢TXp OH TXHGD DO PpGLFR PiV
TXHXWLOL]DUODKHUUDPLHQWDGHOMXLFLRFOtQLFR\OD
libertad clínica?
Si analizamos datos de otros sistemas sanitaULRVYHPRVTXHHQHO5HLQR8QLGRSRUHMHPSOR
HOGHORVDFWRVPpGLFRVQRVRQHYDOXDGRV
HV GHFLU OD LQGLFDFLyQ GH SUXHEDV R ORV WUDWDPLHQWRVPpGLFRVRTXLU~UJLFRVVHOOHYDQDFDER
WHQLHQGRFRPREDVHODH[SHULHQFLDSDVDGDHOVDEHUDGTXLULGR\HOMXLFLRFOtQLFR<HVTXHHQQLQJ~QPRPHQWRVHKDKHFKRXQDHYDOXDFLyQIRUPDO
FLHQWt¿FDSRUQLQJXQD$GPLQLVWUDFLyQ6DQLWDULD
DVSHFWRTXHVHUHYHODFDGDGtDFRPRPiVFUXFLDO
HQHOFRQWUROGHODDFWLYLGDGVDQLWDULD
(VXQJUDYHHUURUFUHHUTXHODOLEHUWDGFOtQLFDR
ODOLEHUWDGGHSUHVFULSFLyQDPSDUDQDOPpGLFRTXH
XWLOL]DSURFHGLPLHQWRVQRYiOLGRVGHDFXHUGRDOR
TXH OD FLHQFLD DFWXDO FRQVLGHUD FRUUHFWR \D TXH
OR ~QLFR TXH OD OLEHUWDG FOtQLFD GHEHUtD SHUPLWLU
HVHOHJLUHQWUHORVSURFHGLPLHQWRVTXHODFLHQFLD
HVWLPHYiOLGRVQXQFDHQWHUULWRULRVVLWXDGRVPiV
DOOiGHODVIURQWHUDVGHOFRQRFLPLHQWRFLHQWt¿FR
+D\ TXH EXVFDU SODQWHDPLHQWRV TXH KDJDQ
FRLQFLGLUORPpGLFDPHQWHDWUDFWLYRSDUDORVSURfesionales en términos de decisión clínica con
lo socialmente deseable. Y para lograr todo esto
KD\TXHEXVFDUXQDSHUIHFWDFRQMXJDFLyQGH
WDPLHQWRVGHGXGRVDRHVFDVDH¿FDFLDWHUDSpXWLFD
OR TXH FRQGXFLUi D XQD PHMRU XWLOL]DFLyQ GH ORV
UHFXUVRVHFRQyPLFRV3UDFWLFDUOD0(%VLJQL¿FD
LQWHJUDUODFRPSHWHQFLDFOtQLFDLQGLYLGXDOFRQOD
PHMRUHYLGHQFLDFOtQLFDH[WHUQDGLVSRQLEOHDSDUWLUGHODLQYHVWLJDFLyQVLVWHPiWLFD1LQJXQDGHODV
GRVSRUVHSDUDGRVHUiVX¿FLHQWH
Hay algunas consideraciones de cierta imSRUWDQFLD TXH FRQYLHQH KDFHU D OD KRUD GH KDblar de libertad clínica y su innegable relación
FRQODJHVWLyQFOtQLFDHLQFOXVRFRQODSROtWLFD
sanitaria:
1. La política sanitaria nunca dictará de forPDGLUHFWDODSUiFWLFDFOtQLFDSHURVtFRQGLFLRQDUiODOLEHUWDGFOtQLFDGDGRTXHODSUiFWLFDFOtQLFDVHDGDSWDDODFDUWHUDGHVHUYLFLRV\DODRIHUWD
disponible.
/DFXDQWL¿FDFLyQGHODRIHUWDDWUDYpVGH
XQDDGHFXDGDSODQL¿FDFLyQHVXQDUPDGHJUDQ
URWXQGLGDGSDUDWUDWDUGHFRQVHJXLUORTXHODVRFLHGDGYDORUDDOPHQRUFRVWRSRVLEOHHYLWDQGR
TXHODRIHUWDGHVHUYLFLRVVHDDOJRGHVFRRUGLQDGR GHSHQGLHQWH GH FDGD PpGLFR \ FRQ WRTXHV
DQiUTXLFRV
3RU WDQWR XQD YHUGDGHUD OLEHUWDG FOtQLFD
VHPD[LPL]DPiVFXDQWRPiVVHRSWLPLFHHOXVR
GHUHFXUVRVSDUDVHUYLUDORVLQWHUHVHVGHORVSDcientes.
<DHQODGpFDGDGHORVRFKHQWDVHR\HURQYRFHV
KDEODQGRGHHVWHSUREOHPDFRPRIXHHOFDVRGH
5D\PRQG+RIIHQEHUJTXLHQD¿UPy³«1RSXHGHH[LVWLUOLEHUWDGFOtQLFDWRWDOVLQWHQHUHQFXHQWD
ODV SUHIHUHQFLDV R GHVHRV GHO SDFLHQWH7DPELpQ
KD\TXHFRQVLGHUDUDVSHFWRVSHUVRQDOHVpWLFRV\
OHJDOHV<HQHVWDQXHYDHUDWDPELpQHOOtPLWHTXH
QRVPDUFDQXQRVUHFXUVRVOLPLWDGRV´
$KRUD ELHQ SRGUtDPRV D¿UPDU VLQ PLHGR D
HTXLYRFDUQRV TXH GHVGH XQ SXQWR GH YLVWD GH
JHVWLyQ KDELWXDOPHQWH ORV PpGLFRV WUDEDMDQ \
tienen en consideración aspectos de costo en
OD WRPD GH GHFLVLRQHV GLDULDV FXDQGR DIHFWDQ
DO SURSLR SDFLHQWH D ORV IDPLOLDUHV D OD VRFLHdad o al sistema de salud. Pero no se manejan
criterios de respuesta basados en costos sino en
‡(MHUFLFLRSURIHVLRQDOFRQEDVHFLHQWt¿FD
FLUFXQVWDQFLDVFRODWHUDOHV SUHVWLJLRSUHVLyQID‡,QWHULRUL]DFLyQGHOFRVWRRSRUWXQLGDG
PLOLDU« ‡2ULHQWDFLyQDOXVXDULR
Ningún profesional debe situarse en su ac(V SUREDEOH TXH OD 0HGLFLQD %DVDGD HQ OD tuación y en la toma de decisiones clínicas al
(YLGHQFLD EDVDGDHQKHFKRVFLHQWt¿FDPHQWHSUR- margen de la realidad socioeconómica y polítiEDGRV VXSRQJDXQDKRUURHQHOXVRGHWpFQLFDV FD$VtSXHVHOSUREOHPDQRHVWiHQGUDPDWL]DU
diagnósticas inapropiadas y reduzca el uso de tra- R SHQVDU TXH ORV PpGLFRV QR WLHQHQ HQ FXHQWD
150 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
los costos; el problema está en donde se sitúa la
OtQHDTXHPDUTXHHOOtPLWHVREUHTXpFRVWRVGHben ser tenidos en cuenta por los profesionales
sanitarios y cuáles no.
/R TXH Vt HVWi FODUR DXQTXH SXHGD SDUHFHU
XQD REYLHGDG HV TXH OD QHFHVLGDG GH FRQWURO
de la libertad clínica es diferente para el gestor
HQIXQFLyQGHVXiPELWRGHDFWXDFLyQDVtHQHO
iPELWRSULYDGRHO¿QGHOXFURHVXQRGHORVIDFWRUHVTXHKDFHQHFHVDULDHVDOLPLWDFLyQGHODOLEHUWDGFOtQLFD$PD\RUFRQWUROPD\RUEHQH¿FLR
HFRQyPLFR6LQHPEDUJRHQHOiPELWRS~EOLFR
ODPD[LPL]DFLyQGHVHUYLFLRVHVORTXHSHUVLJXH
HOOtPLWHGHODOLEHUWDGFOtQLFD$PD\RUFRQWURO
PD\RU YROXPHQ GH VHUYLFLRV R PD\RU DPSOLDFLyQGHODFDUWHUDGHVHUYLFLRV
/OHJDGRV D HVWH SXQWR KDEUtD TXH UHFRUGDU
ODVSDODEUDVGH-5+DPSWRQSXEOLFDGDVHQHO
British Medical Journal HQ HO DxR HQ VX
FpOHEUHDUWtFXOR³7KHHQGRIWKHFOLQLFDOIUHHGRP
(O ¿Q GH OD OLEHUWDG FOtQLFD ´ (Q pO GHFtD OR
siguiente: “La libertad clínica ha muerto y nadie
GHEHODPHQWDUVXIDOOHFLPLHQWR (QORVWLHPSRVHQORVTXHODLQYHVWLJDFLyQHUDLQH[LVWHQWH\
HO WUDWDPLHQWR WDQ LQRIHQVLYR FRPR LQH¿FD] OD
RSLQLyQGHOPpGLFRHUDOR~QLFRTXHKDEtDSHUR
DKRUD OD RSLQLyQ QR HV VX¿FLHQWH /D OLEHUtad clínica debiera haber sido estrangulada hace
WLHPSR\DTXHHQHOPHMRUGHORVFDVRVKDVLGR
HOHQFXEULPLHQWRGHODLJQRUDQFLD\HQHOSHRU
XQDH[FXVDSDUDHOFXUDQGHULVPR « /DOLEHUtad clínica murió accidentalmente atrapada entre
ODVQXHYDVIRUPDVGHLQYHVWLJDFLyQ\WUDWDPLHQWR\ORVOtPLWHVLQHYLWDEOHVGHXQDHFRQRPtDTXH
QRSXHGHH[SDQGLUVHLQGH¿QLGDPHQWH´
$QWH HVWR OD SUHJXQWD TXH QRV IRUPXODPRV
HV¢UHDOPHQWHKDIDOOHFLGR"3DUHFHFODURTXHOD
pérdida de la libertad clínica debe ir pareja a un
proceso de acercamiento y pacto de intereses enWUHODDGPLQLVWUDFLyQ\HOSURIHVLRQDO<DXQTXH
H[LVWHXQJUDQFRQVHQVRDFHUFDGHHVWDPXHUWH
SDUHFHTXHQDGLHVHDWUHYHD¿UPDUVXFHUWL¿FDGR
GH GHIXQFLyQ< HV TXH FRPR PHQFLRQD$OODQ
:LOOLDPV³«DYHFHVDXQTXHODOLEHUWDGFOtQLFD
esté muerta se utiliza como si se tratara del cuerSRGHO&LG&DPSHDGRUPRVWUiQGRODHQGHIHQVD
GHDTXHOODVSUiFWLFDVPpGLFDVTXHVHYHQDPHQD]DGDVSRUODHIHFWLYLGDG´
Los profesionales sanitarios también temen
SHUGHU YDORUHV DVHQWDGRV HQ OD SUiFWLFD PpGLFD
DORODUJRGHORVVLJORV\YHUVHFRUURPSLGRVSRU
una mentalidad empresarial; si a todo esto se
DxDGH OD SHUFHSFLyQ GH TXH OD DFWXDFLyQ GHVGH
OD JHVWLyQ EXVFD OLPLWDU VX DXWRQRPtD QRV HQcontramos por tanto con un panorama cuando
PHQRV GLItFLO GH DUWLFXODU Pi[LPH VL WHQHPRV
DGHPiVHQFXHQWDTXHOD$GPLQLVWUDFLyQ6DQLWDria ha prestado de forma clásica escasa atención
a la formación de los profesionales a lo largo de
VXSHUtRGRHGXFDWLYRHQGLVFLSOLQDVUHODFLRQDGDV
con la gestión sanitaria.
+D\ TXH UHFRQRFHU SRU RWUD SDUWH TXH HQ
RFDVLRQHVQRVHKDVLGRFDSD]GHGH¿QLUGHXQD
IRUPDFODUD\HIHFWLYDORTXHVXSRQHODFRUUHVSRQVDELOL]DFLyQHQODVODERUHVGHJHVWLyQQRKDELHQGR WUDVODGDGR D QXHVWURV SURIHVLRQDOHV TXp
HVORTXHUHDOPHQWHHVSHUDPRVGHHOORVFXDQGR
hablamos de gestión clínica.
/RTXHSDUHFHLQGXGDEOHHVTXHORVSDSHOHV
TXH MXHJDQ WRGRV ORV DFWRUHV HQ OD UHDOLGDG GH
ODDVLVWHQFLDVDQLWDULDSXHGHQYHUVHFODUDPHQWH
IDYRUHFLGRVVLVRPRVFDSDFHVGHLQWHJUDUTXpHV
ORTXHSRGHPRVDSUHQGHUHQWUHWRGRV1RROYLGHPRVTXHVLODVGHFLVLRQHVGHJHVWLyQGHEHQGH
estar basadas en todo momento en la información
FRQWUDVWDGD WDPSRFR SRGHPRV SHUGHU GH YLVWD
TXH HQ QXHVWUD RUJDQL]DFLyQ HO FRQRFLPLHQWR
VHDVLHQWDHQORVSURIHVLRQDOHVVDQLWDULRVIXQGDPHQWDOPHQWHORVPpGLFRV-HUHP\/HH3RWWHUHQ
XQD UHYLVLyQ UHDOL]DGD SDUD OD British Management Association BMA H[SRQtDGHXQDIRUPD
iVSHUDTXH³«HQXQDFRPSDxtDELHQJHVWLRQDGD
ORV PHMRUHV ORV PiV EULOODQWHV ORV OtGHUHV VRQ
ORVJHVWRUHV«HQORVVHUYLFLRVDVLVWHQFLDOHVHVWD
SRVLFLyQWDQGHVWDFDGDODRFXSDQORVPpGLFRV´
Con esta realidad presente a lo largo de los
últimos decenios parecía claro y absolutamente
QHFHVDULR TXH VH GHVDUUROODUDQ SUR\HFWRV \ DOWHUQDWLYDV TXH IXHUDQ SRVLELOLWDQGR HVD SDUWLFLSDFLyQHLPSOLFDFLyQDFWLYDGHORVSURIHVLRQDOHV
HQODVWDUHDVGHJHVWLyQ'HHVWDIRUPD\DGHVGH
PHGLDGRV GHO VLJOR ;; VH GHVDUUROODURQ IyUPXODVTXHLQLFLDEDQHVWHFDPLQRHQHO+RVSLWDO
-RKQV+RSNLQVGH%DOWLPRUH\IXHURQPXFKDVD
ORODUJRGHORV~OWLPRVGRVGHFHQLRVVREUHWRGR
ODVH[SHULHQFLDVUHDOL]DGDVHQHO6HUYLFLRGH6DOXG EULWiQLFR FRQ GRFXPHQWRV WDQ GHWHUPLQDQWHVFRPRIXHURQHO,QIRUPH*ULI¿WKVRHOGRFXmento Working for patientsGHJUDQLQÀXHQFLD
HQODVH[SHULHQFLDVSRVWHULRUHVGHJHVWLyQFOtQLFD
OOHYDGDVDFDERHQHOPXQGRRFFLGHQWDO
Antes de abordar otros aspectos de gran imSRUWDQFLDGHQWURGHOPDUFRGHODJHVWLyQFOtQLFD
KD\TXHKDFHUKLQFDSLpHQTXHXQDJHVWLyQFOtQLFDFX\R~QLFRPRWLYRVHEDVHHQODQHFHVLGDGGH
reducir costos está condenada al fracaso; hablar
7 - Gestión clínica: una nueva forma de entender la gestión sanitaria / 151
de ética en el compromiso con la población a
DWHQGHUHQODQHFHVLGDGGHGLVWULEXFLyQGHUHFXUsos o en la mejora de la calidad y la disminución
GHODYDULDELOLGDGVRQDUJXPHQWRVTXHIDFLOLWDUiQ
el entendimiento entre todos los actores de este
complejo mundo sanitario.
Definición de la gestión clínica
6RQPXFKDVODVGH¿QLFLRQHVTXHFLUFXODQHQOD
ELEOLRJUDItDH[LVWHQWHVREUHHOVLJQL¿FDGRGHOD
H[SUHVLyQgestión clínica7UDWDQGRGHKDFHUXQ
UHVXPHQVHSRGUtDGHFLUTXHODJHVWLyQFOtQLFD
tiene por objeto garantizar una correcta atención
de los pacientes teniendo en consideración el
QHFHVDULRFRQWUROGHOXVRGHUHFXUVRV$VtSXHV
FRPRVHSXHGHYHUHVWDPRVKDEODQGRGHUHVXOWDGRVHQWLHPSR\IRUPDGHLPSOLFDFLyQSRUSDUWH
GHO SURIHVLRQDO VDQLWDULR GH FRVWRV \ WDPELpQ
SRUVXSXHVWRGHVDWLVIDFFLyQGHOSDFLHQWH
&RPRDSXQWD2U¿OD7LPRQHUODJHVWLyQFOtQLFD
es una forma de gestionar las unidades asistenciaOHVEDVDGDVREUHWRGRHQODSDUWLFLSDFLyQDFWLYD\
responsable de los profesionales en la consecución
GHREMHWLYRV'HDKtODQHFHVLGDGGHLQWURGXFLUFRQceptos tan alejados hasta el momento actual de la
SUiFWLFDFOtQLFDFRPRVRQODSODQL¿FDFLyQODJHVWLyQHOFRVWR\WRGRHOORHQXQPDUFRGHSDUWLFLSDFLyQUHVSRQVDELOL]DFLyQFDOLGDG\GHE~VTXHGDGH
la satisfacción del paciente.
La gestión clínica facilita un proceso de
UHDGDSWDFLyQ ODERUDO PXWXR HQ HO TXH HO SURfesional asume responsabilidad y el gestor se
FRQ¿JXUD FRPR XQ HOHPHQWR IDFLOLWDGRU GH OD
RUJDQL]DFLyQEXVFDQGRDPERVHOLQFUHPHQWRGH
ODH¿FLHQFLDGHOVLVWHPDVDQLWDULR/DJHVWLyQFOtnica debe tratar de conjugar dos aspectos de la
Pi[LPDLPSRUWDQFLD
a. las demandas de la población
b. el uso racional de los recursos
<HVTXHHQODUHDOLGDGGHODDWHQFLyQDOSDFLHQWHFRQYLYHQGRVFDUDVDQWHODVTXHQRSRGHmos adoptar por más tiempo una actitud de desprecioDOFRQWUROGHOXVRGHORVUHFXUVRVFRPR
algo por completo secundario.
La gestión clínica busca en principio aunar
GRVFXOWXUDVWUDGLFLRQDOPHQWHDOHMDGDVODGHOD
JHVWLyQ\ODFXOWXUDFOtQLFDLQWHQWDQGRDGDSWDUVH
DXQDQXHYDUHDOLGDGKRVSLWDODULDVLHQGRUHÀHMR
\SRVLEOHVROXFLyQSDUDODQXHYDUHDOLGDGTXHVH
HVWi LPSRQLHQGR HQ HO VLJOR ;;, HQ OD TXH HO
FRQRFLPLHQWR OD FDOLGDG ODV EXHQDV SUiFWLFDV
FOtQLFDV \ OD HYLGHQFLD FLHQWt¿FD VH FRQ¿JXUDQ
FRPRORVHMHVGHODDFWLYLGDGKRVSLWDODULD
/XHJRDORODUJRGHOFDStWXORKDEODUHPRVGH
DOJXQRVGHORVSXQWRVTXHFRQVWLWX\HQHOHPHQWRVGH
JUDQLPSRUWDQFLDGHQWURGHORTXHHVHOPXQGRGH
ODJHVWLyQFOtQLFDDVtDVSHFWRVFRPRODJHVWLyQSRU
SURFHVRVODJHVWLyQGHOFDPELRHOQHFHVDULRFDPbio de las formas clásicas de organización de los
KRVSLWDOHV OD KRUL]RQWDOL]DFLyQ GH ODV HVWUXFWXUDV
GLUHFWLYDVRODQHFHVLGDGGHGDUXQDDWHQFLyQDORV
pacientes con un carácter integrador se constituyen
FRPRORVHOHPHQWRVTXHFRQWULEXLUiQDHVDPHMRUD
GHODH¿FLHQFLDGHQXHVWUDVRUJDQL]DFLRQHV
Cuando hablábamos de libertad clínica y
gestión clínica mencionábamos conceptos de
gran calado como el de la Medicina Basada en
OD(YLGHQFLDSXHVELHQHVWRVFRQFHSWRVVRQORV
TXH GHEHQ D\XGDU GH IRUPD IXQGDPHQWDO D ORV
profesionales sanitarios en la toma de decisioQHV TXH GHEHQ HVWDU DVHQWDGDV HQ OD HYLGHQFLD
FLHQWt¿FD\HQHOFRQRFLPLHQWRPpGLFR
Puntos básicos que hay que
considerar ante la gestión clínica
+D\XQDVHULHGHDVSHFWRVTXHKD\TXHWHQHUHQ
FXHQWDDQWHFXDOTXLHUSODQWHDPLHQWRTXHVHKDJD
de gestión clínica:
1. Establecimiento claro de una cartera de
VHUYLFLRVDFRUGHFRQODHVWUXFWXUD\ODVSRVLELOLdades y en consonancia con las demandas de la
VRFLHGDGODUDFLRQDOLGDGFOtQLFD\ODVSRVLELOLGDGHV¿QDQFLHUDV
3ODQWHDPLHQWRGHXQDHVWUDWHJLDGHIXWXUR
clara. Resulta imprescindible saber dónde estaPRVSHURWDPELpQKDFLDGyQGHTXHUHPRVLU
'HVDUUROORGHVLVWHPDVGHLQIRUPDFLyQTXH
SHUPLWDQFRQRFHUDQDOL]DU\HYDOXDUODDFWLYLGDG
GHVDUUROODGD\VLUYDDOPLVPRWLHPSRFRPRYHhículo de comunicación.
4. La gestión clínica se basa en un concepto
GH WUDEDMR PXOWLGLVFLSOLQDU HQ HO TXH QR VRODmente es importante la función del médico sino
ODGHWRGRVORVSURIHVLRQDOHVTXHGHXQDXRWUD
forma inciden en el proceso asistencial.
5. La gestión clínica se estructura alrededor
GHORVSURFHVRVEXVFDQGRHQWRGRPRPHQWRXQD
PHMRUDGHODFDOLGDG\XQXVRH¿FD]GHORVUHFXUsos disponibles.
(VWDEOHFLPLHQWRGHXQFRQWUDWRTXHHVSHFL¿TXHREMHWLYRVDVLVWHQFLDOHVGHFDOLGDG\GHVHJXULdad en un marco de descentralización económica y
de posibilidades de gestión directa de dichos recur-
152 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
VRV(OFRQWUDWRGHEHUHFRJHUORTXHVHH[LJH\OR
TXHVHREWLHQHHQXQPDUFRGHDEVROXWDFODULGDG\
con sistemas de información adecuados.
7RGRORDQWHULRUFRPRHVREYLRGHEHHVWDU
asentado sobre una clara implicación y asunción
de responsabilidades por parte de todos los proIHVLRQDOHVTXHSDUWLFLSHQHQHOSUR\HFWRTXHVH
plantee de gestión clínica.
8QD8QLGDGGH*HVWLyQ&OtQLFDGHEHUHVSRQder a una serie de cuestiones básicas como son
las siguientes:
‡4XpHVORTXHKD\TXHKDFHU
‡&yPRKDFHUOR
‡&RQTXpVLVWHPDVGHLQIRUPDFLyQ
‡&RQTXpFRVWRV\¿QDQFLDFLyQ\
‡&yPRHIHFWXDUODHYDOXDFLyQ
$O PLVPR WLHPSR FRQYLHQH KDFHU XQD UHÀH[LyQVREUHODVYHQWDMDVHLQFRQYHQLHQWHVTXH
SUHVHQWDHQODDFWXDOLGDGFXDOTXLHUSUR\HFWRGH
JHVWLyQFOtQLFDTXHVHYD\DDSODQWHDUHQXQDLQVWLWXFLyQ VDQLWDULD 6HJ~Q H[SUHVD 7HPHV HQ VX
OLEURVREUHJHVWLyQFOtQLFDODVYHQWDMDVVHSXHden sintetizar en las siguientes:
‡ 1R SUHFLVDQ FDPELRV QRUPDWLYRV GH LPSRUWDQFLDDXQTXHVtFRQYLHQHHVWDEOHFHUDQLYHO
QRUPDWLYR GLQiPLFDV GH IXQFLRQDPLHQWR
HVWUXFWXUD HWF GH ODV ÈUHDV R 8QLGDGHV GH
Gestión Clínica a desarrollar.
‡1RGHVSLHUWDUHFKD]RSROtWLFRGHKHFKRKDQ
sido administraciones de diferentes signos y
HQGLIHUHQWHVSDtVHVTXLHQHVEXVFDQHVWHWLSR
de soluciones.
‡(VXQSURFHVRSDXODWLQR\YROXQWDULRUHSUHVHQWDPiVDOOiGHORTXHSXHGHVHUODLQVWDXUDFLyQGHPHGLGDVSXQWXDOHVDIHFWDQGRDOD
forma de funcionamiento y reticulación del
hospital.
‡ &RQOOHYD DXWRQRPtD GH JHVWLyQ HO PpGLFR
pasa no sólo a ser un elemento fundamental
HQHOJDVWRVDQLWDULRFRPRLQGXFWRUVLQRTXH
pasa a corresponsabilizarse de los resultados
GHVXVDFWXDFLRQHVDQLYHOHFRQyPLFRDGTXLULHQGR QXHYRV FRPSURPLVRV EDVDGRV HQ OD
E~VTXHGDGHODH¿FLHQFLD
‡0HMRUDODUHODFLyQPpGLFRSDFLHQWHFDPELD
ODIRUPDGHUHODFLyQFRQHOSDFLHQWHSDVDQGR
de una estructura anclada en el pasado y con
WLQWHVSDWHUQDOLVWDVDXQDQXHYDUHODFLyQEDVDGDHQODLQIRUPDFLyQ\HQODHOHFFLyQSRU
SDUWH GHO FLXGDGDQR GH ODV DOWHUQDWLYDV GH
WUDWDPLHQWRTXHHOPpGLFROHGDDHOHJLU
‡ 0HMRUD GH OD PRWLYDFLyQ GHO SHUVRQDO OD
LPSOLFDFLyQ GH IRUPD DFWLYD HQ OD WRPD GH
GHFLVLRQHV\HQODDWHQFLyQPHMRUDVLQGXGD
DOJXQD OD PRWLYDFLyQ GH QXHVWURV SURIHVLRnales.
‡ 3URSRUFLRQD PiV \ PHMRU LQIRUPDFLyQ XQR
GH ORV SXQWRV FODYH D GHVDUUROODU HQ FXDOTXLHU SURFHVR GH JHVWLyQ FOtQLFD VH DUWLFXOD
alrededor de la implantación de un sistema
GH LQIRUPDFLyQ TXH SHUPLWD FRQRFHU FRPR
herramienta para gestionar.
7DPSRFR IDOWDQ ODV FUtWLFDV FHQWUDGDV HQ OR
TXH SRGUtDPRV FRQVLGHUDU WUHV DVSHFWRV VHFXQdarios:
‡ 3UHVLyQ VLQGLFDO ORV PHFDQLVPRV GH IXQcionamiento en un área de gestión clínica
pueden ser malinterpretados como fórmulas
SULYDWL]DGRUDVHQFXELHUWDVVyORSRUHOKHFKR
GHODE~VTXHGDGHODH[FHOHQFLDHQODH¿FLHQcia de la gestión de los recursos. Se trata de
FUtWLFDVLQHYLWDEOHVSHURTXHFDUHFHQGHWRGR
fundamento.
‡ 'HVHVWUXFWXUDFLyQ GHO PRGHOR GH RUJDQL]DFLyQDFWXDOHVWHSXQWRWLHQHXQDGREOHYHUWLHQWHSXHGHVHUHQWHQGLGRFRPRXQLQFRQYHQLHQWHRFRPRXQDRSRUWXQLGDGGHDGHFXDU
\ FDPELDU XQ PRGHOR RUJDQL]DWLYR TXH KD
FXPSOLGRVXIXQFLyQSHURTXHHVWiDJRWDGR
y cambiarlo por otro diferente pero con una
PD\RUDGHFXDFLyQDODQXHYDUHDOLGDG\DORV
QXHYRVSUREOHPDVTXHVHSODQWHDQHQORVVLVtemas sanitarios.
‡3XHGHTXHVXSODQWHDPLHQWRQRJHQHUHXQDnimidad entre los profesionales sanitarios:
HO GHVDUUROOR GH ODV 8QLGDGHV VH KD GHPRVWUDGR FRPR XQ DUPD GH VX¿FLHQWH DOFDQFH
SDUD FRQYHQFHU D ORV SURIHVLRQDOHV HQ SULQFLSLRUHWLFHQWHVQRHVXQDUPDDFRUWRSOD]R
VLHQGRVXp[LWRIUXWRGHXQWUDEDMRDPHGLR\
largo plazo.
La gestión por procesos
8QRGHORVSULQFLSLRVGHODJHVWLyQGHODFDOLGDG
KDFH UHIHUHQFLD D TXH XQ UHVXOWDGR VH DOFDQ]D
PiVH¿FD]PHQWHFXDQGRODVDFWLYLGDGHV\ORVUHcursos relacionados se gestionan como un proFHVR<HVTXHXQRGHORVSULPHURVSDVRVDWHQHU
en cuenta cuando hablamos de gestión clínica
HV OD QHFHVLGDG GH LGHQWL¿FDU FRQ FODULGDG ORV
7 - Gestión clínica: una nueva forma de entender la gestión sanitaria / 153
SURFHVRVTXHLQWHUYLHQHQGHQWURGHOiUHDHVWRV
procesos deben de ser analizados en su totaliGDG YLHQGR FyPR IXQFLRQDQ ORV ÀXMRV \ WRGDV
ODV LQWHUUHODFLRQHV TXH SXHGHQ H[LVWLU HQWUH ORV
participantes en el proceso.
$KRUD ELHQ ¢TXp HQWHQGHPRV SRU SURFHVR"
6HJ~QOD1RUPD,62XQSURFHVRHVXQ
FRQMXQWRGHDFWLYLGDGHVPXWXDPHQWHUHODFLRQDGDV
RTXHLQWHUDFW~DQTXHWUDQVIRUPDQHOHPHQWRVGH
HQWUDGDHQUHVXOWDGRV7DPELpQSRGUtDPRVGH¿QLU
XQSURFHVRDVLVWHQFLDOFRPRHOFRQMXQWRGHDFWLYLGDGHVOOHYDGDVDFDERSRUSURIHVLRQDOHVVDQLWDULRV
en diferentes tempos y siguiendo una secuencia
GHDFWLYLGDGHVSODQL¿FDGDV\GHELGDPHQWHHVWUXFWXUDGDVEXVFDQGRXQUHVXOWDGRDSURSLDGR
6HJ~Q9DUJDVXQSURFHVRGHVHUYLFLRVFOtQLcos es:
a. una secuencia de acciones clínicas y admiQLVWUDWLYDV
b. dirigidas a mejorar el estado de salud del
paciente
FVREUHODEDVHGHXQIXQGDPHQWRFLHQWt¿FR
d. con una utilización adecuada de recursos
económicos y no económicos
7RGRV ORV SURFHVRV DVLVWHQFLDOHV GHEHQ UHVponder a cuestiones básicas como son la razón
GH OD H[LVWHQFLD GHO SURSLR SURFHVR H[SOLFDQGR
HQTXpFRQVLVWHFRQTXpREMHWR\DTXLpQVHGLULJH\DOPLVPRWLHPSRGHEHTXHGDUGH¿QLGRFRQ
FODULGDG HO HQWRUQR VHFXHQFLDO GH FyPR VH YDQ
DJUXSDQGRODVDFFLRQHVVREUHHOSDFLHQWHVLHQGR
XQDVSHFWRTXHGHEHUHVDOWDUVHHQFXDOTXLHUSURFHVR OD QHFHVLGDG GH HYDOXDU \ PHGLU WRGDV ODV
DFWLYLGDGHVUHDOL]DGDV/DDGHFXDGDFRRUGLQDFLyQ
GHWRGDVODVDFWLYLGDGHVOOHYDGDVDFDERVREUHHO
paciente es la garantía de una atención integral y
GHFDOLGDGVyORFRQRFLHQGRWRGRVDTXHOORVSDVRV
\DFWXDFLRQHVUHDOL]DGRVSRGUHPRVLGHQWL¿FDUORV
DVSHFWRVFDSDFHVGHPHMRUDUODDWHQFLyQSUHVWDGD
WDQWRHQORTXHVHUH¿HUHDODIRUPDFRPRDORV
WLHPSRVH[LVWHQWHVHQWUHXQD\RWUDDFWXDFLyQ
/DV YHQWDMDV GH XQ PRGHOR GH JHVWLyQ SRU
SURFHVRVVHSRGUtDVLQWHWL]DUFRPRLQGLFD7HPHV
HQHODxRHQORVVLJXLHQWHVFRPSRQHQWHV
a. Se centra en el usuario.
E)DYRUHFHHOFDPELRGHDFWLWXGGHORVSURIHsionales.
c. Mejora la continuidad de la asistencia.
d. Se basa en la implicación de los profesionales.
H0HMRUDODHIHFWLYLGDGGHODVDFWXDFLRQHV
f. Optimiza el uso de recursos.
J)DFLOLWDODLGHQWL¿FDFLyQGHODIDOWDGHFDOLdad de las actuaciones.
$ ODV DQWHULRUHV KDEUtD TXH DxDGLU WDQWR ODV
mejoras en tiempos de atención como el aumento de la satisfacción de los pacientes.
8Q DQiOLVLV GHWDOODGR GH WRGRV ORV SURFHVRV
OOHYDGRVDFDERQRVGHEHSODQWHDUPXOWLWXGGHDOWHUQDWLYDVGHPHMRUDDKtHQWUDQFRQFHSWRVFRPR
ODUHLQJHQLHUtDGHSURFHVRVTXHVHFHQWUDHQHO
análisis de dos cuestiones básicas como son preJXQWDUVHODUD]yQSRUODTXHODVFRVDVVHUHDOL]DQ
GHXQDGHWHUPLQDGDPDQHUD\SRURWURODGRSUHguntarse asimismo si no se podrían realizar las
cosas de otra forma diferente.
En la reingeniería de procesos hospitalarios
VHDSXQWDQXQDVHULHGHFRPSRQHQWHVEiVLFRVGH
acuerdo a un estudio realizado en hospitales ameULFDQRVSRU:DOVWRQ\.LPEHUO\HQHODxR
TXHVHHVWUXFWXUDQHQORVVLJXLHQWHVJUXSRV
D8WLOL]DFLyQGHSHUVRQDO
1. Necesidad de proceder a una descentralizaFLyQGHORVVHUYLFLRVGHODRUJDQL]DFLyQ
$XVSLFLDEDQ DVLPLVPR XQD QHFHVLGDG GH
reducción del tamaño de las plantillas de perVRQDOH[LVWHQWHV
3URSLFLDEDQWDPELpQODFUHDFLyQGHHTXLSRV
HQ ORV TXH ODV DFWLYLGDGHV VH UHSDUWLHUDQ HQ
IXQFLyQ GH OD FXDOL¿FDFLyQ UHDOL]DQGR SRU
WDQWR WDUHDV TXH UHTXLHUHQ HVFDVDV KDELOLGDGHV\SHUVRQDOFRQXQDPHQRUFXDOL¿FDFLyQ
REYLDPHQWHHVWRSODQWHDXQDVLPSOLFDFLRQHV
claras en cuanto a la reducción de costos.
E'LVHxRGHOVHUYLFLR
4. Propugnaban una agrupación de los pacientes en función de las necesidades de cuidaGRVpVWDKDVLGRXQDLGHDTXHKDJHQHUDGRXQ
JUDQGHEDWHSRUFXDQWRTXL]iVWHQJDVXUD]yQ
de ser en la industria manufacturera pero con
GXGRVRVUHVXOWDGRVRSHUDWLYRVHQODVLQVWLWXciones sanitarias.
5. Necesidad de optimizar el uso de los recurVRVFOtQLFRVSDUDORTXHUHVXOWDLPSUHVFLQGLEOHHODQiOLVLVGHOÀXMRGHDFWXDFLRQHVTXHVH
OOHYDQDFDERHQHOSURFHVRGHDWHQFLyQ
c. Estructura de la organización
6. Abogan en su estudio por la necesidad de
DSODQDUODHVWUXFWXUDMHUiUTXLFDGHODRUJDQL-
154 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
]DFLyQ GHPDVLDGR FRPSOHMD \ FRVWRVD 8Q
aplanamiento de esta estructura reportará beQH¿FLRVHQDVSHFWRVWDQFODURVFRPRODPHjora de la transmisión de la información y la
descentralización y corresponsabilización en
la toma de decisiones.
%XVFDUIRUPDVGHUHGXFFLyQGHFRVWRVHQDVpectos no fundamentales ni relacionados con
ODDFWLYLGDGSULQFLSDOTXHFRQVWLWX\HODUD]yQ
de ser de nuestra empresa sanitaria.
:DOVWRQ\.LPEHUO\GDQXQDVHULHGHFRQVHMRV
TXHIDFLOLWDQHOp[LWRHQFXDOTXLHUSURFHVRGHHVWH
WLSRTXHDIURQWHPRVHQRUJDQL]DFLRQHVVDQLWDULDV
a. El plazo para lograr este tipo de transformaciones no es corto; se necesitan períodos prolongados para su puesta en funcionamiento y
SDUDODJDUDQWtDGHp[LWR
b. La formación e información del personal es
XQ IDFWRU FODYH GHO p[LWR SRU FXDQWR GHEHQ
FRQRFHU SHUIHFWDPHQWH D GyQGH TXLHUH LU OD
RUJDQL]DFLyQ\FXiOHVVRQORVUHTXHULPLHQWRV
TXHGHHOORVVHHVSHUDQ
F1DGLHGHEHTXHGDUDOPDUJHQGHODRUJDQL]DFLyQXQDGHODVEDVHVGHOp[LWRVHFHQWUDHQOD
FRQFHSFLyQGHHTXLSRVPXOWLGLVFLSOLQDUHVSDUD
ORV TXH VH KDFH QHFHVDULD OD SDUWLFLSDFLyQ GH
todos.
G'HEHH[LVWLUXQFURQRJUDPDFODURGHDFWLYLdades a desarrollar.
H 7RGR HO PXQGR GHEH FRQRFHU TXp FyPR
FXiQGR\SDUDTXpGHEHQKDFHUODVFRVDV(O
conocimiento del grado de responsabilidad
de todos los miembros de la organización
FRQWULEX\HFODUDPHQWHDOp[LWR
I(OSHUtRGRODUJRGHLPSODQWDFLyQGHOTXHKDEOiEDPRVDQWHVGHEHFRQWULEXLUDTXHODRUganización no tenga la sensación de ruptura
sino de transición.
J 3DUHFH FODUR TXH HO FROHFWLYR PpGLFR WLHQH
XQDJUDQLQÀXHQFLDHQHOSURFHVRUHTXLULpQdose su participación e implicación de forma
GHFLGLGDFRPRJDUDQWtDGHp[LWRGHOSUR\HFWRDXQTXHVLQROYLGDUHOLPSRUWDQWHSDSHOGHO
UHVWRGHORVFROHFWLYRVVDQLWDULRV
6HWUDWDDODYLVWDGHORDQWHULRUGHFRQRFHU
\HVWUXFWXUDUGHPRGRDGHFXDGRWRGDVODVDFWLYLGDGHVTXHFRQIRUPDQQXHVWUDUHDOLGDGSDUDTXH
con una correcta sistematización de las mismas
y después de un análisis de sus necesarias inWHUUHODFLRQHV ORJUHPRV ORV PHMRUHV UHVXOWDGRV
posibles para la organización.
$QWHHVWRVSODQWHDPLHQWRVSDUHFHFODURTXH
XQRGHORVSXQWRVSULQFLSDOHVTXHVXVWHQWDFXDOTXLHUDFWXDFLyQHQHVWHVHQWLGRGHVFDQVDVREUHOD
QHFHVLGDGGHFRQWDUHQFXDOTXLHURUJDQL]DFLyQ
FRQ PHFDQLVPRV GH SODQL¿FDFLyQ HVWUDWpJLFD
FODUDPHQWH DVHQWDGRV TXH SHUPLWDQ DOFDQ]DU OD
PLVLyQ TXH OD RUJDQL]DFLyQ VH KD\D PDUFDGR
PLVLyQQRFRPRKHFKRDLVODGRVLQRDSR\DGDHQ
ORVFRQFHSWRVGHYLVLyQ\YDORUHVGHODRUJDQL]DFLyQTXHSRVLELOLWDUiQOOHYDUDHIHFWRWDOPLVLyQ
6HWUDWDSRUWDQWRGHFRPSRQHUXQPDSDGHSURFHVRVTXHUHÀHMDUiDTXHOORVTXHVHUHDOL]DQHQOD
LQVWLWXFLyQTXHHVWHPRVDQDOL]DQGRDVXYH]HVWRVSURFHVRVJHQHUDOHVSRGUiQVHUVXEGLYLGLGRV
con objeto de facilitar su comprensión y análisis
DUTXLWHFWXUDGHSURFHVRV 1RROYLGHPRVTXHFXDOTXLHUSURFHVRGHDQilisis de procesos debe ser estudiado y rediseñado
WHQLHQGRHQFXHQWDODVH[SHFWDWLYDVGHOSULQFLSDO
SURWDJRQLVWDHOSDFLHQWHTXHVHFRQFHQWUDQHQ
FDOLGDGSRVLELOLGDGHVGHHOHFFLyQDFRUWDPLHQWR
GHSOD]RVDFFHVLELOLGDGPHMRUDGHODLQIRUPDFLyQ SUHRFXSDFLyQ SRU ORV WHPDV UHODFLRQDGRV
FRQODVHJXULGDG\WDPELpQHIHFWLYLGDG
(VWDPRV SRU WDQWR KDEODQGR GH ODV FXDWUR
IDVHV TXH GHEHQ FRPSRQHU FXDOTXLHU SUR\HFWR
de implantación de gestión por procesos: una
IDVHHVWUDWpJLFDRWUDGHGHVDUUROORVHJXLUFRQOD
LPSODQWDFLyQ\DFDEDUFRQODHYDOXDFLyQGHWRGR
HOSURFHVROOHYDGRDFDER
(Q OD IDVH HVWUDWpJLFD GH¿QLUHPRV DVSHFWRV
WDQLPSRUWDQWHVFRPRODPLVLyQYLVLyQYDORUHV\
REMHWLYRVHVWUDWpJLFRVHQHVWDIDVHUHVXOWDEiVLFR
contemplar la elaboración de un mapa de proceVRVHQVXWULSOHYHUWLHQWHGLUHFWLYRVDVLVWHQFLDOHV
\GHJHVWLyQ$OUHVSHFWRFRQYLHQHKDFHUXQDFODUL¿FDFLyQFRQHVWRVDVSHFWRVWDQLPSRUWDQWHV
‡'HEHQLUHQFRQFRUGDQFLDFRQHOSODQWHDPLHQWRHVWUDWpJLFRJOREDOGHOKRVSLWDOGHOTXHIRUmen parte los proyectos de gestión clínica.
‡1RGHEHQROYLGDUORVWUHVSXQWRVEiVLFRVTXH
FDUDFWHUL]DQODDFWLYLGDGKRVSLWDODULDHQVXV
YHUWLHQWHV GRFHQWH LQYHVWLJDGRUD \ DVLVWHQcial.
‡'HEHGHWHQHUVHHQFXHQWDHOSULQFLSLRGHUHVponsabilización en el uso de los recursos.
Gestión del cambio
)RUPDSDUWHGHWRGRHOSURFHVRDOTXHYHQLPRV
aludiendo en el cual un correcto planteamiento
estratégico resulta imprescindible. Solamente
dedicaremos unas palabras a la gestión del cam-
7 - Gestión clínica: una nueva forma de entender la gestión sanitaria / 155
ELRKDFLHQGRHVSHFLDOpQIDVLVHQODVHWDSDVTXH HOORVHSUHWHQGHJDUDQWL]DUORVGHUHFKRVTXHUHFRJHQODPD\RUtDGHODV&RQVWLWXFLRQHVHQYLJRU
deben de cubrirse:
HQWUHHOORVHOGHUHFKRDODVDOXG
/D ¿QDOLGDG TXH VH SHUVLJXH PHGLDQWH OD
1. Reconocimiento de la necesidad del cambio
a. diagnóstico del problema
FUHDFLyQ GH HVWDV ÈUHDV R 8QLGDGHV &OtQLFDV
de Gestión es la de conseguir una atención sab. análisis de la información disponible
FLGHQWL¿FDFLyQGHVROXFLRQHV\DOWHUQD- QLWDULDGHFDOLGDGEDVDGDHQGHFLVLRQHVFOtQLFDV
WLYDV
DFRUGHVFRQODPHMRUHYLGHQFLDFLHQWt¿FD\HQ
&DSDFLGDGGHDFWXDFLyQ
ODH¿FLHQFLDFRPRFRPSURPLVRVRFLDO\JDUDQ'LVHxRGHOFDPELRYHUUHFXUVRVQHFHVDULRV WtDSDUDODVRVWHQLELOLGDGLPSOLFDQGRDOPLVPR
WLHPSRDORVSURIHVLRQDOHVLQWHJUDGRVHQHOiUHD
FDOHQGDULRLGHQWL¿FDUEDUUHUDV
&RQVXOWDKDEODUFRQORVSURIHVLRQDOHVH[SOL- HQODDVXQFLyQGHUHVSRQVDELOLGDGHVHQODWRPD
FDQGRODVSURSXHVWDVEXVFDQGRDSR\R\QR GHGHFLVLRQHV\HQODFRQVHFXFLyQGHORV¿QHV\
ROYLGDQGRDJHQWHUHOHYDQWH
REMHWLYRVSODQWHDGRV
5. Amplia difusión del cambio
6. Acuerdo sobre planes detallados
Definiciones
3XHVWDHQSUiFWLFDGHOFDPELR
$SR\DUHOFDPELR
8Q DSDUWDGR D FRQVLGHUDU HQ FXDOTXLHU UHJXOD0RGL¿FDUORVSODQHV
FLyQOHJDOTXHVHHPSUHQGDHVHOGHODGH¿QLFLyQ
9DORUDU HO UHVXOWDGR WHQLHQGR SUHVHQWH TXH GHÈUHDV\8QLGDGHVGH*HVWLyQ&OtQLFD
SDUDHIHFWXDUXQDFRUUHFWDYDORUDFLyQWHQGUHPRVTXHWHQHUSUHVHQWHTXH
1. Se denomina Área Clínica al conjunto de
VHUYLFLRV XQLGDGHV R iUHDV GH FRQRFLPLHQ‡(OFDPELRGHEHH[WHQGHUVHDORODUJRGH
WR FDUHQWHV GH SHUVRQDOLGDG MXUtGLFD SURSLD
un periodo de tiempo.
compuestas por un conjunto de recursos
‡$VHJXUDUVHGHTXHVHKD\DSURGXFLGRXQD
KXPDQRV\PDWHULDOHVTXHVHRUJDQL]DQFRQ
mejora y no sólo un cambio.
FULWHULRV GH FDOLGDG DXWRQRPtD H¿FDFLD \
‡ &RQVLGHUDU FyPR VH KD PRGL¿FDGR OD
H¿FLHQFLD FRQ REMHWR GH SUHVWDU OD DWHQFLyQ
SUiFWLFD FOtQLFD ODV LPSOLFDFLRQHV VREUH
VDQLWDULDSURSLDGHVXiUHDRXQLGDGEXVFDQlos recursos y el impacto del cambio.
do la necesaria coordinación y continuidad
asistencial para el paciente.
Aspectos importantes a considerar en la
6HGHQRPLQD8QLGDG&OtQLFDGH*HVWLyQDOFRQjunto de recursos humanos y materiales dentro
regulación legal de la gestión clínica
GH XQ VHUYLFLR TXH VH RUJDQL]DQ FRQ FULWHULRV
/DOHJLVODFLyQDLPSODQWDUFX\RREMHWRVHUiODUHGHFDOLGDGDXWRQRPtDH¿FDFLD\H¿FLHQFLDFRQ
gulación de la gestión clínica en un determinado
objeto de prestar la atención sanitaria propia de
WHUULWRULRWLHQHSRUREMHWRODUHJXODFLyQGHODHVsu área o unidad buscando la necesaria coordinatructura y funcionamiento de las Áreas Clínicas
ción y continuidad asistencial para el paciente.
\8QLGDGHV&OtQLFDVGH*HVWLyQHQHOPDUFRGHO 7DQWRHOÈUHDFRPROD8QLGDGVHUHVSRQVDELlizan ante la Gerencia del hospital del cumpli6LVWHPD 6DQLWDULR SUHWHQGLHQGR FRPSDWLELOL]DU
PLHQWRGHORVREMHWLYRVVDQLWDULRVPDUFDGRV
HO QHFHVDULR HTXLOLEULR HQWUH OD UHVSRQVDELOLGDG
DWUDYpVGHXQXVRH¿FLHQWHGHORVUHFXUVRV
RUJDQL]DWLYD \ XQ DGHFXDGR XVR GH ORV UHFXUVRV
¿MiQGRVHORVPLVPRVDWUDYpVGHXQFRQWUDWR
VDQLWDULRV(VWHPRGHORRUJDQL]DWLYRWHQGUiFRPR
TXHVHHVWDEOHFHUiHQWUHDPEDVSDUWHV
HMH\UD]yQGHVHUDOSDFLHQWHRUJDQL]iQGRVHORV
GLIHUHQWHVGLVSRVLWLYRVDVLVWHQFLDOHV\VXSHUVRQDO
GHPDQHUDLQWHUUHODFLRQDGD6HWUDWDSRUWDQWRGH Funciones
HYROXFLRQDUGHVGHXQPRGHORGHJHVWLyQFHQWUDGR
HQHOVHUYLFLRKDFLDRWURPiVÀH[LEOHHQHOTXHOD /DV ÈUHDV R 8QLGDGHV &OtQLFDV GH *HVWLyQ GHVDUUROODUiQIXQFLRQHVHQHOFDPSRGHODSUHYHQgestión se centra en el proceso y en el paciente.
El ámbito de aplicación incluye todos los FLyQ DWHQFLyQ VDQLWDULD UHKDELOLWDFLyQ LQYHVWLFHQWURV\HVWDEOHFLPLHQWRVVDQLWDULRVH[LVWHQWHV gación y docencia.
(Q PDWHULD GH SUHYHQFLyQ FRODERUDUiQ
HQHOWHUULWRULRVDQLWDULRGRQGHVHLPSODQWHDEDUFDQGRWRGRVVXVQLYHOHVDVLVWHQFLDOHV&RQWRGR GH IRUPD DFWLYD FRQ OD DXWRULGDG VDQLWDULD \
156 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
FRQORVGLVSRVLWLYRVDVLVWHQFLDOHVSHUWHQHFLHQWHV DO 6HUYLFLR GH 6DOXG HQ HO SODQWHDPLHQWR
SUHYLRGLVHxR\SXHVWDHQIXQFLRQDPLHQWRGH
ORV SURJUDPDV GH SUHYHQFLyQ SURSLRV GH VX
iPELWRGHIXQFLRQDPLHQWRDVtFRPRVXSRVWHULRUGHVDUUROOR\HYDOXDFLyQGHORVQLYHOHVGH
cumplimiento.
(QPDWHULDGHDWHQFLyQVDQLWDULD
a. Prestación de asistencia sanitaria propia de
sus características a la población de su ámELWR GH LQÀXHQFLD GHQWUR GHO PDUFR GH ORV
REMHWLYRV FOtQLFRV \ DVLVWHQFLDOHV TXH VHDQ
establecidos por las autoridades sanitarias.
E3URPRYHU\GLYXOJDUFRQVHQVRVWpFQLFRVFRQ
WRGRVORVSURIHVLRQDOHVGHOiUHDRXQLGDGDVt
como con los profesionales de otras áreas o
XQLGDGHV GH FRQRFLPLHQWR GHO FHQWUR GHVDUUROODQGRHQWRGRVORViPELWRVYtDVFOtQLFDV
orientadas al paciente.
F$QDOL]DUORVÀXMRV\SURFHGLPLHQWRVGHGHULYDFLyQGHSDFLHQWHVUHVSRQVDELOL]iQGRVHGH
ODDXWRUL]DFLyQGHODGHULYDFLyQGHDTXpOORV
SDUDORVTXHVHHVWLPHQHFHVDULR
d. Garantizar la formación de los profesionaOHVDGVFULWRVDOiUHDRXQLGDGIRPHQWDQGROD
toma de decisiones sustentada en razones de
HYLGHQFLDFLHQWt¿FD
e. Establecer cauces de participación entre las
áreas o unidades y las diferentes asociacioQHV R PRYLPLHQWRV VRFLDOHV GHO iUHD GH LQÀXHQFLD
(QHOiPELWRGHODUHKDELOLWDFLyQVHGHVDrrollarán las acciones necesarias propias de cada
iUHDRXQLGDGFRODERUDQGRFRQHOGHVDUUROORGH
programas de rehabilitación y reinserción laboUDO\RVRFLDOGHORVSDFLHQWHV
4. En el campo de la docencia:
a. Garantizar la adecuada formación pregraGRGHHVWXGLDQWHVGHPHGLFLQDHQIHUPHUtD\
otras disciplinas mediante la adecuada colaERUDFLyQFRQOD8QLYHUVLGDG
b. Garantizar la formación de especialistas de
acuerdo a los programas docentes establecidos para cada una de las especialidades.
c. Elaborar programas de formación tanto del
propio personal como de los profesionales de
Atención Primaria para las áreas de conociPLHQWR SURSLDV GH GLFKDV iUHDV R 8QLGDGHV
Clínicas de Gestión.
(QHOiUHDGHODLQYHVWLJDFLyQ
D,QFRUSRUDUODLQYHVWLJDFLyQFRPRXQRGHORV
ejes fundamentales a desarrollar dentro de
ODVDFWLYLGDGHV
b. Participar en ensayos y estudios multicenWURHQOtQHDVGHLQYHVWLJDFLyQSUHGH¿QLGDV\
consideradas de interés de acuerdo a la estrategia marcada en el área.
&XDOHVTXLHUDRWUDVIXQFLRQHVTXHSXGLHUDQ
ser encomendadas por la correspondiente autoridad sanitaria.
7RGDVODVIXQFLRQHVVHxDODGDVVHRULHQWDUiQ
DO FXPSOLPLHQWR GH ORV REMHWLYRV HVWDEOHFLGRV
desde la autoridad sanitaria correspondiente en
el marco de sus políticas sanitarias.
Sistemas de información
&DGD ÈUHD R 8QLGDG GHEHUi GHVDUUROODU VX VLVWHPDGHLQIRUPDFLyQTXHVHUiVXSHUYLVDGRSRU
OD 'LUHFFLyQ GHO &HQWUR DGDSWiQGROR D ODV QHcesidades de información y buscando la utilidad
SDUD OD SRVWHULRU HYDOXDFLyQ GHO FXPSOLPLHQWR
del contrato pactado.
Relación contractual
Entre la Dirección del Centro y el área o unidad
se establecerá un Contrato de Gestión Clínica en
HOTXHVHHVSHFL¿TXHQWDQWROD¿QDQFLDFLyQFRPR
ORV UHFXUVRV DGVFULWRV DVt FRPR ORV GLIHUHQWHV
REMHWLYRVTXHKDQGHHVWDUHQJOREDGRVGHQWURGHO
iPELWRGHO&RQWUDWRTXHHVWDEOH]FDHOHVWDEOHFLmiento sanitario y la administración sanitaria. Los
LQGLFDGRUHVUHFXUVRVFULWHULRV\PHWRGRORJtDGH
ODHYDOXDFLyQDVtFRPRORVLQFHQWLYRVOLJDGRVDO
FXPSOLPLHQWR GHO SURJUDPD VH H[SOLFLWDUiQ HQ
dicho contrato junto con sus posibles causas de
rescisión.
Dicho Contrato de Gestión Clínica será obMHWRGHXQDHYDOXDFLyQDQXDOFRQHO¿QGHGHWHUminar el grado de cumplimiento del mismo a los
efectos correspondientes.
Órganos de gobierno y gestión de las
Áreas o Unidades clínicas de gestión
/DVÈUHDVR8QLGDGHVFOtQLFDVGHJHVWLyQVHUiQ
JHVWLRQDGDVEDMROD'LUHFFLyQGHO&HQWUR6DQLWDULRHQHOTXHVHHQFXDGUHQSRUORVVLJXLHQWHV
órganos:
1. Director en el caso de Áreas clínicas
&RRUGLQDGRUHQHOFDVRGH8QLGDGHVFOtQLFDV
de gestión
&RPLVLyQGH'LUHFFLyQGHOÈUHDR8QLGDG
7 - Gestión clínica: una nueva forma de entender la gestión sanitaria / 157
Funciones de los responsables
SRQVDEOH GH OD DVLJQDFLyQ GH IXQFLRQHV
tareas y puestos de trabajo.
$XWRUL]DFLyQ GH¿QLFLyQ GHO SHU¿O \
selección del personal necesario para la
UHDOL]DFLyQ GHO WUDEDMR HQFRPHQGDGR
todo ello de acuerdo a las normas y criteULRVGHFRQWUDWDFLyQDFWXDOPHQWHYLJHQWHV
dentro del marco de la administración sanitaria autonómica.
3ODQL¿FDU OD FRQWUDWDFLyQ GHO SHUVRQDO
QHFHVDULRSDUDOOHYDUDFDERODDFWLYLGDG
GHQWURGHOiUHDRXQLGDGGHQWURGHOPDUco presupuestario asignado.
$XWRUL]DFLyQ GH SHUPLVRV OLFHQFLDV \
YDFDFLRQHVGHOSHUVRQDODGVFULWR
$GHFXDU GH OD HVWUXFWXUD DVLVWHQFLDO \ RUJDQL]DWLYDHQVXFRQMXQWRFRQHOREMHWLYRGH
JDUDQWL]DU HO FXPSOLPLHQWR GH ORV REMHWLYRV
TXHVHDQHVWDEOHFLGRVSRUODVDXWRULGDGHVVDnitarias.
(VWDEOHFHU KRUDULRV WXUQRV \ IXQFLRQHV D
GHVDUUROODUHQHOÈUHDR8QLGDGGHDFXHUGR
FRQORVREMHWLYRVH[SOLFLWDGRVHQHO&RQWUDWR
establecido con la Dirección del Centro.
3URSRQHUDOD'LUHFFLyQGHOFHQWURODFRQWUDWDFLyQ GH ELHQHV \ VHUYLFLRV SDUD OD XQLGDG UHVSHWDQGR OD QRUPDWLYD YLJHQWH \ OD
disponibilidad presupuestaria.
&XDOHVTXLHUD RWUDV IXQFLRQHV TXH OH VHDQ
H[SUHVDPHQWHHQFRPHQGDGDVGHVGHOD'LUHFción del Hospital.
El Director del Área clínica o el Coordinador de
OD8QLGDGFOtQLFDGHJHVWLyQGHVDUUROODUiQODVVLguientes funciones:
6HU HO Pi[LPR UHVSRQVDEOH GH OD DFWLYLGDG
GHVDUUROODGDHQHOiPELWRGHOiUHDRXQLGDG
HQ VXV YHUWLHQWHV DVLVWHQFLDO HFRQyPLFD \
DGPLQLVWUDWLYD FRQ¿JXUiQGRVH FRPR HO LQWHUORFXWRU DQWH OD GLUHFFLyQ GHO FHQWUR GLULgiendo y organizando el área o unidad.
&RPR VXSHULRU MHUiUTXLFR GH ORV -HIHV GH
6HUYLFLR R 6HFFLyQ DGVFULWRV DVXPLU HQ HO
PDUFRGHODQXHYDiUHDRXQLGDGFRQVWLWXLGD
las funciones de jefatura de todo el personal
TXH VH DGVFULED D HOOD FXDOHVTXLHUD VHDQ HO
HVWDPHQWR \ OD HVSHFLDOLGDG D ORV TXH SHUWHQH]FD VLQ SHUMXLFLR GH OD GLVWULEXFLyQ GH
IXQFLRQHV\UHVSRQVDELOLGDGHVTXHSRVWHULRUmente se pacten dentro de cada una de las
QXHYDVHVWUXFWXUDVGHJHVWLyQFOtQLFDTXHVH
crean mediante la presente legislación.
$VXPLUOD3UHVLGHQFLDGHOD&RPLVLyQGH'Lrección
3ODQL¿FDU\RUJDQL]DUODHVWUXFWXUDRUJDQL]DWLYDRULHQWDGDKDFLDODFRQVHFXFLyQGHORVREMHWLYRVDVLVWHQFLDOHVHFRQyPLFRV\RUJDQL]DWLYRV
TXHDVtVHH[SOLFLWHQHQHOFRQWUDWRHVWDEOHFLGR
cumpliendo y haciendo cumplir las directrices
TXHVHPDUTXHQGHVGHOD'LUHFFLyQGHO&HQWUR
'LVHxDUXQVLVWHPDGHHYDOXDFLyQTXHSHUPLWD OD PHGLFLyQ GH ORV UHVXOWDGRV REWHQLGRV
WDQWRDQLYHOJOREDOFRPRDQLYHOGHFDGDXQR Provisión del cargo de
GHORVPLHPEURVDGVFULWRVPHGLDQWHODFUHD- Director o Coordinador
FLyQHLPSODQWDFLyQSUHYLDGHXQVLVWHPDGH
LQIRUPDFLyQHIHFWLYR
/DSURYLVLyQGHOFDUJRGH'LUHFWRUR&RRUGL(VWDEOHFHU SURWRFRORV QRUPDV GH IXQFLRQDnador se efectuará por la Gerencia del centro
PLHQWRRFXDOTXLHURWUDPHGLGDTXHSHUPLWD
mediante el procedimiento de libre designauna mejora en los estándares de la atención
FLyQWUDVFRQYRFDWRULDHQODTXHVHHVSHFL¿FDrecibida por los pacientes.
UiWDQWRHOSHU¿OGHOSXHVWRFRPRODVFRPSH3DUWLFLSDUGHIRUPDHIHFWLYDHQHOGLVHxRGH
WHQFLDV\KDELOLGDGHVUHTXHULGDVTXHYDULDUiQ
ÀXMRV\RUJDQL]DFLyQGHODDWHQFLyQSUHVWDGD
en función del área o unidad; se efectuará una
FRQHVSHFLDOLPSOLFDFLyQHQODGHFLVLyQ¿QDO
YDORUDFLyQWDQWRGHOSUR\HFWRGHJHVWLyQFRPR
GHGHULYDFLyQGHSDFLHQWHVFRUUHVSRQGLHQWHV
GHORVPpULWRVTXHDSRUWHHODVSLUDQWH
al ámbito clínico-asistencial del área o uni/RVUHTXLVLWRVH[LJLEOHVSDUDHODFFHVRDOFDUGDGFRQREMHWR GH IDFLOLWDU OD DWHQFLyQ \OD
go de Director o Coordinador serán:
FRQVHFXFLyQGHORVREMHWLYRVSDFWDGRVHQHO
- Estar en posesión del título de alguna de
correspondiente contrato.
ODVHVSHFLDOLGDGHVTXHFRPSRQHQHOiUHD
(ODERUDUODVDFWLYLGDGHVDGHVDUUROODUHQPDclínica o la unidad de gestión
WHULDGHGRFHQFLDHLQYHVWLJDFLyQ
- Ostentar la condición de especialista
(QPDWHULDGHSHUVRQDOGHVDUUROODUi
FRQSOD]D¿MD
/D FRRUGLQDFLyQ GH ODV DFWLYLGDGHV GH (OQRPEUDPLHQWRVHHIHFWXDUiSRUHO*HUHQWRGR HO SHUVRQDO DGVFULWR VLHQGR HO UHVWHGHOFHQWURFRUUHVSRQGLHQWHXQDYH]YDOR-
158 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
rados los proyectos y los méritos aportados
/DV IXQFLRQHV GH OD &RPLVLyQ GH 'LUHFción son las siguientes:
por los candidatos.
/DV UHWULEXFLRQHV DVt FRPR ORV QLYHOHV GH D(VWDEOHFLPLHQWRGHODQRUPDWLYDGHIXQFLRnamiento interno
FRPSOHPHQWRGHGHVWLQR\HVSHFt¿FRVVHUiQ
E$SUREDFLyQ GH SURWRFRORV JXtDV \ FXDQWDV
ORVHTXLYDOHQWHVDXQ-HIHGH'HSDUWDPHQWR
normas se elaboren dentro del marco del área
5.Los Directores y Coordinadores podrán ser
o unidad
cesados libremente por la misma autoridad
c. Aprobación de los responsables de los difeTXH KD\D SURFHGLGR D HIHFWXDU VX QRPEUDUHQWHViPELWRVHQORVTXHVHHVWUXFWXUHIXQmiento.
FLRQDOPHQWHHOiUHDRXQLGDGDSURSXHVWDGHO
Director o Coordinador
La Comisión de Dirección
d. Aprobación de las acciones propuestas en
PDWHULDGHGRFHQFLDHLQYHVWLJDFLyQSUHYLRD
1. La Comisión de Dirección englobará:
su planteamiento y aprobación por la Direca. Director o Coordinador
ción del Centro
b. Coordinador de Enfermería
F-HIHVGHORVGLIHUHQWHV6HUYLFLRVHQHOFDVR e. Informe y aprobación del Contrato a establecer con la Dirección del Centro
GHOÈUHD\-HIHGH6HUYLFLR\GH6HFFLyQHQ
I,QIRUPHGHOD0HPRULDDQXDOGHDFWLYLGDG
HOFDVRGHOD8QLGDG
J 6HJXLPLHQWR GH OD DFWLYLGDG GHVDUUROODGD
G6XSHUYLVRUHVGHHQIHUPHUtD
introduciendo las medidas correctoras necee. Responsable de calidad
VDULDV TXH SRVLELOLWHQ OD FRQVHFXFLyQ GH ORV
I7XWRUHVGHUHVLGHQWHV
REMHWLYRVHVWDEOHFLGRV
J$FWXDUiFRPR6HFUHWDULRFRQYR]\VLQYRWR
K $VHVRUDPLHQWR FXDQGR DVt OR VROLFLWH GHO
un miembro elegido por el Director o CoorDirector o Coordinador
dinador
8
GESTIÓN PRESUPUESTARIA Y GESTIÓN
DE COSTES EN LA ORGANIZACIÓN1
INTRODUCCIÓN
/DDGPLQLVWUDFLyQRJHUHQFLDHQVHQWLGRODWRGH
ORVUHFXUVRV¿QDQFLHURVKDDGTXLULGRXQDLPSRUWDQFLDVXSHUODWLYDGHELGRDODQHFHVLGDGGHORJUDU
XQXVRH¿FLHQWHGHORVHVFDVRVUHFXUVRVGLVSRQLEOHVSDUDVROYHQWDUODVGHPDQGDVGHODSREODFLyQ
$XQFXDQGRODDGPLQLVWUDFLyQ¿QDQFLHUDLPSOLFD
XQDVHULHGHDFFLRQHVPX\HVSHFLDOL]DGDVHQOD
DFWXDOLGDGORVDGPLQLVWUDGRUHVGH6LVWHPDV/Rcales de Salud o Regiones Sanitarias deberían poder lidiar con un mínimo bagaje de conocimienWRVTXHOHVIDFLOLWHQODFRPSUHQVLyQ\HODQiOLVLV
GH ORV IHQyPHQRV D TXH GHEHQ HQIUHQWDUVH ORV
apoyen en la toma de decisiones y les permitan
LQWHJUDUODJHVWLyQJOREDO/DJHUHQFLD¿QDQFLHUD
debe percibirse entonces como un componente
inseparable de la administración integral de los
VHUYLFLRV GH VDOXG (VWi PX\ YLQFXODGD FRQ HO
TXHKDFHUSRUFXDQWRORVUHFXUVRV¿QDQFLHURVVRQ
ODEDVHSHURDODYH]\SDUDGyMLFDPHQWHHOIDFWRU
OLPLWDQWHGHORVSURJUDPDV\ODVDFFLRQHVTXHVH
SXHGHQHMHFXWDUGHOiPELWRGHORSRVLEOHHQGH¿QLWLYD(QXQDGHFXDGRSURFHVRJHUHQFLDOGHORV
VHUYLFLRVGHVDOXGDSDUWLUGHOGLDJQyVWLFRGHOD
VLWXDFLyQVDQLWDULDGHODFRPXQLGDGVHGHEHUtDQ
GLVHxDUODVLQWHUYHQFLRQHVUHTXHULGDVTXHHQFRQMXQWRFRQVWLWX\HQHOSODQGHDFFLyQSDUDHQIUHQWDU
ORVSUREOHPDVLGHQWL¿FDGRV8QDYH]HVWUXFWXUDGRHOSURJUDPDGHDFWLYLGDGHVHVQHFHVDULRFXDQWL¿FDUWRGRVORVUHFXUVRVTXHKDUtDQIDOWDSDUDVX
operacionalización. El costo estimado para cada
XQRGHORVUHFXUVRVHQODFDQWLGDGUHTXHULGDHVOD
EDVH SDUD OD IRUPXODFLyQ GHO SUHVXSXHVWR FX\R
SURGXFWR¿QDOHVXQFXDGURGHQHFHVLGDGHV¿QDQcieras por rubro.
/D DGPLQLVWUDFLyQ ¿QDQFLHUD LQYROXFUD XQD
VHULHGHDVSHFWRVFX\RREMHWLYRJOREDOHVSURFXUDUVRSRUWHHFRQyPLFRSDUDTXHVHHMHFXWHQFRQ
H¿FLHQFLD ORV SURJUDPDV UHTXHULGRV SRU OD SRblación. Los componentes de la administración
¿QDQFLHUDVRQ
‡*HVWLyQGHLQJUHVRV
‡$VLJQDFLyQGHUHFXUVRV
‡*HVWLyQSUHVXSXHVWDULD
‡&RQWDELOLGDGJHQHUDO
‡&RQWDELOLGDGGHFRVWRV
‡)LMDFLyQGHSUHFLRV
‡(YDOXDFLyQ¿QDQFLHUD
/DJHVWLyQGHLQJUHVRVVHRFXSDGHODLGHQWL¿FDFLyQGHQXHYDVIXHQWHVGHLQJUHVRV\ODPD[LPLzación de las conocidas. Es un aspecto muy imSRUWDQWHHQODJHUHQFLDSRUTXHFRPRVHFRPHQWy
ORVUHFXUVRV¿QDQFLHURVVXHOHQVHUHOIDFWRUOLPLWDQWHHQODHQWUHJDGHVHUYLFLRVGHVDOXG3RUHVR
HVQHFHVDULRFRQRFHUODVIXHQWHVGHLQJUHVRVTXH
HVWiQ RSHUDQGR OD LPSRUWDQFLD UHODWLYD GH FDGD
XQDGHHOODVVXVSRWHQFLDOLGDGHVSHURDGHPiVVH
UHTXLHUH LGHQWL¿FDU IXHQWHV DOWHUQDWLYDV TXH SHUPLWDQ¿QDQFLDUDTXHOORVSURJUDPDVTXHQRFXHQtan con los recursos o hacer frente a las situacio-
Capítulo basado en parte en el Manual de Capacitación de Administración Financiera para Hospitales Descentralizados – Manual de Capacitación 5 – *HVWLyQ(VWUDWpJLFDSDUDODRSWLPL]DFLyQGHODDFFHVLELOLGDGH¿FLHQFLD\
calidad de la atención en los hospitales públicos de autogestión, .
1
160 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
QHV LPSUHYLVWDV FRPR SRGUtDQ VHU OD DSDULFLyQ
GHXQEURWHHSLGpPLFRHODUUHJORRUHFDPELRGH
HTXLSDPLHQWR LQGLVSHQVDEOH R OD VDWLVIDFFLyQ GH
QHFHVLGDGHV VDQLWDULDV HQ QXHYRV JUXSRV GH SREODFLyQ HVWRHVSRUHMHPSORODLPSOHPHQWDFLyQ
GHXQQXHYRSURJUDPDGHVDOXG La asignación de recursos es el proceso meGLDQWHHOTXHODVDXWRULGDGHVVDQLWDULDVGHOQLYHO
central o regional determinan los montos de reFXUVRV ¿QDQFLHURV TXH VH YDQ D DVLJQDU D FDGD
XQRGHORVSURJUDPDVSXGLHQGRXWLOL]DUVHSDUD
HVWR GLIHUHQWHV FULWHULRV FRPR HO FRVWR GH ODV
LQWHUYHQFLRQHVODLPSRUWDQFLDSROtWLFDGHOSURJUDPDRUHJLyQODSULRULGDGDVLJQDGDHQHOSODQ
entre otros.
/DYDORUDFLyQPRQHWDULDGHOSODQGHDFFLyQ
\HOSURJUDPDRSHUDWLYRGDQFRPRUHVXOWDGROD
formulación del presupuesto de operación e inYHUVLyQ SRU OR TXH pVWH FRQVLVWH HQ XQ OLVWDGR
RUGHQDGR GH ORV UHFXUVRV HFRQyPLFRV UHTXHULGRV SDUD DGTXLULU ORV LQVXPRV QHFHVDULRV (VWH
FRPSRQHQWHLQYROXFUDWDPELpQODDSOLFDFLyQGH
HVRVUHFXUVRVSDUDODDGTXLVLFLyQGHORVLQVXPRV
\HOFRQWUROTXHJDUDQWLFHXQDJHVWLyQ¿QDQFLHUD
transparente. Estos tres subcomponentes constituyen la gestión presupuestaria.
&DGD XQR GH ORV PRYLPLHQWRV ¿QDQFLHURV
TXHVHSURGXFHQGXUDQWHODHMHFXFLyQGHOSUHVXpuesto debe ser registrado en la partida o cuenta
FRUUHVSRQGLHQWHVXPDQGRDOUHQJOyQGHJDVWRV
el monto utilizado y restando al saldo esa misma
VXPD (VWR HV GH IRUPD PX\ VLQWpWLFD OR TXH
se conoce como el principio básico de la contabilidad general. En la producción de un deterPLQDGRVHUYLFLR FRQVXOWDRHJUHVRKRVSLWDODULR
SRUHMHPSOR VHXWLOL]DQXQDVHULHGHHOHPHQWRV
TXH WLHQHQ XQ FRVWR /D FRQWDELOLGDG GH FRVWRV
consiste en establecer cuánto cuesta cada uno
GH HOORV FRQ HO ¿Q GH GHWHUPLQDU HO FRVWR WRWDO
GHOVHUYLFLREULQGDGR(véase más detallado más
adelante en este mismo capítulo).
$SDUWLUGHOFRVWRGHXQVHUYLFLRVHSXHGH¿MDUVXSUHFLRDOXVXDULR RDO¿QDQFLDGRU±UHFXpUGHVHTXHVLHPSUHDOJXLHQSDJDODFXHQWD VLDOD
FLIUDGH¿QLGDHQHOFRVWHRVHOHDGLFLRQDQRWURV
factores como el margen de ganancia. Adicionalmente se deben estudiar las condiciones del
PHUFDGRFRQHOSURSyVLWRGHVHUFRPSHWLWLYRV
/D¿MDFLyQGHORVSUHFLRVGHORVVHUYLFLRVHVPX\
~WLOVLVHSLHQVDHQGLYHUVL¿FDUODVIXHQWHVGHLQJUHVRVSRUHMHPSORODVYHQWDVGHVHUYLFLRV/D
HYDOXDFLyQ ¿QDQFLHUD LQWHJUD HO SURFHVR ¿QDQciero con los otros componentes de la gestión.
3XHGHHQIRFDUVHGHVGHYDULDVSHUVSHFWLYDVHQWUH
ODVTXHVHPHQFLRQDQ
Ļ&RPSDUDFLyQGHOSUHVXSXHVWRGHLQJUHVRV
FRQ ORV LQJUHVRV HIHFWLYRV Ļ FRPSDUDFLyQ GHO
presupuesto de gastos con las erogaciones efecWXDGDVĻFRPSDUDFLyQGHORVJDVWRVFRQHOQLYHO
GH SURGXFFLyQ DOFDQ]DGR Ļ GHWHUPLQDFLyQ GH
GLYHUVDVYDULDFLRQHV\VXVFDXVDVĻDQiOLVLVGH
HVWDGRV¿QDQFLHURVGHUD]RQHV¿QDQFLHUDVHWF
(VWHFRPSRQHQWHGHODJHUHQFLD¿QDQFLHUDEXVFDLGHQWL¿FDUHUURUHVXRPLVLRQHVDVtFRPRVXV
FDXVDV\FRQVHFXHQFLDVSDUDDSR\DUHOSURFHVR
de toma de decisiones en la operacionalización
GHPHGLGDVFRUUHFWLYDV\HQHOHVWDEOHFLPLHQWR
de ajustes en las fases del proceso.
Si la gerencia estratégica es una necesidad en
ODJHVWLyQGHORVVHUYLFLRVGHVDOXGHOHQIRTXHHVWUDWpJLFRHQODDGPLQLVWUDFLyQ¿QDQFLHUDUHVXOWD
LPSUHVFLQGLEOHSDUDJDUDQWL]DUHO¿QDQFLDPLHQWR
DFRUWRPHGLDQR\ODUJRSOD]RGHORVVHUYLFLRV\
HOPD\RULPSDFWRSRVLEOHFRQUHFXUVRVTXHFUHFHQHQPHQRUSURSRUFLyQTXHODVQHFHVLGDGHV(O
HQIRTXHHVWUDWpJLFRGHODJHUHQFLD¿QDQFLHUDLPSOLFDODPD[LPL]DFLyQGHORVLQJUHVRVWUDGLFLRQDOHV\HOGHVDUUROORGHIXHQWHVQRWUDGLFLRQDOHV
ODGHVEXURFUDWL]DFLyQODLQFRUSRUDFLyQGHWRGRV
ORVDFWRUHV\HOHVWXGLRGHWRGDVODVYDULDEOHVTXH
LQFLGHQ HQ OD DGPLQLVWUDFLyQ ¿QDQFLHUD /D DGPLQLVWUDFLyQ¿QDQFLHUDHQORVVHUYLFLRVGHVDOXG
es el resultado de la interacción dinámica entre
XQD VHULH GH YDULDEOHV LQWHUQDV \ H[WHUQDV D OD
LQVWLWXFLyQSRUORTXHSDUDEULQGDUXQHQIRTXH
HVWUDWpJLFRDODJHUHQFLD¿QDQFLHUDHVQHFHVDULR
GHVDUUROODU XQ SURFHVR DQDOtWLFR GHWDOODGR TXH
VHLQLFLDFRQXQHVWXGLRGHOHQWRUQR FRQGLFLRQHV HFRQyPLFDV SROtWLFDV VRFLDOHV \ GH VDOXG
HQWUHRWURVDVSHFWRV FX\RpQIDVLVSULPRUGLDOHV
determinar las necesidades y los grupos prioritaULRVODLQÀXHQFLDTXHODVYDULDEOHV\ORVDJHQWHV
±WDQWR LQWHUQRV FRPR H[WHUQRV± SXHGHQ WHQHU
VREUHODV¿QDQ]DVHLGHQWL¿FDUIXHQWHVDOWHUQDWLYDVRFRPSOHPHQWDULDVGHLQJUHVRV(QVHJXQGR
OXJDU HV YLWDO FRQRFHU OD VLWXDFLyQ UHODFLRQDGD
FRQ ODV SHUVSHFWLYDV IXWXUDV \ OD FRPSHWHQFLD
WDQWRWHFQROyJLFDFRPRGHSUHVWDFLyQGHVHUYLcios. Posteriormente es importante realizar un
GLDJQyVWLFRGHODVFDSDFLGDGHVGHSURGXFFLyQOD
H¿FLHQFLDORVFRVWRV\ODFDOLGDGGHORVVHUYLFLRV
TXHVHEULQGDQHQODVLQVWLWXFLRQHVTXHFRPSRQHQHO6,/26ROD5HJLyQ6DQLWDULDFRQHO¿Q
GH FRQRFHU ODV IRUWDOH]DV RSRUWXQLGDGHV GHELOLGDGHV\DPHQD]DVTXHSXHGHQLQFLGLUSRVLWLYD
RQHJDWLYDPHQWHHQODVLWXDFLyQ¿QDQFLHUD HVWR
8 - Gestión presupuestaria y gestión de costos en la organización / 161
Simple y estable o completo y turbulento
¿qué tipo de cambios tecnológicos, económicos,
de mercado, laborales o socio políticos han ocurrido.
¿Algún cambio creará nuevas oportunidades?
R
NA ECU
TU RS
RA OS
LE
S
NATURALEZA
DEL ENTORNO
Es burocrática o de matriz orgánica.
¿Cúal es la filosofía de dirección?
Se estimula a los empleados
COMPETIDOR A
COMPETIDOR B
¿La organización ha adoptado alguna estrategia
o simplemente está reaccionando ante cualquier cambio?
¿La organización analiza sistemáticamente su entorno?
COMPETIDOR C
¿CÓMO ESTÁ ESTRUCTURADA,
QUÉ TIPO DE EMPLEADOS
TIENE Y CUÁL ES SU CULTURA?
ES
UTILIDADES
BENEFICIOS
SUPERVIVENCIA EN DEFINITIVA
CI
SF
AC
AN
M
HU
IO
BR O
LI IC
UI ÓG
EQ COL
E
SA
TI
AS
ON
¿QUÉ TIPO DE ESTRATEGIA
ESTÁ EMPLEANDO?
¿QUÉ TIPO DE
TECNOLOGÍA TIENE?
¿Están normalizados los procesos de trabajo?
¿Qué opción tecnológica ha adoptado la organización?
Figura 8.1: Cómo hace la organización para estar en forma
HVXQDPDWUL]GHLPSDFWRRPDWUL])2'$ &DGD
administrador público de un establecimiento de
VDOXG GH XQ 6,/26 R GH XQD UHJLyQ VDQLWDULD
GHEHLQWHJUDUODSODQL¿FDFLyQHVWUDWpJLFD\¿QDQFLHUDSDUDFRQIHULUDOSODQUHVXOWDQWHXQHQIRTXH
HVWUDWpJLFR 3DUD KDFHUOR GHEH WHQHU SUHVHQWHV
de modo permanente tres aspectos:
(O SODQ HVWUDWpJLFR \ OD IRUPXODFLyQ GHO
presupuesto son responsabilidad directa del
JHUHQWHSRUORWDQWRpOGHEHSDUWLFLSDUDFWLYDPHQWHHQDPERVDVSHFWRVFRPRSDUWHGH
la gerencia superior.
(O SODQ HVWUDWpJLFR GHEH SUHFHGHU D OD IRUmulación presupuestaria y responder a las
necesidades de la población.
(O SUHVXSXHVWR GHEH VHU FRQFHELGR FRPR
XQDFRQFUHFLyQ¿QDQFLHUDGHOSODQHVWUDWpJLco y como un aliado de la operación de los
programas.
gerente analiza toda la información disponible
SDUD H[SOLFDUVH ORV HYHQWRV DFWXDOHV \ SDVDGRV
pero también para proyectar el futuro. Con esta
LQIRUPDFLyQGHWHUPLQDODVYDULDFLRQHVRFXUULGDV
\HODERUDPHGLGDVFRUUHFWLYDV\SUHYHQWLYDVGHFLGHLPSOHPHQWDUODVTXHSDUHFHQPiVDGHFXDGDV
ODVRSHUDFLRQDOL]D\FRQWURODHOUHVXOWDGRQXHYDPHQWHPHGLDQWHODLQIRUPDFLyQTXHUHFRSLOD
/RV IDFWRUHV DQDOL]DGRV SRU 3RUWHU TXH VH
PXHVWUDQHQOD)LJXUDGHWHUPLQDQODVXSHUYLYHQFLDGHODHPSUHVDHQFDGDVHFWRUTXHVHFRQVLGHUH HOKRVSLWDOHVDTXtXQDH[FHSFLyQ\DTXH
FRPRFRPHQWDPRVHQRWUDSDUWHVHWUDWDGHXQD
LQVWLWXFLyQ LQPRUWDO SXHV VL ELHQ SXHGH FHUUDU
QR TXLHEUD HV GHFLU QR GHVDSDUHFH GHO VHFWRU
QXQFDSRUPRWLYRVGHXQDPDODJHVWLyQ GESTIÓN DEL PRESUPUESTO
5HFXpUGHQVH HQ HVWH FRQWH[WR ODV FRQGLFLRnes de una organización para estar en forma Es inherente a todas las organizaciones elaborar
SXHGHFRQVXOWDUVHSRUHMHPSORD3RUWHU SODQHVSDUDXQSHUtRGRGH¿QLGR\HOHJLUHOPHMRU
PpWRGRSDUDKDFHUORVUHDOLGDG([LVWHQGLIHUHQUHVXPLGDVHQOD)LJXUD
FLDVFRQVLGHUDEOHVHQODIRUPDGHSODQL¿FDUDO/DLQIRUPDFLyQ¿QDQFLHUDHVSLODUIXQGDPHQ- JXQRVIRUPXODQVXVSODQHVVLQTXHWUDVFLHQGDQD
WDOHQHOSURFHVRGHWRPDGHGHFLVLRQHVSXHVHO ODHVIHUDLQWHOHFWXDORWURVKDFHQUHJLVWURV\HVWL-
162 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
NUEVOS
PARTICIPANTES
BARRERAS PARA LA ENTRADA
Economías de escala
Diferencias de producto de marca
Identidad de marca
Traslación de costos
Requerimiento de capital
Acceso a la distribución
AMENAZA
Ventajas absolutas en costos
DE NUEVOS
Curva registrada de aprendizaje
PARTICIPANTES
Acceso a insumos necesarios
Diseño de un producto registrado de bajo costo
Política de gobierno
Represalia esperada
CAPACIDAD DE NEGOCIACIÓN
DE PROVEEDORES
COMPETIDORES
EN LA INDUSTRIA
PROVEEDORES
DETERMINANTES DE LA RIVALIDAD
Crecimiento de la industria
Valor agregado por costos fijos (o de almacenaje)
Exceso de capacidad intermitente
Diferencias en el producto
Identidad de marca
Traslación de costos
Concentración y equilibrio
Complejidad informática
Diversidad de competidores
Intereses corporativos
Barreras para la salida
CAPACIDAD DE NEGOCIACIÓN
DE COMPRADORES
COMPRADORES
INTENSIDAD
DE LA RIVALIDAD
DETERMINANTES DEL PODER DEL PROVEEDOR
Diferenciación de insumos
Traslación de costos de proveedores
y empresas en la industria
Presencia de insumos sustitutivos
Concentración de proveedores
Importancia del volumen para el proveedor
Costos respecto de compras totales en la industria
Impacto de los insumos en el costo
o en la diferenciación
Amenaza de integración ascendente
respecto a la descendente por empresas de la industria
DETERMINANTES DEL PODER DEL COMPRADOR
AMENAZA
DE SUSTITUTOS
Apalancamiento de la negociación
Concentración de compradores frente
a concentración de empresas
Volumen del comprador
Traslación de costos del comprador
respecto de la empresa
Información del comprador
Capacidad para la integración descendente
Productos sustitutivos
Sacar apuros
Sensibilidad de precios
Precio total de compras
Diferencias de producto
Identidad de marca
Impacto en el rendimiento
de la calidad
Beneficios del comprador
Incentivos de los decisores
SUSTITUTOS
Figura 8.2: Factores que determinan la permanencia de las empresas en el mercado (tomado de Porter, 2000)
PDFLRQHVVLQDSOLFDUWpFQLFDVFLHQWt¿FDVYDULRV
H[SUHVDQVXVSODQHVHQWpUPLQRVFXDQWLWDWLYRV\
los elaboran en forma ordenada y sistemática.
3HURWRGRVGHEHQH[SUHVDUORVSODQHVTXHHODERUDURQHQWpUPLQRVGHODFDQWLGDGGHUHFXUVRVTXH
UHTXLHUHQSDUDHMHFXWDUORV\HVWRVHFRQRFHFRQ
el nombre de formulación de presupuesto.
El presupuesto no es una simple lista de inJUHVRV \ JDVWRV TXH VH SUHVHQWDQ HQ XQ IXWXUR
FHUFDQR\FLHUWDPHQWHSDVyPXFKDDJXDGHEDMR
GHOSXHQWHGHVGHODIRUPDGHSUHVXSXHVWDUTXHVH
PXHVWUDHQOD)LJXUDGHOOLEURGHAdministración SanitariaGHO'U3HQQDFRUUHVSRQGLHQWH
DOSHUVRQDOGHO+RVSLWDO$UJHULFKGH
(O FRQFHSWR PRGHUQR VXSRQH TXH GHWUiV GH
XQDWDOQyPLQDGHLQJUHVRV\JDVWRVH[LVWHalgo
XQ SODQ GH DFFLyQ FX\R SURGXFWR ¿QDO VRQ ORV
VHUYLFLRVTXHVHEULQGDQDODFRPXQLGDG\PiV
DOOi\HQ~OWLPDLQVWDQFLDHOLPSDFWRORJUDGRHQ
las condiciones de salud. El presupuesto en su
concepción actual es un plan escrito con deterPLQDFLyQGHREMHWLYRV\PHWDVHODERUDGRLQGLFDQGRODVXQLGDGHVHMHFXWRUDVODVSUR\HFFLRQHV
GHLQVXPRVQHFHVDULRV\HOFRVWRSUHYLVWRGHORV
PLVPRVSDUDXQSHULRGRGHWHUPLQDGRRHQXQD
FRQFHSFLyQPiVDPSOLDODH[SUHVLyQ¿QDQFLHUD
GHODSODQL¿FDFLyQ
Cuando un SILOS o región sanitaria efectúa
VXSODQL¿FDFLyQUHTXLHUHGHXQHVWXGLR\XQDLQYHVWLJDFLyQFRQFLHQ]XGDORTXHQRVyORSHUPLWLUiTXHVHDOFDQFHQODVPHWDVGHWHUPLQDGDVHQORV
SODQHVVLQRTXHWDPELpQFUHDUiHQORVVLVWHPDV
ORFDOHVGHVDOXGHOKiELWRGHOOHYDUDFDERXQD
FDQWLGDGUD]RQDEOHGHLQYHVWLJDFLyQ\GHHVWXGLR
antes de tomar decisiones.
(QUHVXPHQVHSXHGHGHFLUTXHHOSUHVXSXHVWR WLHQGH R GHEHUtD DO PHQRV D IDFLOLWDU \ VXVtentar un adecuado y fructífero ejercicio de toma
de decisiones. Los puntos de interés dentro de la
LQYHVWLJDFLyQSUHVXSXHVWDOUDGLFDQHQHOIXWXURGH
ODRUJDQL]DFLyQ\ODVFRQGLFLRQHVHQODVTXHGHEHQRSHUDU'HHVWHPRGRODDGPLQLVWUDFLyQGHXQ
8 - Gestión presupuestaria y gestión de costos en la organización / 163
Figura 8.3: Presupuesto mensual del personal del Hospital Argerich, 1909. Se lee con claridad: director de sección (médico), médico de primeros auxilios, administrador (como se ve, la historia del administrador en el hospital data de antiguo), auxiliar, farmacéutico, ayudante de farmacia, 2 practicantes mayores, 2 enfermeros, cabo
de cirugía, correo y portero, mucamo y peón (actual mantenimiento), dos cocheros (actual ambulanciero), un
cochero, todo por un total de $1.825 al mes. Tomado de: La Administración Sanitaria y Asistencia Pública de la
Ciudad de Buenos Aires, José Penna y Horacio Madero. Estudio de los Servicios de Higiene y Asistencia Pública, desde la época colonial hasta el presente. Publicación Oficial. Buenos Aires. Imprenta, litografía y encuadernación de G Kraft 1910. [ejemplar facilitado por la Biblioteca de la Facultad de Medicina de la UBA]
6,/26R5HJLyQFHQWUDVXDWHQFLyQHQORVHYHQtos futuros y en las oportunidades y amenazas en
ODVTXHGHEHQRSHUDUODVLQVWLWXFLRQHVDVXFDUJR
6LQHPEDUJRFRQIUHFXHQFLDODVSUHVLRQHVGHORV
SUREOHPDVFRWLGLDQRVUHIHUHQWHVDODVDFWLYLGDGHV
GH XQ 6,/26 WLHQGHQ D VHU SULRULWDULDV GHMDQGR
HQVHJXQGRQLYHOODSODQL¿FDFLyQ FRPRVXHOHGHFLUVHORXUJHQWHQRGHMDWLHPSRDORLPSRUWDQWH Los presupuestos pudieran contrabalancear esta
WHQGHQFLDIRUPDOL]DQGRHOSURFHVRGHSODQHDFLyQ
\ORJUDQGRTXHHVWHSURFHVRVHDXQDUHVSRQVDELOLGDGH[SOLFLWDGHORVDGPLQLVWUDGRUHV
(OSUHVXSXHVWRVHUH¿HUHDXQDDFWLYLGDGRD
XQFRQMXQWRGHHOODVDODRSHUDFLyQGHXQDHPSUHVDLQVWLWXFLyQRDXQDDJUXSDFLyQGHODVPLVPDV
\ D XQ SHUtRGR GHWHUPLQDGR GH PDQHUD TXH XQ
presupuesto sin esos referentes no tiene sentido.
'HELGRDTXHXVXDOPHQWHWRGDVODVDFWLYLGDGHVHFRQyPLFDVHVWiQUHJLGDVSRUHOSHUtRGR¿VFDOHOODSVRGHWLHPSRFRQYHQLHQWHSDUDHODERUDU
XQSUHVXSXHVWRHVXQDxRSRUORTXHODPD\RUtD
GHODVRUJDQL]DFLRQHVWDQWRHVWDWDOHVFRPRSULYDGDV SUHSDUDQ VXV SUHVXSXHVWRV DQXDOPHQWH
Durante el período presupuestario se realiza un
PRQLWRUHRIUHFXHQWHGHODJHVWLyQ\GHDFXHUGR
DORVUHVXOWDGRVVHUHYLVDHOSUHVXSXHVWRRULJLQDOGHIRUPDSHULyGLFDFRQHO¿QGHUHDOL]DUORV
ajustes necesarios. EI ejercicio presupuestario
VH GLYLGH SRU PHVHV VLHQGR FDGD XQR GH HOORV
el período básico para comparar lo real y lo
SUHVXSXHVWDGR(VQHFHVDULRUHVDOWDUTXHODIXQción básica de los presupuestos es su utilización
como instrumento de control de la gestión.
Los presupuestos se formulan y ejecutan
con base en una serie de instrucciones y en un
intercambio de estudios y decisiones adoptadas
HQGLIHUHQWHVQLYHOHVGHFRPSHWHQFLDGHODRUJDQL]DFLyQDWUDYpVGHOSHUtRGRSUHVXSXHVWDULROR
TXHFRQIRUPDHOciclo presupuestal.
Se pueden diferenciar etapas en lo referente
D OD SHULRGLFLGDG GH ODV DFWLYLGDGHV TXH LQYROXFUDHOSUHVXSXHVWRVLQHPEDUJRODODERUSUHVXSXHVWDULD VH FRQVWLWX\H HQ XQ DFWR FRQWLQXR
SXHVWRTXHODHMHFXFLyQHQHOWLHPSRREOLJDUHDOL]DUQXHYRVFiOFXORVGHPDQHUDFRQVWDQWHTXH
DGTXLHUHQ OD IRUPD GH WUDVSDVRV GH UHFXUVRV \
UHFWL¿FDFLyQGHODVPHWDVDQXDOHV
La preparación del presupuesto para el peUtRGRVLJXLHQWHUHTXLHUHFLHUWDVSUHYLVLRQHVTXH
SXHGHQFRQWULEXLUDPRGL¿FDUODVGHFLVLRQHVTXH
deben tomarse en el curso de la gestión del preVXSXHVWRTXHVHHMHFXWD
A pesar de la interdependencia y simultaneidad
GHODVIDVHVGHOFLFORSUHVXSXHVWDULRVHSXHGHQGLVtinguir los siguientes cuatro componentes:
‡)RUPXODFLyQGHOSUHVXSXHVWR
‡'LVFXVLyQ\DSUREDFLyQ
‡(MHFXFLyQ
‡&RQWURO\HYDOXDFLyQ
El proceso de elaborar presupuestos es la traGXFFLyQHQUHFXUVRV¿QDQFLHURVGHORVREMHWLYRV
FRQFUHWRVGHXQ6,/26XQDUHJLyQRXQVLVWHPD
TXHVHIRUPXODQDSDUWLUGHORVJOREDOHVUHÀHMDGRV HQ ODV SROtWLFDV JXEHUQDPHQWDOHV GH ORV
0LQLVWHULRVR6HFUHWDUtDVGH6DOXGLQVWLWXFLRQHV
DXWyQRPDV R HQWLGDGHV SULYDGDV FRQVLJQDGRV
en los planes de mediano y largo plazo. Cada
entidad de las mencionadas orienta sus prograPDVDORJUDUHVRVREMHWLYRVGHDFXHUGRDODVQH-
164 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
FHVLGDGHVGHODSREODFLyQSRUORTXHODHWDSDGH
formulación presupuestaria se puede segregar
HQGRVIDVHVODH[WHUQD\ODLQWHUQD
Fase externa: En ella se determina la
VXERUGLQDFLyQODVXEVXPLVLyQ\ODFRQJUXHQFLD
de los planes y los correspondientes proyectos
GHSUHVXSXHVWRFRQORHVWDEOHFLGRSRUODVSROtWLFDV/DVSULRULGDGHVHOYROXPHQGHOJDVWRS~EOLFR\VXGLVWULEXFLyQVHFWRULDOVRQLQIRUPDFLRQHV
preponderantes para elaborar el proyecto de presupuesto y están determinadas en gran medida
por la política económica y social.
Fase interna: )XQGDPHQWiQGRVHHQODSROtWLFDJHQHUDOHQHOSODQVHFWRULDO\HQODVDXWRUL]DFLRQHVGHJDVWRVSUHOLPLQDUHV±DORVTXH
deben ajustarse para la preparación de presupuestos todas las entidades públicas– se reali]DODDSHUWXUDGHODVFDWHJRUtDVSURJUDPiWLFDV
TXHGHEHQH[SUHVDUODWRWDOLGDGGHODVDFFLRQHV
TXHUHTXLHUHQDXWRUL]DFLRQHVSUHVXSXHVWDULDV
Con el establecimiento de los programas VH
GHILQHH[SOtFLWDPHQWHHOiPELWRGHRSHUDFLyQ
GHFDGDLQVWLWXFLyQ\DODYH]ODFRPSHWHQFLD
DGPLQLVWUDWLYDGHODVXQLGDGHVHQFDUJDGDVGH
su ejecución.
([LVWHQYDULRVPpWRGRVSDUDIRUPXODUHOSUHsupuesto; a continuación se mencionan los más
utilizados.
([SUHVLyQHQWpUPLQRV¿QDQFLHURV el presupuesto debe ser representado en la unidad moQHWDULDYLJHQWH
Información de operaciones: uno de los
propósitos fundamentales del presupuesto es la
GHWHUPLQDFLyQGHORVLQJUHVRVTXHVHREWHQGUiQ
DVtFRPRORVJDVWRVTXHVHYDQDSURGXFLU
Determinación de recursos: además de deWHUPLQDUORVLQJUHVRV\ORVJDVWRVGHOIXWXUROD
organización debe planear los recursos necesarios para realizar los proyectos de operación.
Presupuesto base cero
(QODDFWXDOLGDGXQDGHODVWpFQLFDVTXHKDFREUDdo mayor importancia para facilitar a la administración su labor de efectuar una correcta asignaFLyQ GH UHFXUVRV HV OD GHQRPLQDGD presupuesto
base cero. Consiste en un procedimiento mediante
HOTXHODDGPLQLVWUDFLyQDOHMHFXWDUHOSUHVXSXHVWRDQXDOWRPDODGHFLVLyQGHDVLJQDUORVUHFXUVRV
GHVWLQDGRVDiUHDVLQGLUHFWDVGHODRUJDQL]DFLyQGH
WDOIRUPDTXHHQFDGDXQDVHGHPXHVWUHTXHHOEHQH¿FLRJHQHUDGRHVPD\RUTXHHOFRVWRHQHOTXHVH
KDLQFXUULGR(QVtQWHVLVHVWDWpFQLFDSDUWHGHOVXSXHVWRTXHQRLPSRUWDODDFWLYLGDGTXHVHGHVDUUROOHPXFKRWLHPSRDQWHVVLQRMXVWL¿FDVXEHQH¿FLR
GHEHHOLPLQDUVHHVGHFLUTXHWRGDDFWLYLGDGGHEH
HVWDUVXMHWDDODQiOLVLVFRVWREHQH¿FLR(VWDKHUUDPresupuesto maestro
PLHQWDREOLJDDORVJHUHQWHVDMXVWL¿FDUPHGLDQWH
XQ DQiOLVLV FRVWREHQH¿FLR FXDOTXLHU LQFUHPHQWR
El presupuesto es un plan integrador y coordina- GHVXVDFWLYLGDGHV\DGHPiVORVFRPSURPHWHDMHGRTXHVHH[SUHVDHQWpUPLQRV¿QDQFLHURVUHV- UDUTXL]DUODVDFWLYLGDGHVGHDFXHUGRFRQHOEHQH¿SHFWR GH ODV RSHUDFLRQHV \ UHFXUVRV TXH IRUPD cio y su importancia para la organización y para la
parte de una organización para un período deter- SREODFLyQXVXDULDGHORVVHUYLFLRV
PLQDGRFRQHO¿QGHORJUDUODVPHWDVLQVWLWXFLRLa aplicación de la metodología del presuQDOHV7LHQHODVVLJXLHQWHVFDUDFWHUtVWLFDV
SXHVWREDVHFHURHVXQDVHFXHQFLDTXHHVWiDSR3ODQL¿FDGRVLJQL¿FDTXHHOSUHVXSXHVWRH[- yada en la siguiente estructura lógica:
SUHVDORTXHVHSURFXUDUiUHDOL]DUGHWDOPDQHUD
TXHODRUJDQL]DFLyQORJUHXQFDPELRDVFHQGHQWH
1. Se deben establecer los supuestos o premien un período.
VDVHQODVTXHGHVFDQVDUiODSODQL¿FDFLyQ(VGHIntegrador: toma en cuenta todas las áreas y FLUFRQVLVWHHQTXHODRUJDQL]DFLyQGLFWHODVQRUDFFLRQHVGHODRUJDQL]DFLyQ(VXQSODQYLVWRFRPR PDVRSDXWDVHQODVTXHVHVXVWHQWDODSODQL¿FDXQWRGRSHURWDPELpQHVWiGLULJLGRDFDGDiUHDGH FLyQGXUDQWHHVWHSHUtRGRWDOHVFRPRUHVWULFFLyQ
WDOPDQHUDTXHFRQWULEX\DDOORJURGHORVREMHWLYRV GHUHFXUVRVKXPDQRVRHFRQyPLFRV\VHWRPHHQ
JOREDOHVGHVGHXQDSHUVSHFWLYDKROtVWLFD
FRQVLGHUDFLyQ TXH OD LQVWLWXFLyQ HV SDUWH GH XQ
Coordinado: los planes de los diferentes de- VLVWHPDPDFURHFRQyPLFRHQHOTXHGHEHWHQHUVH
partamentos de la organización deben ser prepa- en cuenta el crecimiento del producto nacional
UDGRVHQDUPRQtDFRQORVGHORVRWURVGHPDQHUD EUXWRHOFUHFLPLHQWRGHOVHFWRUDTXHSHUWHQHFH\
TXHQRVHSURGX]FDQGXSOLFLGDGHVFRQWUDGLFFLR- HOQLYHOGHLQÀDFLyQTXHVHHVSHUDHQHOSDtV
QHVRYDFtRV6LORVSODQHVQRVRQFRRUGLQDGRV
el presupuesto maestro no puede ser la suma de
(V QHFHVDULR LGHQWL¿FDU ORV QRGRV R SDODVSDUWHVFUHDQGRFRQIXVLyQ\HUURU
TXHWHV GH GHFLVLyQ 8Q SDTXHWH GH GHFLVLyQ HV
8 - Gestión presupuestaria y gestión de costos en la organización / 165
XQFRQMXQWRGHDFWLYLGDGHVTXHGHSHQGHQGHOD
JHUHQFLD\TXHSXHGHQHVWDUVXMHWDVDODQiOLVLV
FRVWREHQH¿FLR(QFDGDXQDGHODVXQLGDGHVR
SDTXHWHVHOJUXSRGHDFWLYLGDGHVGHVDUUROODGDV
SXHGHVHUPRGL¿FDGRRDOWHUDGRGHDFXHUGRFRQ
los intereses de la organización.
$QDOL]DU ODV XQLGDGHV GH GHFLVLyQ (VWD
IDVHHVODPiVLPSRUWDQWHGHODVHFXHQFLDSRUTXH
GHWHUPLQDHOp[LWRRIUDFDVRGHODLPSODQWDFLyQ
del presupuesto base cero. Consiste en seis taUHDVEiVLFDVDVDEHU
'H¿QLUHOREMHWLYRHVHQFLDOGHODXQLGDGGH
GHFLVLyQUHVSHFWLYDGHPDQHUDFODUD\HVSHFt¿FD
'HVFULELU OD IRUPD HQ TXH VH HVWiQ GHVDUUROODQGR VXV DFWLYLGDGHV H LQGLFDU FRQ TXp
UHFXUVRVQXHYRVVHFXHQWDTXLpQHIHFW~DODV
GLIHUHQWHVDFWLYLGDGHVTXLpQHVVRQORVXVXDULRVGHORVVHUYLFLRV
(IHFWXDU XQ DQiOLVLV GH VHQVLELOLGDG VREUH
ODV GLIHUHQWHV RSFLRQHV TXH SXGLHUDQ VHUYLU
GHEDVHSDUDTXHODXQLGDGGHGHFLVLyQUHDlice su labor.
6HOHFFLRQDUODPHMRUDOWHUQDWLYDHQIXQFLyQ
GHXQDQiOLVLVGHORVIDFWRUHVFXDQWLWDWLYRV\
FXDOLWDWLYRV
'HWHUPLQDU HO QLYHO PtQLPR GH VHUYLFLR
TXH GHEHUtD SUHVWDU OD XQLGDG GH GHFLVLyQ
GH DFXHUGR FRQ OD RSFLyQ VHOHFFLRQDGD DVt
como su costo. Indicar también cómo pueGHQ DXPHQWDUVH ORV VHUYLFLRV DVt FRPR ORV
FRVWRVLQFUHPHQWDOHVTXHKDEUtDQGHSURGXFLUVHSDUDHVHQLYHOGHDFWLYLGDGHV
'LVHxDU ODV KHUUDPLHQWDV FXDQWLWDWLYDV \
FXDOLWDWLYDV PiV LGyQHDV D ¿Q GH HYDOXDU OD
FDOLGDGGHOVHUYLFLRGHVDUUROODGR
-HUDUTXL]DU ODV XQLGDGHV GH GHFLVLyQ (O
proceso de selección o priorización está en función de los criterios más adecuados a las cirFXQVWDQFLDV GH OD RUJDQL]DFLyQ /DV YDULDEOHV
GH¿QLGDVSDUDDQDOL]DUHOFRVWRversusEHQH¿FLR
GH ODV DFWLYLGDGHV D UHDOL]DU GLFKRV FULWHULRV
SXHGHQVHUUHQWDELOLGDGULHVJRLPSDFWRHVSHUDGRDFHSWDFLyQGHODFRPXQLGDGXRWURV
5. Elaborar e integrar el presupuesto anual.
8QDYH]HIHFWXDGDODMHUDUTXL]DFLyQGHEHUtDHODERUDUVHHOSUHVXSXHVWRGH¿QLWLYRSDUDFDGDXQLdad de decisión; éste será formulado de acuerdo
FRQ HO QLYHO GH DFWLYLGDGHV DO TXH VH SUHWHQGD
WUDEDMDU 8QD YH] FRQFOXLGD OD WDUHD SDUD WRGDV
ODVXQLGDGHVGHGHFLVLyQTXHIXHURQVHOHFFLRQDGDVVHLQWHJUDDOSUHVXSXHVWRDQXDOTXHLQFOX\H
ODV DFWLYLGDGHV GLUHFWDV H LQGLUHFWDV GH ORV VHUYLFLRV
&RQWURODU DGPLQLVWUDWLYDPHQWH ORV UHVXOtados. La última fase puede ser denominada
VHJXLPLHQWR 'H QDGD VHUYLUtD KDEHU HIHFWXDGR
ODVIDVHVGHODPHWRGRORJtDVLXQDYH]LQLFLDGR
HO SUHVXSXHVWR QR VH FRQWUROD TXH FDGD XQLGDG
GHGHFLVLyQFXPSODFRQVXVDFWLYLGDGHVSURJUDPDGDVGHIRUPDTXHVLQRORKDFHQVHDSOLTXHQ
RSRUWXQDPHQWHODVPHGLGDVFRUUHFWLYDV
Presupuesto por programas
(OSUHVXSXHVWRGHEHVHUODH[SUHVLyQ¿QDQFLHUD
GHO TXHKDFHU LQVWLWXFLRQDO 3RU HVD UD]yQ GHEH
WHQHUXQDHVWUXFWXUDWDOTXHLQGLTXHHOFRVWRHVWLPDGRSDUDODRSHUDFLyQGHORVGLYHUVRVSURJUDPDVTXHVHUHDOL]DQ\VXVDFWLYLGDGHV(ODVSHFWR
básico de la formulación de un presupuesto por
SURJUDPDVHVGH¿QLUODHVWUXFWXUDSURJUDPiWLFD
TXHWHQGUtDSDVDQGRHOSURJUDPDDFRQYHUWLUVH
de este modo en la unidad presupuestaria báVLFD3DUDHVWRKD\TXHWHQHUHQFXHQWDTXHORV
programas deben concordar idealmente con los
VHFWRUHVGHDFWLYLGDGLQVWLWXFLRQDO\FRQODVQHFHVLGDGHV GH OD SREODFLyQ 8Q SUHVXSXHVWR DVt
IRUPXODGRSHUPLWHLGHQWL¿FDUODVGLIHUHQWHVDFWLYLGDGHVTXHGHEHUHDOL]DUHO6,/26ODUHJLyQ
o las instituciones con miras al cumplimiento de
REMHWLYRV\PHWDV2WURSXQWRDFRQVLGHUDUSDUD
ODDSHUWXUDGHORVSURJUDPDVHVTXHpVWRVGHEHQ
HVWDEOHFHUVH GH PDQHUD TXH VHDQ FRPSOHPHQWDULRV\DTXHHQRFDVLRQHVSXHGHVHUQHFHVDULR
TXH SDUD DOFDQ]DU GHWHUPLQDGRV SURSyVLWRV VH
HMHFXWHQ YDULRV SURJUDPDV FRPSOHPHQWDULRV
FRQREMHWLYRV\PHWDVFRQFRUGDQWHV
'HEHUtD FRQIRUPDUVH XQ JUXSR GH WDUHDV
FRQVWLWXLGR SRU PLHPEURV GH OD DOWD JHUHQFLD
TXHGHEH¿MDUODVSDXWDVJHQHUDOHVTXHODRUJDnización debería seguir y coordinar los presuSXHVWRVTXHHQIRUPDVHSDUDGDSUHSDUDURQODV
GLYHUVDVXQLGDGHVRUJDQL]DFLRQDOHVUHVROYLHQGR
HYHQWXDOHVGLIHUHQFLDVTXHVXUMDQHQWUHHOODV(V
LQGLVSHQVDEOH OD H[LVWHQFLD GH FRRUGLQDFLyQ HQ
WRGDVODVXQLGDGHVHMHFXWRUDVVLVHTXLHUHORJUDU
H¿FLHQFLDHQODJHVWLyQ3RUHOORVHUHTXLHUH¿MDU
fechas límite donde la información de cada unidad deba estar a disposición.
7DPELpQ HV QHFHVDULR TXH VH HODERUHQ SRU
HVFULWRODVSROtWLFDVORVPpWRGRV\ORVSURFHGL-
166 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
PLHQWRVTXHUHJLUiQHOSUHVXSXHVWRHVWRVHORJUD
mediante la elaboración de un manual de presupuesto adecuado. Este manual debe contener los
VLJXLHQWHVUHTXLVLWRV
/RV REMHWLYRV ¿QDOLGDGHV \ IXQFLRQDOLGDG
GH WRGR HO SODQ SUHVXSXHVWDO DVt FRPR OD
UHVSRQVDELOLGDG TXH WHQGUi FDGD XQR GH ORV
miembros del personal a cuyo cargo está un
área de responsabilidad presupuestal.
(OSHUtRGRTXHLQFOXLUiHOSUHVXSXHVWRFRPR
ODSHULRGLFLGDGFRQTXHVHJHQHUDQORVLQIRUmes de gestión.
7RGDODRUJDQL]DFLyQVHSRQGUiHQIXQFLRQDmiento para alcanzar un desarrollo coherente
\XQDDGPLQLVWUDFLyQH¿FLHQWH
4. Las instrucciones para el seguimiento de la
PHWRGRORJtDRSHUDFLRQDOFRQODTXHVHHODERrara el presupuesto.
6RQ LQQHJDEOHV ODV YHQWDMDV TXH RIUHFH OD
FRQIHFFLyQ GH HVWH PDQXDO \D TXH HV XQ PHGLRLQIRUPDWLYRPX\YDOLRVRSDUDWRGRVORVLQWHJUDQWHV GH XQD RUJDQL]DFLyQ SRUTXH HQ pO VH
delimitan la autoridad y la responsabilidad de
FDGD PLHPEUR WDQWR FRPR ORV SURFHGLPLHQWRV
a seguir.
Ejecución del presupuesto
Está constituida por una serie de operaciones
TXH GHEHQ FXPSOLU WRGRV ORV IXQFLRQDULRV GH
acuerdo con el plan de trabajo anual integrado
SRU SURJUDPDV VXESURJUDPDV DFWLYLGDGHV \
SUR\HFWRV (O SODQ GH HMHFXFLyQ SRU H[FHOHQFLD
HVHOSUHVXSXHVWRQRREVWDQWHSDUDFRQWULEXLUD
su ordenada realización deben prepararse planes
anuales de ingresos y gastos. Al comparar resulWDGRVVHSXHGHSUHVHQWDUTXHORVLQJUHVRV\ORV
gastos no coincidan; entonces debe buscarse una
solución a esa problemática. Se puede recurrir a
DMXVWDUORVJDVWRVDORVLQJUHVRV HVWRLPSOLFDUtD
retrasar los programas o conducir a un desaproYHFKDPLHQWR GH ORV UHFXUVRV QR ¿QDQFLHURV D
producir los ingresos necesarios o a establecer
un adecuado plan de gastos.
Ejecución de ingresos
(MHFXWDU ORV LQJUHVRV FRQVLVWH HQ OOHYDU D FDER
ODVIXQFLRQHVGHUHFDXGDFLyQ¿VFDOL]DFLyQ\FRbranza. La función de recaudación consiste en
OD JHVWLyQ GH SDJR SRU VHUYLFLRV UHFLELGRV TXH
deben realizar los usuarios frente a la adminisWUDFLyQ R GHO DSRUWH TXH UHDOL]DQ HO JRELHUQR
FHQWUDOXRWUDVLQVWLWXFLRQHVS~EOLFDVRSULYDGDV
/D IXQFLyQ GH ¿VFDOL]DFLyQ FRQVLVWH HQ YHUL¿FDUTXHORVLQJUHVRVVHSURGX]FDQRSRUWXQDPHQWH\HQORVPRQWRVDGHFXDGRVSDUDORTXHVH
UHTXLHUHXQDGHFXDGRVLVWHPDGHLQIRUPDFLyQ
La función de cobranza comprende las acFLRQHV DGPLQLVWUDWLYDV SDUD ORJUDU OD UHFDXGDFLyQGHODVVXPDVFRUUHVSRQGLHQWHVSRUODYHQWD
GHVHUYLFLRV
Ejecución de gastos
&RQEDVHHQORVSODQHVGHHMHFXFLyQ¿QDQFLHUD
\ ORV JDVWRV SUR\HFWDGRV VH SURFHGH D GDU ODV
autorizaciones correspondientes. Éstas pueden
GDUVHGHXQDYH]SDUDWRGRHODxR VHUYLFLRVGH
OD GHXGD SDJR GH FXRWDV R SDUD FDGD XQR GH
ORVSHUtRGRVGHOFDOHQGDULRGHSDJRV VHJ~QODV
prioridades y la situación de la tesorería.
'XUDQWHODHMHFXFLyQGHOSUHVXSXHVWRDYHFHV
HVQHFHVDULRPRGL¿FDUORVPRQWRVDVLJQDGRV\D
VHD SDUD FRPSOHPHQWDU SDUWLGDV LQVX¿FLHQWHV
±TXL]iODVLWXDFLyQPiVFRP~Q±SDUDDPSOLDU
ORVVHUYLFLRVRELHQSDUDKDFHUIUHQWHDHOHYDFLRQHVGHORVFRVWRVQRSUHYLVWDV
(VODIDVHTXHLPSOLFDYHUL¿FDU\YDORUDUHO
JUDGRGHFXPSOLPLHQWRGHORVREMHWLYRV\PHWDVHOQLYHOGHJDVWRVGHOSHUtRGRGHWHUPLQDU
ODVFDXVDVGHODVGHVYLDFLRQHVRYDULDFLRQHVHQWUHORHMHFXWDGR\ORSURJUDPDGR\GH¿QLUODV
PHGLGDVFRUUHFWLYDVHQFDVRQHFHVDULR'HHVWD
PDQHUDVHGH¿QHHOFRQWURO\HYDOXDFLyQFRPR
un subproceso continuo de la administración
SUHVXSXHVWDULDTXHLPSOLFDYHUL¿FDU\YDORUDU
las acciones emprendidas con el objeto de apreFLDU OD PHGLGD HQ TXH VH FXPSOHQ FXDOLWDWLYD
\ FXDQWLWDWLYDPHQWH ORV SURSyVLWRV \ SROtWLFDV
¿MDGRV FRQ DQWHULRULGDG \ DO PLVPR WLHPSR
GHWHUPLQDU ODV DFFLRQHV FROHFWLYDV QHFHVDULDV
D ¿Q GH DMXVWDU OD HMHFXFLyQ D ODV SUHYLVLRQHV
RULJLQDOHVRDORVQXHYRVOLQHDPLHQWRVFR\XQWXUDOHVTXHVXUMDQGXUDQWHODHMHFXFLyQGHOSUHsupuesto.
(VSHFt¿FDPHQWH VH SXHGH LQGLFDU TXH OD
HYDOXDFLyQ SUHVXSXHVWDULD VH GHVDUUROOD HQ ODV
siguientes etapas:
‡$QiOLVLVGHOJUDGRGHFXPSOLPLHQWRGHORVREMHWLYRV\PHWDVHVGHFLUGHODH¿FLHQFLDFRQ
TXH VH KDQ DGPLQLVWUDGR ORV UHFXUVRV 3DUD
ello deben considerarse factores internos y
H[WHUQRVDOSURJUDPDTXHVHHVWiHYDOXDQGR
DGHPiVGHEHGLVSRQHUVHGHXQDFRUULHQWHGH
LQIRUPDFLyQSHUPDQHQWHRSRUWXQD\DGHFXDGDVREUHDYDQFHItVLFRDVSHFWRV¿QDQFLHURV
y costos de los programas.
8 - Gestión presupuestaria y gestión de costos en la organización / 167
‡'HWHUPLQDFLyQGHODVFDXVDVGHODVYDULDFLRnes entre lo ejecutado y lo programado. En
HVWHFDPSRGHEHWHQHUVHSUHVHQWHTXHWDQWR
OD FDSDFLGDG DQDOtWLFD GHO HYDOXDGRU FRPR
ORV LQVWUXPHQWRV WpFQLFRV TXH pVWH SRVHD
son factores determinantes para el análisis
GHODVFDXVDV\GHORVHIHFWRVGHODVYDULDciones.
‡ &RPR FRQVHFXHQFLD GHO DQiOLVLV GH ODV YDULDFLRQHVREVHUYDGDV\ODH[SOLFDFLyQGHVXV
FDXVDVGHEHQGH¿QLUVHODVPHGLGDVFRUUHFWLYDV FXDQGR VHD QHFHVDULR ,QFOXVR HQ DOJXQRVFDVRVFXDQGRQRVHSUHVHQWHQYDULDFLRQHV SRGUtDQ DGRSWDUVH PHGLGDV FRUUHFWLYDV
con el propósito de optimizar el empleo de
los recursos asignados al programa.
‡(VWDEOHFHUSDWURQHVGHUHIHUHQFLDSDUDLGHQWL¿FDUORVGHVYtRVGHOPLVPR\RGHODQRUPD
establecida.
(O SURSyVLWR GHO FRVWHR QR HV DO PHQRV HQ
SULQFLSLR\VHJ~QORFRQVLGHUDGRDKRUUDUGLQHUR DXQTXHpVWDSXHGDVHUXQDGHULYDFLyQGHORV
DQiOLVLV VLQRSHUPLWLUXQDXWLOL]DFLyQySWLPD\
una adecuada ubicación de recursos de acuerdo
DORVYDORUHVpWLFRVTXHFDGDVRFLHGDGFRQVLGHUH
preeminentes.
Comenta también Meehroff TXH HQ XQD UHunión con un funcionario del Ministerio de Salud
GHO8UXJXD\HQHOFRQWDGRUJHQHUDOOHGLMR
³QR FRQRFHPRV QXHVWURV FRVWRV«´ FRVD TXH pO
WRPyFRPRXQDEURPDSDUDGDUVHFXHQWDDOSRFR
WLHPSRGHTXHHUDODYHUGDG(UD\HVXVXDOTXH
los médicos o los funcionarios públicos no tengan
PRINCIPIOS DE CONTABILIDAD ANALÍTICA Y COSTOS
PD\RUFRQFLHQFLDGHHVWHWHPDHQSDUWHSRUIRUPDFLyQ\HQSDUWHSRUTXHODWUDGLFLyQLQVWLWXFLRQDO
INSTITUCIONALES. PRODUCTO HOSPITALARIO
QRORKDYXHOWRXQDSUiFWLFDFRQRFLGDQLPXFKR
(QYLVWDGHTXHHQHOIRQGRGHWRGRSURFHVRSUR- PHQRV LQFRUSRUDGD 1XHYDPHQWH HO 'U 3HQQD
GXFWLYRGHELHQHV\VHUYLFLRVH[LVWHXQFRVWR¿QDQ- DSRUWDXQDH[FHSFLyQDOKDEHUVHSUHRFXSDGR\D
ciero y éste posee un gran peso en las decisiones HQGHORVFRVWRVGHORVSDFLHQWHVKRVSLWDSUHVHQWHV\IXWXUDVODLQIRUPDFLyQGHORVFRVWRVGH lizados o atendidos en urgencias en el Hospital
ORVVHUYLFLRVGHVDJUHJDGRVHQORVGLYHUVRVLQVXPRV $UJHULFKFRPRVHDSUHFLDHQOD)LJXUD
UHTXHULGRVSDUDDOFDQ]DUORVQLYHOHVGHSURGXFFLyQ
'HFtD3HQQD³«VLHQGRHVWHKRVSLWDO $UJHGHVHDGRV VRQ XQ IDFWRU PX\ LPSRUWDQWH$XQTXH
pueda parecer ocioso discutir el propósito de reali- ULFK DQWHWRGRXQDHVWDFLyQGHVRFRUURVPpGLFRV
]DUDFWLYLGDGHVJHQHUDOHVGHFRVWHRHVWDGLVFXVLyQ \SULPHURVDX[LOLRVHQFDVRGHXUJHQFLDVDOHIHFes del todo prioritaria. Meerhoff menciona en su tuarse el cálculo del costo parcial de cada enferOLEURODVVLJXLHQWHVUD]RQHVHQWUHRWUDVSDUDFRQR- mo hospitalizado debe hacerse tomando como
base el total de enfermos atendidos no sólo dencer costos institucionales:
‡&RQRFHUHOGHVHPSHxRGHORVVHUYLFLRV\PH- WURVLQRIXHUDGHOKRVSLWDOSRUTXHQRKDEUtDUD]yQ
SDUDQRFRPSXWDUORVDX[LOLRVHQODYtDSXEOLFD
GLUVXSURGXFWLYLGDG
RDGRPLFLOLRSRUHMHPSOR\DTXHHVWHVHUYLFLR
‡7HQHUHOHPHQWRVSDUDPHMRUDUODJHVWLyQ
‡ ,QWURGXFLU FULWHULRV UDFLRQDOHV HQ OD DVLJQD- obliga a tener un personal especial de guardia de
ción de recursos y aplicar las técnicas del PpGLFR\SUDFWLFDQWHVRWURHQODIDUPDFLDHQIHUPHURV FRFKHURV GH DPEXODQFLD HWF OR TXH
cálculo económico
‡(YDOXDU\PHMRUDUORVVLVWHPDVGHFDSWDFLyQ origina no sólo gastos de sueldos sino de maUHJLVWUR SURFHVDPLHQWR H LQWHUSUHWDFLyQ GH QXWHQFLyQGURJDVHPSOHDGRVGHIRUUDMHSDUDOD
FDEDOOHUL]DHWF«\DTXHHVWHKRVSLWDOWLHQHXQ
datos
‡'HWHFWDUSUREOHPDVDQRPDOtDVGLVSDULGDGHV QXWULGR FRQVXOWRULR H[WHUQR TXH JHQHUD PLOHV
\ GHVYLDFLRQHV UHVSHFWR GH ODV QRUPDV SDUD GHFRQVXOWDVDODxR±HQHQ
HQ±\XQVHUYLFLRGHXUJHQpoder introducir soluciones
‡(VWDEOHFHUUHODFLRQHVGHFRVWRH¿FDFLD\FRV- FLDTXHWLHQHFLIUDVHOHYDGDVHQVXPRYLPLHQWR
±HQHQ±FLIUDVTXHVRQ
WREHQH¿FLR
‡(VWDEOHFHUSDWURQHVGHUHIHUHQFLDRGHFRP- las más importantes en Buenos Aires después de
SDUDFLyQHQWUHVHUYLFLRV
ODVTXHSUHVHQWDOD&DVD&HQWUDOGHOD$VLVWHQFLD
9pDVH0HHKURII5'HVFHQWUDOL]DFLyQ¿QDQFLDPLHQWRFRVWHR\DXWRJHVWLyQGHHVWDEOHFLPLHQWRVGHVDOXGXQD
YLVLyQLQWHJUDGD3DOWH[3;(
168 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
Figura 8.4: Costos de enfermos hospitalizados y auxilios médicos por día en el hospital Argerich, datos
entre 1904 y 1909. Tomado de: La Administración Sanitaria y Asistencia Pública de la Ciudad de Buenos
Aires, José Penna y Horacio Madero. Estudio de los Servicios de Higiene y Asistencia Pública, desde la
época colonial hasta el presente. Publicación Oficial. Buenos Aires. Imprenta, litografía y encuadernación de G Kraft 1910. (Ejemplar facilitado por la Biblioteca de la Facultad de Medicina de la UBA)
3~EOLFDORTXHDXPHQWDHOFRVWRDQXDOGHEHLPSXWDUVHSDUDVHUH[DFWR\MXVWRQRVyORORVJDVWRV
ocasionados sino todos los enfermos atendidos
GHQWUR\IXHUDGHOKRVSLWDO«´
< WHUPLQD 3HQQD H[FXViQGRVH ³«ODPHQWR
TXHORVSURFHGLPLHQWRVGLYHUVRVGH$GPLQLVWUDFLRQHVDQWHULRUHVDODPtDDOQRGHMDUYDORUGH
ODV SURYLVLRQHV FRQVXPLGDV SRU HVWH +RVSLWDO
PHLPSLGDQKDFHUHOFiOFXORGHVGHHODxR
DO«´ 3HQQD0DGHURop. cit. )XQGDPHQWDOPHQWH XQ VLVWHPD GH LQIRUPDFLyQ GHEH VHU XQ VRSRUWH H¿FD] \ H¿FLHQWH GH
ODDGPLQLVWUDFLyQSDUDTXHpVWDWHQJDPHQRUHV
SUREDELOLGDGHVGHHUURU\SDUDTXHHOULHVJRHQ
las decisiones sea menor. En su trabajo operatiYRFRWLGLDQRLQYROXFUDXQDVHULHGHSURFHVRVTXH
FDSWXUDQSURFHVDQDOPDFHQDQ\GLVWULEX\HQOD
LQIRUPDFLyQ QHFHVDULD SDUD VXV RSHUDFLRQHV
SDUDODVDFWLYLGDGHVGHGLUHFFLyQ\FRQWURO\SDUD
el soporte a los procesos de toma de decisiones.
'HVGHXQSXQWRGHYLVWDKLVWyULFR\HQUHODFLyQFRQORVWHPDVTXHHVWDPRVWUDWDQGRGLUHPRVTXHODFRQWDELOLGDG¿QDQFLHUDVHGHVDUUROOy
DOVXUJLUODQHFHVLGDGGHUHÀHMDUHQQ~PHURVOD
UHDOLGDGGHODHPSUHVD\VLHQGRVX¿FLHQWHSDUD
ODJHVWLyQGHXQDSHTXHxDHPSUHVDTXHSURGX]FD
\ YHQGD XQRV SRFRV SURGXFWRV TXHGy REVROHWD
de cara a apoyar la gestión de empresas multiSURGXFWRGLYHUVL¿FDGDV\KDVWDsupercomplejas
como el hospital moderno.
/DHPSUHVDHVSDUDODFRQWDELOLGDG¿QDQFLHUD
XQWRGRFRQVXVDFWLYRV\SDVLYRV\VXIXQFLRQDPLHQWRFRQVLVWHHQPRYLPLHQWRVHQWUHHVWDVPDVDVSDWULPRQLDOHV1RREVWDQWHHVWDLQIRUPDFLyQ
HV LQVX¿FLHQWH DO WHQHU TXH WRPDUVH GHFLVLRQHV
VREUHXQSURGXFWRRXQPHUFDGRTXHDIHFWDQD
SDUWHGHODHPSUHVD\QRDVXWRWDOLGDG\HVDTXt
TXHWLHQHVXQDFLPLHQWR\UD]yQGHVHUODFRQWDbilidad analítica o de gestión.
SOBRE LOS COSTES
([LVWHQGLYHUVDVYHUVLRQHVGHOFRQFHSWRGHFRVWR\DTXHVXGH¿QLFLyQLQWHUHVDDP~OWLSOHVGLVFLSOLQDV\FRQVWLWX\HSRURWUDSDUWHXQDQRFLyQ
LQWXLWLYDXWLOL]DGDFRQWLQXDPHQWHHQODYLGDFRtidiana. El concepto económico de costo se ha
XWLOL]DGRHQGRVYHUVLRQHVJHQHUDOHVODSULPHUD
HQVHQWLGRGHFRQVXPRRVDFUL¿FLRGHUHFXUVRV
GHIDFWRUHVSURGXFWLYRV\ODVHJXQGDHQHOVHQWLGRGHFRVWRDOWHUQDWLYRRGHRSRUWXQLGDG$Vt
3HGHUVHQ SRUHMHPSORGHVDUUROODODLGHD
GHVDFUL¿FLRGH¿QLHQGR³&RVWRHVHOFRQVXPR
YDORUDGRHQGLQHURGHELHQHV\VHUYLFLRVSDUDOD
SURGXFFLyQTXHFRQVWLWX\HHOREMHWLYRGHODHPSUHVD´PLHQWUDVSDUD6FKQHLGHU FRVWRHV
³HOHTXLYDOHQWHPRQHWDULRGHORVELHQHVDSOLFDGRVRFRQVXPLGRVHQHOSURFHVRGHSURGXFFLyQ´
(O FRVWR DOWHUQDWLYR R GH RSRUWXQLGDG GH FXDOTXLHUIDFWRUHPSOHDGRHQHOSURFHVRSURGXFWLYR
VHPLGHGHDFXHUGRFRQHOEHQH¿FLRSHUGLGRSRU
no emplear ese factor en su mejor aplicación alWHUQDWLYDHVGHFLUHOFRVWRGHRSRUWXQLGDGHVHO
YDORUGHODPHMRUDOWHUQDWLYDTXHVHSLHUGH(Vtos conceptos de costo han sido tratados por los
HFRQRPLVWDVFOiVLFRVSULQFLSDOPHQWHSRU'DYLG
5LFDUGR \ - % 6D\ \ OD HVFXHOD PDUJLQDOLVWD
TXHDWUDYpVGHODWHRUtDGHOHTXLOLEULRUHIRU]y
ODUHODFLyQIXQFLRQDOH[LVWHQWHHQWUHFRVWRVVDODULRVLQWHUpVEHQH¿FLRSUHFLRV\UHQWDVGHVWDFDQGRODHVHQFLDIXQGDPHQWDOGHODDFWLYLGDG
HFRQyPLFD UDFLRQDO WRGR VDFUL¿FLR SDUD TXH
VHDFRVWRGHEHDXPHQWDUHOYDORUVRFLDOGHOELHQ
DOTXHVHDSOLFDWRGRVDFUL¿FLRTXHQRFXPSOD
8 - Gestión presupuestaria y gestión de costos en la organización / 169
esta condición debe ser considerado como un
despilfarro.
La contabilidad de gestión aplica una meWRGRORJtD LQGXFWLYD SDUD HO FiOFXOR \ FRQWURO
GH FRVWRV OR TXH GD OXJDU D TXH pVWH VH PXHVWUHFRPRXQDPDJQLWXGGHYDORUUHODWLYRTXHQR
SXHGHFDOFXODUVHGHPRGRH[DFWR\DTXHH[LVWH
LQFHUWLGXPEUHHQODYDORUDFLyQGHORVFRQVXPRV
y en la distribución de éstos sobre la producción
obtenida. El costo surge cuando el consumo de
los factores de la producción se efectúa para
realizar la información económica de la cadena
GHYDORUHPSUHVDULDO(OJDVWRHVHOHTXLYDOHQWH
PRQHWDULR GH ODV FRPSUDV UHDOL]DGDV KDFLHQGR
UHIHUHQFLDDOPRPHQWRGHDGTXLVLFLyQ
Como la contabilidad de gestión pretende
elaborar información para la toma de decisiones
HPSUHVDULDOHV GHEH SURYHHU GLIHUHQWHV WLSRV R
YDULHGDGHVGHLQIRUPDFLyQGHFRVWRVTXHVHDGDSten a las necesidades de las situaciones cambianWHVHQODVTXHVHGHEHGHFLGLUVLHQGRQHFHVDULR
atender a la diferente problemática planteada en
los siguientes aspectos por lo menos:
‡0HGLFLyQGHORVLQJUHVRVFRVWRVEHQH¿FLRV
‡,QIRUPDFLyQSDUDODSODQL¿FDFLyQ
‡,QIRUPDFLyQSDUDHOFRQWURO
‡,QIRUPDFLyQSDUDODWRPDGHGHFLVLRQHVVREUH
SURGXFFLyQ LQYHUVLyQ FRPSUDV VXVWLWXFLyQ
GHSURGXFWRVSUHFLRVGHYHQWDHWF
‡ ,QIRUPDFLyQ VREUH ODV GLVWLQWDV DFWLYLGDGHV
TXHFRPSRQHQODFDGHQDGHYDORU\VREUHORV
Cost drivers TXH UHÀHMDQ OD UHODFLyQ FDXVDO
de los consumos.
3DUDVDWLVIDFHUODVQHFHVLGDGHVLQIRUPDWLYDV
JHQHUDGDVSRUHVWRVGLYHUVRVSURSyVLWRVVHQHFHVLWDQ GLIHUHQWHV WLSRV GH PRGHORV GH FRVWRV
TXHPXHVWUHQGHIRUPDFODUD\UHOHYDQWHORTXH
debe decidirse realizar de forma racional en cada
momento.
CLASIFICACIÓN DE COSTOS
&RVWRGHSURGXFFLyQRLQGXVWULDOLQFOX\H
HO FRVWR GH ORV PDWHULDOHV PDQR GH REUD \
otros insumos de fabricación indirectos.
&RVWR GH GLVWULEXFLyQ VRQ ORV FRVWRV UHODWLYRV D OD FRPHUFLDOL]DFLyQ \ HQWUHJD D OD
FOLHQWHOD VH FRQVLGHUD TXH VRQ FRQVXPLGRV
HQHOSHUtRGRHQTXHVHUHDOL]DQ
1.4. Costos de administración y generales: son
ORVFRVWRVDVLJQDGRVSRUDGPLQLVWUDFLyQGLUHFFLyQ¿QDQFLDFLyQGHORVSURFHVRVGHSURGXFFLyQ\YHQWD
1.5. Costos de empresa o costos totales: son los
FRVWRVFRPSOHWRVGHOSHUtRGRTXHVHREWLHnen por agregación de los costos de producFLyQGLVWULEXFLyQDGPLQLVWUDFLyQGLUHFFLyQ
\¿QDQFLHURV
2. Con relación al momento de cálculo
&RVWRUHDOUHWURVSHFWLYRKLVWyULFRRHIHFWLYRFDOFXODGRDSDUWLUGHORVFRQVXPRVUHDOHV
HQHOSURFHVRSURGXFWLYRGXUDQWHXQSHUtRGR
de tiempo.
&RVWR HVWiQGDU QRUPDWLYR SURVSHFWLYR
o predeterminado: calculado a partir de los
FRQVXPRV SUHGHWHUPLQDGRV D XQ SUHFLR HVWiQGDUSUH¿MDGRSDUDXQSHUtRGRIXWXURWDPbién considerado como un costo o norma.
3. Con relación a su posible asignación mediata o
inmediata (certeza de imputación de los factores
a los productos)
&RVWRGLUHFWRVRQORVUHIHULGRVDPHGLRV
o factores consumidos en el proceso por un
producto o por un centro de costo y sobre
HOTXHVHSXHGHFDOFXODUHVSHFt¿FDPHQWHVX
asignación.
&RVWR LQGLUHFWR VRQ ORV TXH LQFOX\HQ HO
consumo de factores o medios de producción
TXH SRU DIHFWDU DO SURFHVR HQ VX FRQMXQWR
QRVHSXHGHQFDOFXODUGLUHFWDPHQWHVLQRSRU
distribución.
4. Con relación a la variación del nivel
'HQWUR GHO iPELWR GH OD FRQWDELOLGDG TXH KD de actividad (producción o venta)
&RVWRV ¿MRV SHUPDQHFHQ VHQVLEOHPHQWH
sido ampliado posteriormente por la economía
¿MRV SDUD XQ SHUtRGR GH WLHPSR \ QLYHO GH
GH HPSUHVD ORV FRVWRV KDQ VLGR FODVL¿FDGRV
ODDFWLYLGDGGHODHPSUHVD\QRGLVPLQX\HQ
DWHQGLHQGRDGLYHUVRVFULWHULRV
DXQ FXDQGR VH UHGX]FD HO QLYHO GH SURGXFFLyQRYHQWD\DTXHQRHVWiQDIHFWDGRVSRU
1. Con relación a los elementos que lo forman
1.1. Costo primario o directo: es el costo forHOYROXPHQGHRSHUDFLRQHVHVWRQRLPSOLFD
mado por el material y otros suministros y
TXH VHDQ LQYDULDEOHV HQ SHUtRGRV VXFHVLYRV
la mano de obra necesaria para fabricar un
\DTXHXQDDOWHUDFLyQHQHOQLYHOGHSUHFLRV
producto.
SRGUiPRGL¿FDUORVFRVWRV
170 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
mentar los medios de producción en forma
5HIHULGRVDOFRVWRXQLWDULR¿MRTXHVHREWLHGLVFUHWD OR TXH LPSOLFD XQD GLVFRQWLQXLGDG
QHDOGLYLGLUORVFRVWRV¿MRVSRUHOQ~PHURGH
HQ OD IXQFLyQ GH FRVWRV 6X YDULDELOLGDG VH
XQLGDGHVSURGXFLGDVREWHQGUHPRVXQFRVWR
GHVDUUROODGHQWURGHXQRVLQWHUYDORVSURGXXQLWDULRGHFUHFLHQWHFRQHOYROXPHQGHSURciéndose una función a saltos.
ducción.
&RVWRVVHPLYDULDEOHVVRQDTXHOORVTXHWLHEntre ellos cabe destacar:
nen los dos atributos de relación respecto de
&RVWRGHLQDFWLYLGDGRHVWDGRSDUDGRHVWi
OD YDULDFLyQ GH OD YDULDEOH IXQGDPHQWDO HO
UHSUHVHQWDGR SRU DTXHOORV FRVWRV ¿MRV TXH
QLYHOGHDFWLYLGDGGHODSURGXFFLyQ\YHQWD
SHUPDQHFHQLQFOXVRHQHOVXSXHVWRGHSDUDEstos costos no se adaptan estrictamente a
OL]DFLyQWHPSRUDOGHODH[SORWDFLyQ
ODGH¿QLFLyQGHFRVWRYDULDEOHSRUTXH\DDO
- Costo de preparación de la producción: lo
QLYHO GH DFWLYLGDG FHUR FXHQWDQ FRQ XQ LPUHSUHVHQWDQ DTXHOORV FRVWRV ¿MRV QHFHVDULRV
SRUWHGHOFRVWR\WDPSRFRVRQ¿MRVSRUTXH
SDUD SRQHU HO SURFHVR SURGXFWLYR HQ FRQGLYDUtDQFRQHOQLYHOGHDFWLYLGDG8QHMHPSOR
FLRQHVGHUHDOL]DUVXDFWLYLGDG
GHFRVWRVVHPLYDULDEOHVHVHOGHDTXHOORVVX &RVWRGHPDUFKDHQYDFtRORIRUPDQHOFRVPLQLVWURVTXHFRQVXPHODHPSUHVDFRPRSRU
WRGHLQDFWLYLGDGPiVHOFRVWRGHSUHSDUDFLyQ
HMHPSORODHQHUJtDTXHFXHQWDQFRQXQDFXRde la producción.
WD¿MDPiVXQFRVWRTXHGHSHQGHHQUHODFLyQ
&RVWRV YDULDEOHV VRQ DTXHOORV TXH YDUtDQ
al consumo.
HQIXQFLyQGHOYROXPHQGHSURGXFFLyQRYHQWDVLHQGRVXUHSUHVHQWDFLyQJUi¿FDXQDUHFWD &RVWRVUHYHUVLEOHVVRQORVTXHDXPHQWDQR
disminuyen cuando aumenta o disminuye el
TXHSDVDSRUHORULJHQ& E[6LODYDULDFLyQ
YROXPHQGHSURGXFFLyQ
HVSURSRUFLRQDOHOFRVWRXQLWDULRYDULDEOHHV
FRQVWDQWH (Q OD UHDOLGDG VHJ~Q H[SOLFD OD &RVWRVLUUHYHUVLEOHVVRQORVTXHDXPHQWDQ
FXDQGRDXPHQWDHOYROXPHQGHSURGXFFLyQ
WHRUtD HFRQyPLFD SDUD ORV SULPHURV WUDPRV
pero no descienden en la misma proporción
de función de costos y en empresas poco tecQL¿FDGDVORVFRVWRVYDULDEOHVVHDGDSWDQPiV
VLGLVPLQX\HHOQLYHOGHODPLVPD(VWHIHQymeno es conocido con el nombre de histéreHQVXFRPSRUWDPLHQWRDXQDFXUYDTXHFUHFH
sis de los costosGH¿QLpQGRVHFRPRODGLIHDOSULQFLSLRPHQRVTXHSURSRUFLRQDOPHQWH\
UHQFLDGHFRVWRVHJ~QHOYROXPHQGHSURGXFOOHJDDXQSXQWRGHLQÀH[LyQDSDUWLUGHOFXDO
ción se alcance creciendo desde cantidades
FUHFHPiVTXHSURSRUFLRQDOPHQWH6LQHPEDULQIHULRUHV R GHFUHFLHQGR GHVGH YRO~PHQHV
JRVHKDGHPRVWUDGRGHIRUPDHPStULFDTXH
superiores.
HQORVSURFHVRVPiVWHFQL¿FDGRVHVWDFXUYDVH
ajusta en gran medida a una recta en el tramo
GHOD]RQDUHOHYDQWHGHQLYHOGHDFWLYLGDGGH 5. Con relación a la toma de decisiones
XQDHPSUHVDSRUORTXHHVYiOLGRXWLOL]DUHO &RVWRPDUJLQDOHVHOFRVWRHIHFWLYRGHOD
DQiOLVLVOLQHDO'HQWURGHORVFRVWRVYDULDEOHV
~OWLPDXQLGDGSURGXFLGDRHOFRVWRDGLFLRQDO
podemos diferenciar las siguientes clases:
UHTXHULGR SDUD DXPHQWDU OD SURGXFFLyQ HQ
&RVWRV SURSRUFLRQDOHV VRQ DTXHOORV FX\D
una unidad; mientras en contabilidad el costo
YDULDELOLGDG HV SURSRUFLRQDO DO YROXPHQ GH
XQLWDULRGHFUHFHVLHPSUHHQHFRQRPtDOOHJD
SURGXFFLyQ \ WLHQH LGpQWLFR YDORU XQLWDULR
DXQPtQLPRDSDUWLUGHOTXHDVFLHQGH(VWR
SDUDFXDOTXLHUQLYHO
es consecuencia de la ley del decrecimiento
&RVWRVSURJUHVLYRVHQORVTXHODYDULDELOLGHODSURGXFWLYLGDGPDUJLQDO(QODUHDOLGDG
GDGHVPD\RUTXHSURSRUFLRQDOUHVSHFWRGHO
LQGXVWULDO UDUDV YHFHV VH IXHU]DQ ODV FRQGLQLYHOGHDFWLYLGDG\HOYDORUXQLWDULRDXPHQWD
FLRQHV RSHUDWLYDV KDVWD XQ SXQWR GH VDWXUDFRQHOYROXPHQGHSURGXFFLyQVLHQGRVXWDVD
FLyQWDOTXHVHVLHQWDHOHIHFWRGHHVWDOH\
GHYDULDFLyQPD\RUTXH
&RVWRLQFUHPHQWDOHVHODXPHQWRGHOFRVWR
&RVWRVGHJUHVLYRVHQORVTXHODYDULDELOLtotal producido como resultado de incremenGDG HV PHQRU TXH SURSRUFLRQDO DO YROXPHQ
WDUODDFWLYLGDGSURGXFWLYDHQXQGHWHUPLQDGH SURGXFFLyQ VX YDORU XQLWDULR GLVPLQX\H
GRQLYHO
DPHGLGDTXHDXPHQWDHOQLYHOGHDFWLYLGDG &RVWR GLIHUHQFLDO HV HO PHQRU FRVWR SRU
VLHQGRVXWDVDGHYDULDFLyQPHQRUTXH
unidad para un aumento determinado del
&RVWRVVHPL¿MRVRHQHVFDORQHVVRQDTXHYROXPHQ SURGXFFLyQ (O FRQFHSWR GH FRVWR
OORVTXHVHSURGXFHQSRUODQHFHVLGDGGHDXGLIHUHQFLDO GHULYD GLUHFWDPHQWH GH FRQVLGH-
8 - Gestión presupuestaria y gestión de costos en la organización / 171
UDUORXQFDVRSDUWLFXODUGHODXPHQWRGHOYRlumen de producción. La utilización de los
costos incremental y diferencial para tomar
GHFLVLRQHVGHSDVRGHXQDVLWXDFLyQRSHUDWLYDDRWUDWLHQHXQDYDOLGH]PiVDPSOLDTXHOD
TXHRIUHFHQORVFRVWRVPDUJLQDOHV
&RVWRV UHOHYDQWHV H LUUHOHYDQWHV sunk
costs ORVFRVWRVUHOHYDQWHVVRQORVTXHWLHnen una importancia y oportunidad especial
para cada toma concreta de decisiones; es
GHFLUVRQFRVWRVPRGL¿FDEOHVDWUDYpVGHOD
elección de una determinada posibilidad de
DFWXDFLyQ/RVFRVWRVLUUHOHYDQWHVVXPHUJLGRVRKXQGLGRVVRQORVTXHQRSUHVHQWDQOD
FDUDFWHUtVWLFD GH UHOHYDQFLD SDUD XQD GHWHUminada toma de decisiones.
CENTROS DE COSTES
El primer paso en la contabilidad analítica es
GLYLGLU HO KRVSLWDO HQ FHQWURV GH FRVWRV 3XHGH
SHQVDUVHTXHKD\XQFHQWURGHFRVWRVDOOtGRQGH
H[LVWDXQJUXSRGHDFWLYLGDGHVKRPRJpQHDVTXH
SRU VX LPSRUWDQFLD HQ HO SURGXFWR ¿QDO MXVWL¿TXHQTXHVHOOHYHQFRVWRVSRUVHSDUDGRD¿QHVGH
FRQWURO\HYDOXDFLyQ$VtFDGDFHQWURGHFRVWRV
actúa como una suerte de miniempresa. La de¿QLFLyQ FRQWDEOH DO GHFLU GH %RKLJDV HV ³XQD
XQLGDG FRQWDEOH FRQUHVSHFWRDODFXDOVHUHFRJHQ\DFXPXODQGDWRVGHFRVWRV«´
/RV FHQWURV GH FRVWRV SXHGHQ VHU FXDOTXLHU
FRVD TXH VH GHVHH GHQWUR GHO KRVSLWDO XQ VHUYLFLR tQWHJUR XQD XQLGDG XQ WRPyJUDIR HWF
6X GH¿QLFLyQ HV ³OD SLHGUD IXQGDPHQWDO GH OD
HVWUXFWXUDGHODFRQWDELOLGDGDQDOtWLFD´6LTXHUHPRVFRQRFHUORVFRVWRVGHOWRPyJUDIRKDEUi
TXHGH¿QLUORFRPRXQFHQWURGHFRVWRVSXHVGH
otra forma los datos se recogerían en otro lugar:
UDGLRGLDJQyVWLFRFHQWURGHGLDJQyVWLFRSRULPiJHQHVHWF
8Q Q~PHUR PX\ JUDQGH GH FHQWURV GH FRVto permite tener información muy desagregada
±\QyWHVHWDPELpQPX\GLVSHUVD±\SRUWDQWR
podemos hacer preguntas sobre los costos de
PXFKDVFRVDVHOLQFRQYHQLHQWHUHVLGHHQODFDQWLGDG GH LQIRUPDFLyQ TXH VH PDQHMD \ OD FRPplejidad del sistema. Estos factores tienen dos
WLSRVGHFRVWRDVRFLDGRVXQQ~PHURGHFHQWURV
GHFRVWRVHOHYDGRUHTXLHUHFRVWRVGHHODERUDFLyQ
GH OD FRQWDELOLGDG PiV HOHYDGRV \ H[LVWH RWUR
FRVWRV PHQRV HYLGHQWH SHUR TXH H[LVWH LJXDOPHQWH TXH HV HO FRVWR GH LQWHUSUHWDFLyQ (Q
HIHFWRJUDQFDQWLGDGGHFHQWURVGHFRVWRVJHQHUDQPXFKDLQIRUPDFLyQTXHUHTXLHUHXQWLHPSR
LPSRUWDQWHSDUDVXDQiOLVLV8QJHUHQWHDWDUHDGR
TXHQRWLHQHWLHPSRGHOHHUXQDLQIRUPDFLyQGHPDVLDGRGHWDOODGDDFDEDSUHVFLQGLHQGRGHHOOD
FRQ OR TXH HO UHVXOWDGR HV TXH OD FRQWDELOLGDG
analítica acaba haciendo inútil. Es mejor tener
XQ SHTXHxR Q~PHUR GH FHQWURV GH FRVWRV PX\
VLJQL¿FDWLYRV\IiFLOHVGHHVWXGLDUFRQORTXHOD
LQIRUPDFLyQHV~WLO\HOJHUHQWHODDSURYHFKD
Otro criterio para establecer el número de
centros de costo se encuentra en el propósito del
hospital al introducir la contabilidad analítica. Si
HOREMHWLYRGHOFHQWURHVODWRPDGHGHFLVLRQHV VHJXQGRREMHWLYR ORVFHQWURVGHFRVWRVKDEUiQGH
DGDSWDUVHDORVOXJDUHVGRQGHVHSUHYHDTXHVHUi
QHFHVDULRWRPDUODV6LOD¿QDOLGDGGHODFRQWDELOLGDGDQDOtWLFDHVODHYDOXDFLyQGHOIXQFLRQDPLHQWR
GHORVGLUHFWLYRV WHUFHUREMHWLYR FRQYLHQHDGDStar los centros de costos a las unidades de gestión
siguiendo el organigrama del hospital.
/RVFHQWURVGHFRVWRTXHSUHWHQGHQFRQWURODU
la gestión de la organización reciben otro nombre: centros de responsabilidad. En este caso
H[LVWHXQUHVSRQVDEOHGHFDGDFHQWURGHFRVWRVD
TXLHQVHOHHYDOXDUiVXGHVHPSHxRSRUODFRQWDbilidad de este centro de costos. La contabilidad
SRUUHVSRQVDEOHVRFRQWDELOLGDGSDUDODSODQL¿FDción y la gestión tiene por objeto preparar de forma normalizada y rutinaria informes a la direcFLyQVREUHDVSHFWRVFXDQWL¿FDEOHVTXHUHÀHMDQOD
FDOLGDGGHOGHVHPSHxRGHVXVVXERUGLQDGRVHQ
TXLHQHVVHKDGHOHJDGRXQiUHDGHUHVSRQVDELOLGDG 9i]TXH]'RGHUR\9HOLOOD Empresas profit y non profit
/DVHPSUHVDVHQVHQWLGRDPSOLRHQVXDIiQSRU
REWHQHUEHQH¿FLRVWRPDQGHFRQWLQXRWUHVGHFLVLRQHV PX\ HVSHFt¿FDV HQ ODV LQGXVWULDV FRPSHWLWLYDV VL ELHQ HO PRGHOR KD GH DSOLFDUVH D
FXDOTXLHUPHUFDGR DVDEHU &XiQWDSURGXFFLyQYDQDRIUHFHU &yPRYDQDHODERUDUHVD
SURGXFFLyQ HVGHFLUTXpWpFQLFDWHFQRORJtDGH
SURGXFFLyQXVDUiQ \ 4XpFDQWLGDGGHFDGD
LQVXPRYDQDGHPDQGDU
6H VXSRQH TXH ODV HPSUHVDV H[LVWHQ FRQ HO
¿QGHREWHQHUEHQH¿FLRV\TXHWRPDQGHFLVLRQHV
SDUDPD[LPL]DUORV (QHVWHFRQWH[WRGH¿QLUHPRV EHQH¿FLRV FRPR OD GLIHUHQFLD HQWUH LQJUHVRV\FRVWRVHVWRHVVLQyQLPRGHUHQWDELOLGDG 6LQHPEDUJRH[LVWHQHPSUHVDVOODPDGDVVLQ
ánimo de lucro o QRQ SUR¿W \ VRQ SDUWLFXODU-
172 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
PHQWHQXPHURVDVHQHOiPELWRGHODVDOXGFX\D
PLVLyQRVHQWLGRGHODH[LVWHQFLDQRHVHQSULQFLSLRHO¿QGHOXFURVLQRHOEULQGDUEHQH¿FLRVD
sus asociados. En una organización QRQ SUR¿W
las acciones se encaminan a facilitar los mejores
VHUYLFLRVSRVLEOHVFRQORVUHFXUVRVGLVSRQLEOHV\
VXp[LWRVHPLGHHQSULPHUOXJDUSRUODFDQWLGDG
GHVHUYLFLRVTXHSURYHH\SRUODFDOLGDGGHORV
PLVPRV7HQLHQGRHQFXHQWDTXHHOFRQFHSWRGH
VHUYLFLRHVPiVYDJR\PHQRVVXVFHSWLEOHGHPHGLGDTXHHOEHQH¿FLRUHVXOWDPiVGLItFLOPHGLUHO
UHQGLPLHQWRHQXQDRUJDQL]DFLyQVLQ¿QGHOXFUR
SHURDSHVDUGHHVWRORVGLUHFWLYRVGHEHUtDQWUDWDU
GHDVHJXUDUTXHORVUHFXUVRVVHXWLOLFHQFRQH¿FDFLD\H¿FLHQFLD6LQHPEDUJRODGLVWLQFLyQHQtre ambos tipos de organizaciones no es radical.
8QD RUJDQL]DFLyQ TXH EXVFD HO EHQH¿FLR GHEH
SUHVWDUORVVHUYLFLRVTXHVXVFOLHQWHVHQFXHQWUHQ
DGHFXDGRV$OPLVPRWLHPSRXQDRUJDQL]DFLyQ
non SUR¿W GHEH UHFLELU IRQGRV D WUDYpV GH VXV
LQJUHVRVRGHRWUDVIXHQWHVTXHVHDQDOPHQRV
iguales a sus gastos si pretende continuar presWDQGRVHUYLFLRV
Las características de las organizaciones
QRQSUR¿WTXHDIHFWDQDOSURFHVRGH&RQWUROGH
*HVWLyQ VRQ ODV VLJXLHQWHV $QWKRQ\ <RXQJ
Ì$XVHQFLDGHXQDPHGLGDGHOEHQH¿FLR
Ì 'LIHUHQWH FRQVLGHUDFLyQ OHJDO H LPSRVLWLYD
Ì7HQGHQFLDDVHURUJDQL]DFLRQHVGHVHUYLFLRV
Ì 1RWDEOHV OLPLWDFLRQHV VREUH REMHWLYRV \ HVtrategias; Ì Menor dependencia de los clientes
SDUDHODSR\R¿QDQFLHURÌ Importancia de las
LQÀXHQFLDVSROtWLFDV
/DDXVHQFLDGHXQDPHGLGDGHOEHQH¿FLRHV
ODFDUDFWHUtVWLFDPiVLPSRUWDQWH\DTXHDIHFWDD
todas las organizaciones QRQSUR¿W. Las otras características afectan a muchas pero no a todas esWDVRUJDQL]DFLRQHV7RGDVODVRUJDQL]DFLRQHVXWLOL]DQUHFXUVRVSDUDSURGXFLUELHQHV\VHUYLFLRV
(VWRHVXWLOL]DQinputs para producir outputs. En
XQDRUJDQL]DFLyQTXHSHUVLJXHHOEHQH¿FLRpVWH
IDFLOLWDXQDPHGLGDJOREDOGHODH¿FDFLD\ODH¿ciencia. La ausencia de una única y satisfactoria
medida global del rendimiento comparable al
EHQH¿FLRHVHOSUREOHPDPiVVHULRTXHHQIUHQWDQ
ORVGLUHFWLYRVGHODVRUJDQL]DFLRQHVQRQSUR¿W en
el desarrollo de sistemas de Control de Gestión
SDUD VXV RUJDQL]DFLRQHV (Q RUGHQ D HYDOXDU OD
DQWHULRU D¿UPDFLyQ VH QHFHVLWD FRQVLGHUDU ODV
YHQWDMDVGHODPHGLGDGHOEHQH¿FLRTXHVRQ
D )DFLOLWDUXQ~QLFRFULWHULRTXHSXHGHVHUXWLOL]DGRHQODHYDOXDFLyQGHFXUVRVDOWHUQDWLYRV
de acción
E 3HUPLWLUXQDQiOLVLVFXDQWLWDWLYRHQDTXHOODV
SURSXHVWDVHQODVTXHORVLQJUHVRVSXHGHQVHU
directamente comparados con los costos
F 3URSRUFLRQDU XQD ~QLFD PHGLGD GHO UHQGLmiento
G )DFLOLWDUODGHVFHQWUDOL]DFLyQ
H &RPSDUDUORVUHQGLPLHQWRVHQWUHGLIHUHQWHV
organizaciones. La mayoría de las organizaciones QRQ SUR¿W son organizaciones de
VHUYLFLRV \ SRU HOOR QR WLHQHQ ODV PLVPDV
YHQWDMDVHQFXDQWRDO&RQWUROGH*HVWLyQTXH
ODVHPSUHVDVTXHSURGXFHQ\YHQGHQELHQHV
tangibles.
([LVWHQDOJXQDVLPSRUWDQWHVGLIHUHQFLDVHQtre ambos tipos de organizaciones:
D /RV VHUYLFLRV QR SXHGHQ VHU DOPDFHQDGRV
/RV ELHQHV SXHGHQ SHUPDQHFHU HQ LQYHQWDrios a la espera del pedido de los clientes.
Si los medios disponibles para prestar un
VHUYLFLR HQ XQ PRPHQWR GHWHUPLQDGR QR VH
XWLOL]DQORVLQJUHVRVSRWHQFLDOHVVHSLHUGHQ
GH¿QLWLYDPHQWH
E /DV RUJDQL]DFLRQHV GH VHUYLFLRV WLHQGHQ D
VHU LQWHQVLYDV HQ PHGLRV KXPDQRV$XQTXH
HVWDVRUJDQL]DFLRQHVUHTXLHUHQUHODWLYDPHQWHSRFRFDSLWDOSRUXQLGDGGHRXWSXWHOFRQtrol de este output es más difícil.
F 1R VLHPSUH UHVXOWD IiFLO PHGLU OD FDQWLGDG
GHVHUYLFLRVDFDXVDGHODKHWHURJHQHLGDG\
HVSHFL¿FLGDGGHFDGDXQRGHHOORV
G (VPX\GLItFLOLQVSHFFLRQDUODFDOLGDGGHXQ
VHUYLFLRGXUDQWHVXSUHVWDFLyQ/DFDOLGDGGH
los bienes tangibles puede determinarse anWHV GH VX HQWUHJD D ORV FOLHQWHV \ FXDOTXLHU
GHIHFWRUHVXOWDHYLGHQWH
'HQWURGHXQRVOtPLWHVDPSOLRVXQDRUJDQL]DFLyQTXHSHUVLJXHHOEHQH¿FLRSXHGHVHOHFFLRQDU
HO VHFWRU LQGXVWULDO HQ HO TXH HPSUHQGHUi QHJRFLRV7LHQH OD SRVLELOLGDG GH HVFRJHU HQWUH GLIHrentes formas de competir en el sector e incluso
SXHGH FDPELDU HVWDV HVWUDWHJLDV VLHPSUH TXH OR
GHFLGDQVXVGLUHFWLYRV(OFRUWRSOD]RHVHOSHUtRGRHQHOTXHVHFXPSOHQGRVFRQGLFLRQHV ODV
HPSUHVDVH[LVWHQWHVWLHQHQOtPLWHVLPSXHVWRVSRU
DOJ~QIDFWRUGHSURGXFFLyQ¿MR\ QRSXHGHQ
HQWUDUQXHYDVHPSUHVDVDODLQGXVWULDQLSXHGHQ
VDOLUGHHOODODVHPSUHVDV\DH[LVWHQWHV
$FRUWRSOD]RWRGDVODVHPSUHVDV FRPSHWLWLYDV\QRFRPSHWLWLYDV WLHQHQFRVWRVTXHGHEHQ
FXEULU QR LPSRUWD FXiO VHD VX SURGXFFLyQ (Q
UHDOLGDG FLHUWRV FRVWRV GHEHQ SDJDUVH DXQTXH
8 - Gestión presupuestaria y gestión de costos en la organización / 173
ODHPSUHVDGHMHGHSURGXFLU HVGHFLUDXQTXHOD
SURGXFFLyQVHDFHUR $HVHWLSRGHFRVWRVHOH
FRQRFHFRPRFRVWRV¿MRV\ORTXHHVLPSRUWDQWH
UHFRUGDUDFHUFDGHHOORVHVTXHODVHPSUHVDVQR
pueden hacer nada a corto plazo para eludirlos o
PRGL¿FDUORV/DVHPSUHVDVQRWLHQHQFRVWRV¿MRVDODUJRSOD]RSXHVWRTXHSXHGHQH[SDQGLUVH
contraerse o salir de la industria.
Las empresas también tienen ciertos costos a
FRUWRSOD]RTXHGHSHQGHQGHOQLYHOGHSURGXFFLyQ TXH FDGD XQD KD\D HOHJLGR VH OHV FRQRFH
FRPRFRVWRVYDULDEOHV(QFRQMXQWRORVFRVWRV
¿MRV\ORVFRVWRVYDULDEOHVFRQVWLWX\HQHOFRVWR
WRWDOHVGHFLUORVFRVWRVWRWDOHVVLHQGR
CT = CFT + CVT
donde CT VRQ ORV FRVWRV WRWDOHV CFT son los
FRVWRV¿MRVWRWDOHV\CVT VRQFRVWRVYDULDEOHV
$OKDEODUGHFRVWRV¿MRVGHEHPRVGLVWLQJXLU
HQWUH FRVWRV ¿MRV WRWDOHV \ FRVWRV ¿MRV PHGLRV
VLHQGRHVWH~OWLPRHOFRVWR¿MRWRWDOGLYLGLGRSRU
la cantidad de unidades producidas. Éstos son
ORV FRVWRV TXH GLVPLQX\HQ DO DXPHQWDU OD SURGXFFLyQ \D TXH HO WRWDO VH UHSDUWH HQWUH PD\RU
Q~PHURGHXQLGDGHVIHQyPHQRTXHDYHFHVVH
llama dispersión de los gastos generales.
/RV FRVWRV YDULDEOHV SXHGHQ FODVL¿FDUVH HQ
WUHVFDWHJRUtDVFRVWRYDULDEOHWRWDOFRVWRPDUJLQDO\FRVWRYDULDEOHPHGLR/RVFRVWRVYDULDEOHV
WRWDOHV VRQ ORV FRVWRV TXH D FRUWR SOD]R VRODPHQWHYDUtDQRVRQGHSHQGLHQWHVFRQUHVSHFWRDO
QLYHOGHSURGXFFLyQ
3DUD FDOFXODU VXV SRVLEOHV EHQH¿FLRV ODV
empresas deben combinar sus análisis de costo
con información sobre los ingresos potenciales
SURFHGHQWHV GH ODV YHQWDV 'HVSXpV GH WRGR VL
XQDHPSUHVDQRHVFDSD]GHYHQGHUVXSURGXFWR
DPiVGHORTXHOHFXHVWDSURGXFLUORQRSRGUi
permanecer mucho tiempo en el negocio. En
FDPELR VL HO PHUFDGR SHUPLWH TXH OD HPSUHVD
HVWDEOH]FD XQ SUHFLR VLJQL¿FDWLYDPHQWH PD\RU
GH OR TXH OH FXHVWD HODERUDU XQD XQLGDG GH VX
SURGXFWR HQWRQFHV GLFKD HPSUHVD SRGUi WHQHU
XQLQFHQWLYRSDUDDFUHFHQWDUVXSURGXFFLyQ/DV
grandes utilidades resultantes pueden atraer
WDPELpQDQXHYRVFRPSHWLGRUHVDOPHUFDGR
COSTES HOSPITALARIOS
(OKRVSLWDOPRGHUQRHVXQDRUJDQL]DFLyQLQYHUWLGDFRPRWRGDVODVHPSUHVDVGHVHUYLFLRVDXQ-
TXH FRQ XQD HVWUXFWXUD RUJDQL]DWLYD SDUWLFXODU
la capacidad de decisión radica en su personal
GH FRQWDFWR TXH HV TXLHQ HVWDEOHFH OD UHODFLyQ
FRQ HO FOLHQWH H[WHUQR \ TXLHQ FDQDOL]D VXV H[SHFWDWLYDVGHVHRV\QHFHVLGDGHV(QODVHPSUHVDV SURGXFWLYDV FOiVLFDV HVWH HVODEyQ OD EDVH
GHODSLUiPLGHOOHYDDFDERIXQGDPHQWDOPHQWH
ODVWDUHDVPHFiQLFDV\RSHUDWLYDV(VWDVLWXDFLyQ
LQXVLWDGDREOLJDDSURYHHUXQDHVWUXFWXUDGHVRSRUWHDORVSURIHVLRQDOHVPXFKRPiVDPSOLDTXH
VXHTXLYDOHQWHHQXQDHPSUHVDSURGXFWLYDVHLQFOX\HQHQpOORVPpGLFRV\HQIHUPHUDVFDGDXQR
UHVSRQVDEOHGHVXSURSLDOtQHDGHWUDEDMRXQLGDG
asistencial o recursos concretos. Otra diferencia
básica entre el personal de contacto del hospital
\HOGHRWURWLSRGHHPSUHVDVGHVHUYLFLRVUDGLFDHQTXHDTXHOQRVyORGLULJHODVH[SHFWDWLYDV
VLQRWDPELpQFUHDHOVHUYLFLRHLQGXFHODGHPDQda de prestaciones o de productos intermedios
GHQWUR GHO SURSLR VDQDWRULR R KDFLD HO H[WHULRU
cuyo costo no repercute en el entorno ni en el
FOLHQWHQLHQHOSURIHVLRQDOTXHORVSLGHVLQRHQ
HOGHOSURSLRKRVSLWDO\HQHOGHO¿QDQFLDGRU\
HOVLVWHPDHQJHQHUDO'HKHFKR\SRUHMHPSOR
el laboratorio y la radiología se nutren de esta
GHPDQGD \ HVWiQ VRPHWLGDV D ODV ÀXFWXDFLRQHV
GHULYDGDV GH OD SUiFWLFD FOtQLFD HYROXFLyQ GHO
conocimiento e incluso de la cultura hospitaODULD (VWH SHUVRQDO GH FRQWDFWR FUHD DGHPiV
XQ YDORU DxDGLGR TXH HVWi UHSUHVHQWDGR SRU XQ
PD\RUJUDGRGHFRQRFLPLHQWRWRPDQGRWRGDVR
FDVL WRGDV ODV GHFLVLRQHV TXH JHQHUDQ FRVWR HQ
una institución hospitalaria.
COSTE MARGINAL
Realizaremos algunas consideraciones pertinentes sobre un concepto cardinal en economía:
el costo marginal. El costo incremental o costo
marginalHVHOTXHUHVSRQGHDHVWDLPSRUWDQWtVLPDSUHJXQWD¢&XiQWRYDDFRVWDUSURGXFLUXQD
XQLGDGDGLFLRQDOGHSURGXFWRRSUHVWDUXQDXQLGDGDGLFLRQDOGHVHUYLFLR"6HOODPDFRVWRmarginalQRSRUTXHVHDSRFRLPSRUWDQWH\KD\DTXH
GHMDUOR DO PDUJHQ VLQR SRUTXH HV LQFUHPHQWDO
RFXUUHDO¿QDORPDUJHQGHODHVWUXFWXUDGHFRVWRV(QDOJXQDVHPSUHVDVORVFRVWRVPDUJLQDOHV
y medios son casi iguales. Esto sucede cuando
ORV FRVWRV PHGLRV VRQ DSUR[LPDGDPHQWH FRQVWDQWHV\SRUORWDQWRFXDQGRKDFHUXQDXQLGDG
PiV FXHVWD DOUHGHGRU GH OR PLVPR TXH KDFHU
cada una de las cien o mil unidades anteriores.
174 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
1RREVWDQWHORVFRVWRVPDUJLQDOHV\PHGLRV
VXHOHQ VHU GLIHUHQWHV 3RU HMHPSOR PXFKDV HPSUHVDV VREUH WRGR ODV TXH UHTXLHUHQ XQD JUDQ
LQIUDHVWUXFWXUD \ XQD JUDQ LQYHUVLyQ GH FDSLWDO
como las líneas aéreas o las telecomunicaciones
\ DJUHJDUtDPRV ORV KRVSLWDOHV WLHQHQ XQD HVWUXFWXUDGHFRVWRVPHGLRVHOHYDGD6XHOHVHUDVt
en especial cuando se tienen en cuenta los cosWRV¿MRVGHFDSLWDO\FXDQGRHOFRVWRGHSURGXFLU
XQD XQLGDG PiV GH SURGXFWR SRU HMHPSOR XQD
OODPDGD PiV GH WHOpIRQR R OOHYDU D XQ SDVDMHUR
PiVHQXQDYLyQRXQHJUHVRRXQDFRQVXOWD HV
PX\UHGXFLGR(QHOFDVRGHXQ%RHLQJTXH
\DHVWpSURJUDPDGRSDUDYRODUHQWUH1XHYD<RUN
\%RVWRQSRUHMHPSOR\TXHWHQJDSOD]DVOLEUHV
HOFRVWRGHOOHYDUDXQSDVDMHURDGLFLRQDO HOFRVWR
PDUJLQDO HVFHUFDQRDFHUR1RREVWDQWHHOFRVWR
PHGLRGHOOHYDUDHVHSDVDMHUR±WHQLHQGRHQFXHQWDWRGRVORVFRVWRVGHOYXHORLQFOX\HQGRHOFRPEXVWLEOHHOVDODULRGHODWULSXODFLyQORVFRVWRVGH
FDSLWDOGHODYLyQ\GHPiV\GLYLGLpQGRORVHQWUH
FLHQRGRVFLHQWRVSDVDMHURV±SXHGHVHUHOHYDGR
(QHVWDVLWXDFLyQSXHGHUHVXOWDUUHQWDEOHSDUDOD
OtQHDDpUHDOOHYDUDHVHSDVDMHURDXQTXHSDJXHXQ
precio muy reducido por su pasaje.
/DQRUPDEiVLFDHVTXHHQODPHGLGDHQTXHHO
SUHFLRGHOSURGXFWR HQHVWHFDVRHOSDVDMH VXSHUHHOFRVWRPDUJLQDOODHPSUHVDHVWDUiREWHQLHQGR
EHQH¿FLR FRQ HVH SDVDMHUR R XQLGDG GH SURGXFción determinado. Los costos marginales bajos
LQGLFDQTXHODVWDULIDVUHGXFLGDVSXHGHQUHVXOWDU
UHQWDEOHVVLHPSUH\FXDQGRFRQVLJDQTXHODVSOD]DVYDFDQWHV TXHQRJHQHUDQEHQH¿FLR GHMHQGH
VHUOR\JHQHUHQSRUORPHQRVDOJ~QLQJUHVR
5HQWDEOHHQHVWHFDVRQRVLJQL¿FDTXHHOSDVDMHFXEUDWRGRVORVFRVWRVFRVDTXHSUREDEOHPHQWH
QRKDFHVLQRTXHSRUORPHQRVVHDHTXLYDOHQWHD
ORTXHFXHVWDWUDQVSRUWDUDHVHSDVDMHUR
/DV HPSUHVDV TXH WLHQHQ EDMRV FRVWRV PDUginales pueden hacerse rentables aumentando el
JUDGRGHXWLOL]DFLyQGHVXFDSDFLGDG+D\YDULDV
formas de conseguirlo. Las empresas telefónicas y
GHHOHFWULFLGDGRIUHFHQHQRFDVLRQHVGHVFXHQWRV
SDUDHOFRQVXPRHQKRUDVSRFRGHPDQGDGDV FRPR
ODQRFKHRORV¿QHVGHVHPDQD HQODVTXHORVFRVtos marginales son bajos y el grado de utilización
WDPELpQORHV/DVOtQHDViUHDVRIUHFHQYXHORVHFRQyPLFRVSDUDORVSDVDMHURVTXHHVWiQHQODOLVWDGH
HVSHUD\WDULIDVHVSHFLDOHVGH¿QGHVHPDQD
3RUVXSXHVWRFRQHOSDVRGHOWLHPSRVHWLHQHQ
TXH FXEULU WRGRV ORV FRVWRV LQFOXLGRV ORV ¿MRV
No se puede utilizar la determinación de precios
sólo en función de los costos marginales de ma-
QHUDLQGH¿QLGDSDUDPLQLPL]DUODVSpUGLGDVSRUTXHORVGXHxRVGHOFDSLWDOORUHWLUDUiQSDUDRWUR
OXJDUHQHOTXHSXHGDQREWHQHUXQDJDQDQFLDHQ
YH]GHXQDSpUGLGD1RREVWDQWHDFRUWRSOD]R
si su capital está atrapado en su empleo actual
\QRVHSXHGHVDFDUGHDKtIiFLOQLUiSLGDPHQWH
WHQGUiTXHKDFHUORPHMRUTXHSXHGD
<DTXHGDFODUDODLPSRUWDQFLDGHOFRVWRPDUginal al menos en el corto plazo. Agreguemos
TXHSDUDODVHPSUHVDVSHUIHFWDPHQWHFRPSHWLWLYDVHOFRVWRPDUJLQDOHVLJXDODOFRVWRYDULDEOH
MARGEN DE CONTRIBUCIÓN
Otro concepto importante es el de margen de
contribución. La idea central de margen de conWULEXFLyQHVTXpFDXGDOGHGLQHURGHODYHQWDR
ODIDFWXUDFLyQTXHGDGLVSRQLEOHXQDYH]GHVFRQWDGRVORVFRVWRVYDULDEOHVSDUDOLFXDUORVFRVWRV
¿MRV(VGHFLUGDXQDLGHDGHXQDutilidadTXHGH
RWURPRGRQRVHWHQGUtD\DTXHORVFRVWRV¿MRV
VLHPSUHWLHQHQTXHSDJDUVH
6L ORV LQJUHVRV VRQ PHQRUHV TXH ORV FRVWRV
YDULDEOHVODHPSUHVDVXIUHSpUGLGDGHRSHUDFLyQ
y el total de sus pérdidas será superior a sus cosWRV¿MRV3RUORWDQWRODHPSUHVDVyORSXHGHPLnimizar sus pérdidas si cierra sus puertas.
COSTO TOTAL
(FIJO MÁS VARIABLE)
COSTO VARIABLE
MÉDICO
COSTO FIJO
COSTO
MARGINAL
INGRESO
MARGINAL
MARGEN DE
CONTRIBUCIÓN 1
INGRESO
MARGINAL 2
MARGEN DE
CONTRIBUCIÓN 2
8 - Gestión presupuestaria y gestión de costos en la organización / 175
5HFRUGHPRV DTXt TXH OD UHODFLyQ HQWUH LQVXPRV \ SURGXFWRV HV GHFLU OD WHFQRORJtD GH
SURGXFFLyQ H[SUHVDGD HQ WpUPLQRV QXPpULFRV
o matemáticos recibe el nombre de función de
SURGXFFLyQ /DV FXUYDV GH SURGXFFLyQ D FRUWR
plazo dependen del supuesto de un factor de
SURGXFFLyQ ¿MR &XDQGR OD SURGXFFLyQ VH LQFUHPHQWDPiVDOOiGHFLHUWRSXQWRHOIDFWRU¿MR
SURYRFD TXH ORV GHPiV WHQJDQ XQ UHQGLPLHQWR
decreciente y por lo tanto incrementa los costos
PDUJLQDOHV 6LQ HPEDUJR HQ HO ODUJR SOD]R QR
H[LVWHQWDOHVIDFWRUHV¿MRVGHSURGXFFLyQ\DTXH
ODVHPSUHVDVSXHGHQHOHJLUFXDOTXLHUHVFDODGH
producción.
7pFQLFDPHQWH OD H[SUHVLyQ UHQGLPLHQWRV
FUHFLHQWHVDHVFDODVHUH¿HUHDODUHODFLyQHQWUH
LQVXPRV \ SURGXFWRV &XDQGR VH GLFH TXH XQD
función de producción tiene un rendimiento
FUHFLHQWH TXHUHPRV GHFLU TXH XQ LQFUHPHQWR
SRUFHQWXDOFXDOTXLHUDHQHOYROXPHQGHSURGXFFLyQ UHTXLHUH XQ LQFUHPHQWR SRUFHQWXDO PHQRU
HQWpUPLQRVGHLQVXPRV3RUHMHPSORSDUDTXH
XQDHPSUHVDGXSOLFDUDVXSURGXFFLyQQHFHVLWDría menos del doble de cada uno de los insumos
TXHLQWHUYLHQHQHQGLFKDSURGXFFLyQ'LFKRGH
RWURPRGRVLXQDHPSUHVDGXSOLFDRWULSOLFDVXV
LQVXPRVVXSURGXFFLyQVHDFUHFHQWDUiDPiVGHO
doble o el triple. Cuando las empresas pueden
FRQWDUFRQSUHFLRV¿MRVGHORVLQVXPRV±HVGHFLUFXDQGRHVWRVSUHFLRVQRFDPELDQGHDFXHUGR
FRQ ORV QLYHOHV GH SURGXFFLyQ± HO UHQGLPLHQWR
DHVFDODFUHFLHQWHVLJQL¿FDWDPELpQTXHDPHGLGD TXH DXPHQWD OD SURGXFFLyQ GLVPLQX\H VX
FRVWRPHGLR/DH[SUHVLyQeconomía de escala
VHUH¿HUHGLUHFWDPHQWHDHVDUHGXFFLyQGHOFRVWR
SRUXQLGDGGHSURGXFFLyQFXDQGRODPHQFLRQDda producción se realiza en mayor escala. Casi
WRGDVODVHFRQRPtDVGHHVFDODTXHQRVYLHQHQGH
pronto a la mente son de carácter tecnológico.
3RUHMHPSORODSURGXFFLyQGHDXWRPyYLOHVVHUtD
mucho más costosa por unidad si una empresa
IDEULFDUDORVYHKtFXORVDPDQR
Pero algunas economías de escala no se deben
DODWHFQRORJtDVLQRDOVLPSOHWDPDxR3RUHMHPSORODVFRPSDxtDVPX\JUDQGHVSXHGHQFRPSUDU
LQVXPRVSRUYROXPHQDSUHFLRVGLVPLQXLGRV/DV
empresas grandes también pueden producir algunos de sus insumos con considerables ahorros.
3RGHPRVYHUHFRQRPtDVGHHVFDODHQWRGDVSDUWHV
VLODVEXVFDPRV8QFROHFWLYRTXHWUDQVSRUWDD
3RUHMHPSORHO+RVSLWDO*DUUDKDP
SHUVRQDVUHTXLHUHPHQRVWUDEDMRFDSLWDO\JDVRLO
TXHSHUVRQDVFRQGXFLHQGRDXWRPyYLOHV
(OFRVWRSRUSDVDMHUR FRVWRPHGLR HVPiVEDMR
HQHOFROHFWLYR/RVFRPSDxHURVTXHFRPSDUWHQ
XQ DSDUWDPHQWR DSURYHFKDQ ODV HFRQRPtDV GH
HVFDOD/RVFRVWRVGHFDOHIDFFLyQHOHFWULFLGDG\
espacio por persona son más bajos en un apartaPHQWRFRPSDUWLGRTXHVLFDGDSHUVRQDDOTXLODXQ
apartamento por separado.
METODOLOGÍA DE COSTEO INSTITUCIONAL. ANÁLISIS
CONVENCIONAL. COSTES DIRECTOS E INDIRECTOS
Se consideran clásicamente:
(OPDWHULDOGLUHFWRRJDVWRHQUHFXUVRVPDWHULDOHVHVGHFLUORVELHQHVHLQVXPRVGHXVR
GLDULR GLUHFWDPHQWH LQYROXFUDGRV HQ OD SURGXFFLyQGHXQVHUYLFLRXRSHUDFLyQ(QHVWH
FDVRODFRPSUDGHELHQHVVHSXHGHLPSXWDU
DOVHUYLFLRSDUDHOTXHVHXWLOL]DUiQ
/DPDQRGHREUDGLUHFWDRJDVWRGHUHFXUVR
humano necesario para brindar las prestacioQHV TXH LQFOX\H VXHOGRV GH SHUVRQDO HQ UHODFLyQGHGHSHQGHQFLDPiVFDUJDVVRFLDOHV
KRQRUDULRV ¿MRV VL ORV KXELHUD \ KRQRUDULRV
YDULDEOHVVLVXUJLHUDQFRPRIUXWRGHOSDJRGH
SUHVWDFLRQHV GH WHUFHURV SRU HMHPSOR EDMR
la metodología de retribución del hospital
público de autogestión o sistemas análogos
como SAMICHWF /RV FRVWRV LQGLUHFWRV HV GHFLU ODV HURJDFLRQHV QHFHVDULDV SDUD OOHYDU D FDER ODV
SUHVWDFLRQHVGHORVVHUYLFLRVTXHQRSXHGHQ
DWULEXLUVHDQLQJXQRHQSDUWLFXODURTXHVRQ
compartidos.
Cuando se precise desagregar en el costo
GHXQELHQRVHUYLFLRFXiQWRSHVDQVXVGLYHUVRV
FRQVWLWX\HQWHV FRQWDEOHV KDEODPRV GH FRVWRV
GLUHFWRV H LQGLUHFWRV 'HEH UHFRUGDUVH TXH HQ
HOWHUUHQRFRQWDEOHDPERVWLHQHQXQVLJQL¿FDGR
UHODWLYRGDGRSRUHOPDUFRUHIHUHQFLDOHQHOTXH
VHORVFRQWH[WXDOLFH&RVWRGLUHFWRHVDTXHOTXH
SXHGH LGHQWL¿FDUVH XQtYRFDPHQWH FRQ HO ELHQ
SURGXFLGR R FRQ XQ iUHD GH SURGXFFLyQ PLHQWUDVTXHHOFRVWRLQGLUHFWRHVDTXpOTXHQRSXHGH
FXPSOLU FRQ GLFKRV UHTXLVLWRV SRUTXH VRQ FRPXQHVDYDULRVELHQHVRDGLYHUVDVXQLGDGHVGH
producción. Son indirectos los gastos generales
176 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
GH SURGXFFLyQ DTXHOORV FRVWRV TXH GHPDQGDQ
HO PDQWHQLPLHQWR GH OD HVWUXFWXUD SURGXFWLYD
QR GLUHFWDPHQWH DWULEXLEOHV DO VHUYLFLR R ELHQ
SURGXFLGR\TXHQRSXHGHQLGHQWL¿FDUVHGLUHFWDPHQWH FRQ ORV PLVPRV R FRQ HO iUHD TXH OR
SURGXMRVLQRTXHVHUHSDUWHQHQIRUPDJHQpULFD
como costos de toda la organización.
(VTXHPiWLFDPHQWH SDUD IDEULFDU XQ GHWHUPLQDGRELHQHOPDWHULDO\ODPDQRGHREUD
LPSOLFDGRV VRQ ORV FRVWRV GLUHFWRV PLHQWUDV
TXH ORV JDVWRV FRPXQHV GH PDQWHQLPLHQWR \
IXQFLRQDPLHQWRGHODHPSUHVD SHMJDVWRVGH
OLPSLH]DGHHQHUJtDHOpFWULFDDGPLQLVWUDWLYRV
DOTXLOHUHVRDPRUWL]DFLyQGHLQPXHEOHVVHJXURV HWF GHEHQ FRQVLGHUDUVH FRPR FRVWRV LQGLUHFWRV(VWRSDUHFHVLPSOHSHUROOHYDGRDOD
SUiFWLFD QR OR HV SRUTXH VL GHEHPRV UHDOL]DU
una correcta imputación de gastos debe determinarse cuáles son los criterios correctos de
DVLJQDFLyQGDGRTXHORVPRQWRVGHSHQGHUiQGH
la unidad de análisis elegida: desde la óptica de
la unidad de análisis hospitalSRUHMHPSORHQ
XQRGHORVSRORVWRGRVORVJDVWRVVRQGLUHFWRV
6L HQ FDPELR FRQVLGHUDPRV XQ VHUYLFLR FXDOTXLHUD GHQWUR GH pO FRPR OD IDUPDFLD KDEUi
costos directos representados por los sueldos
R FRPSUDV GLYHUVDV \ RWURV FRPSDUWLGRV TXH
VHUiQ LQGLUHFWRV FRPR HO WHOpIRQR OD OX] R OD
OLPSLH]DWHQLHQGRTXHGHWHUPLQDUVHPHGLDQWH
algún factor de atribución la parte proporcional
TXHOHFRUUHVSRQGHUiDHVWHVHUYLFLR
&DGDFRVWR¿QDOHVWDUiLQWHJUDGRSRUORVFDUJRV GLUHFWRV SURSLRV GH FDGD VHUYLFLR R FHQWUR
GH FRVWRV PiV ORV WUDQVIHULGRV TXH SXHGHQ VHU
LQWHUGHSDUWDPHQWDOHV\RUHFLELGRVGHXQRRPiV
órganos centrales y representar un producto o
VHUYLFLRWDQJLEOHGLVWULEXLGR\UHFLELGRGHRWURV
sectores por prorrateo. En relación a la unidad
GHSURGXFFLyQHVQHFHVDULRLGHQWL¿FDUXQDXQLGDGGHPHGLGDTXHUHÀHMHHOHVIXHU]RGHSURGXFFLyQGHXQVHUYLFLRRVXSURGXFFLyQFRQFUHWD\
HVWDXQLGDGGHEHYDORUDUVHVHJ~Q
‡ TXH UHVSRQGD DO SULQFLSLR GH XQLIRUPLGDG
FDGDYH]TXHVHODXWLOL]D
‡TXHWHQJDXQVLJQL¿FDGRFRP~QWDQWRSDUDHO
VHFWRUSULYDGRFRPRS~EOLFR
‡TXHVHSUHVWHDPpWRGRVHVWDGtVWLFRV\GHFRQtabilidad
‡TXHWHQJDUHODFLyQGLUHFWDFRQODWDUHDTXHVH
UHDOL]D\VHDFRQWURODGDSRUTXLHQODFXPSOH
\VXSHUYLVD
‡TXHVHDIiFLOPHQWHFRPSXWDEOH\FRUSRUL]Dble físicamente
Son ejemplos de unidades de producción
R GH PHGLGD HO NLORJUDPR GH URSD SURFHVDGD
/DYDGHUR HO NLOR GH UHVLGXRV SDWROyJLFRV OD
UDFLyQDOLPHQWLFLD FRFLQD ODRUGHQGHWUDEDMR
FXPSOLGDRHOPHWUDMHFXDGUDGR PDQWHQLPLHQWR OD FDQWLGDG GH WRPDV GH HOHFWULFLGDG OX] R GH ERFDV GH JDV JDV R GH FDQLOODV DJXD R
OtQHDV WHOHIyQLFDV 7( HO DQiOLVLV UHDOL]DGR
/DERUDWRULR ODXQLGDGGHVDQJUHWUDQVIXQGLGD
+HPRWHUDSLD HOSDFLHQWHGtD ,QWHUQDFLyQ \OD
FRQVXOWD &RQVXOWRULRV([WHUQRV HQWUHRWURV
'HEH GHWHUPLQDUVH VL VH WUDWD GH XQD HYDluación a corto o largo plazo. En el corto plazo
VH YHQ ORV GRV WLSRV GH FRVWRV /RV SULPHURV
están en relación a los costos considerados
LQGHSHQGLHQWHV GHO QLYHO GH SURGXFFLyQ GH OD
HPSUHVD VHD TXH pVWD IXQFLRQH R QR DOTXLOHU
RDPRUWL]DFLyQGHOHGL¿FLROX]DJXDSHUVRQDO
GH YLJLODQFLD HWF /RV FRVWRV YDULDEOHV VRQ
DTXHOORV UHODFLRQDGRV FRQ ODV FDQWLGDGHV YDULDEOHV HPSOHDGDV SDUD XQ GHWHUPLQDGR QLYHO
GH SURGXFFLyQ OD PDWHULD SULPD XWLOL]DGD OD
PDQR GH REUD HWF (Q JHQHUDO VRQ DTXHOORV
HOHPHQWRVRIDFWRUHVHQORVTXHDODXPHQWDUOD
producción aumenta su consumo. El costo total
HVODVXPDGHDPERV'HQWURGHHVWHFULWHULRHO
costo medio de producción son los costos toWDOHV &7 GLYLGLGRV SRU HO Q~PHUR GH ELHQHV
SURGXFLGRV 4 6H REVHUYD TXH ORV FRVWRV PHGLRV GLVPLQX\HQKDVWDXQSXQWRDSDUWLUGHOTXHFRPLHQ]DQ
DDXPHQWDUGHQXHYR/RTXHVLJQL¿FDTXHPDQWHQLHQGR ¿MRV ORV IDFWRUHV GH SURGXFFLyQ PDTXLQDULDV \ DXPHQWDQGR ORV IDFWRUHV YDULDEOHV
FDQWLGDG GH REUHURV VL ELHQ LQFUHPHQWDUi OD
SURGXFFLyQ HO FRVWR XQLWDULR GHVFHQGHUi KDVWD
XQSXQWRySWLPRDSDUWLUGHOTXHFRPHQ]DUiRWUD
YH]DDXPHQWDU3RUORTXHXQSULPHUFRURODULR
HVTXHQRSXHGHQDXPHQWDUVHORVIDFWRUHVYDULDEOHVGHPRGRLQGH¿QLGRGDGRTXHODSURGXFFLyQ
VHUi LQH¿FLHQWH 8Q PpWRGR GH SURGXFFLyQ HV
WpFQLFDPHQWH H¿FLHQWH VL OD SURGXFFLyQ TXH VH
REWLHQHHVODPi[LPDSRVLEOHFRQODVFDQWLGDGHV
GHIDFWRUHVHVSHFL¿FDGRV
3HURODVLWXDFLyQSXHGHYDULDUDODUJRSOD]R(V
SRVLEOH TXH OD HPSUHVD GHFLGD DXPHQWDU PXFKR
PiVODSURGXFFLyQSHURSRUORYLVWRDQWHULRUPHQWH GHEHUi HYLWDU ORV FRVWRV FUHFLHQWHV GHO FRVWR
PHGLR+DEUiTXHPRGL¿FDUORVIDFWRUHVGHSURGXFFLyQ¿MRVHVGHFLUODVPDTXLQDULDVRHOHVSDFLRGHOWDOOHU(VWRVXFHGHSRUTXHHQHOODUJRSOD]R
ODHPSUHVDWLHQHWLHPSRGHPRGL¿FDUDOJXQRVR
WRGRVORVIDFWRUHVSURGXFWLYRV6LELHQKDEUiXQ
8 - Gestión presupuestaria y gestión de costos en la organización / 177
DXPHQWRGHOFRVWRWRWDOGHSURGXFFLyQORTXHDOD
empresa le interesa es conocer si los costos medios son decrecientes luego del incremento de los
IDFWRUHV SURGXFWLYRV (VWR SXHGH VLJQL¿FDU TXH
los costos medios por unidad de producto sean
GHFUHFLHQWHV\TXHSRUHQGHODH[SDQVLyQGHOD
SURGXFFLyQ YD\D DFRPSDxDGD GH XQD UHGXFFLyQ
GHOFRVWRXQLWDULRGHOSURGXFWR6HGLFHTXHWLHne rendimientos crecientes o economía de escala.
3HUR SXHGH VXFHGHU TXH DXPHQWDQGR OD SURGXFFLyQ DXPHQWH HO FRVWR PHGLR SRU XQLGDG GH OR
SURGXFLGR 7HQGUi UHQGLPLHQWRV GHFUHFLHQWHV R
GHVHFRQRPtD GH HVFDOD 7DPELpQ SXHGH VHU TXH
los costos medios se mantengan constantes para
FDGD XQLGDG GH OR SURGXFLGR VH GLFH TXH WLHQH
rendimientos de escala constantes.
ETAPAS PARA EL CONTROL DE GESTIÓN
Deben considerarse:
1.El establecimiento de un nomenclador o caWiORJRPDHVWURHQHOTXH¿JXUHQORVSURGXFtos hospitalarios
ODLPSXWDFLyQGHFRVWRVSRUFXHQWDV\DTXHHO
REMHWLYRSULQFHSVGHODFRQWDELOLGDGDQDOtWLFD
HVODDIHFWDFLyQGHFRVWRVDQLYHO³PLFURPpWULFR´ORPDVGLUHFWDFODUD\XQtYRFDTXHVHD
SRVLEOH([LVWHQDOPHQRVFXDWURQLYHOHV4:
‡(OKRVSLWDO
‡(OOODPDGRFHQWURGHUHVSRQVDELOLGDG &5 ‡/DOODPDGDXQLGDGGHJHVWLyQ 8* (VWRV
WUHV QLYHOHV FXPSOHQ FRQ OR UHTXHULGR
SDUDXQFRQWUROHVSHFt¿FR\DTXHVHSRseen una afectación directa de medios y
una persona responsable.
‡/DXQLGDGGHDQiOLVLV 8$ 5HSUHVHQWDOD
LGHQWL¿FDFLyQGHODVDFWLYLGDGHVGHOKRVSLWDOGH¿QLGDVGHDFXHUGRDOQRPHQFODGRU
\HVHOPiVSHTXHxRQLYHOGHDIHFWDFLyQ
posible.
'H¿QLUODVXQLGDGHV(OKHFKRGHPHGLUORV
FRVWRVWLHQHYHUGDGHURVHQWLGRYLQFXOiQGRORV
FRQDFWLYLGDGHVHVSHFt¿FDV6XHOHQRREVWDQte ser difícil –o incluso imposible– medir la
DFWLYLGDG GH ORV VHUYLFLRV DGPLQLVWUDWLYRV R
GHDSR\RRDXQORVDVLVWHQFLDOHV véase más
adelante en este mismo capítulo 4.La determinación de costos por unidad. El objeWLYRHVHYDOXDUHOPRQWRGHOSUHVXSXHVWRWHyULFR
4
SRUJUXSRVGHXQLGDGGHDFWLYLGDGKRPRJpQHD
DWUDYpVGHXQFiOFXORTXHYDORULFHODDFWLYLGDG
realizada contra un costo de referencia.
5HVXPLHQGRODSULQFLSDOUD]yQGHVHUGHXQ
departamento de Control de Gestión es contribuir
al mantenimiento de la calidad de los cuidados
PpGLFRVEULQGDGRVSRUXQDLQVWLWXFLyQDUELWUDQdo los medios para el adecuado manejo dentro
GHODVOLPLWDFLRQHVSUHVXSXHVWDULDVTXHSXGLHVHQ
H[LVWLU TXHVLHPSUHH[LVWHQGHKHFKR 'HEHUtD
LPSOHPHQWDUVHXQSURFHVRGHHYDOXDFLyQGHODV
DFWLYLGDGHV PpGLFDV WHQLHQGR HQ PHQWH TXH OD
SUiFWLFDGHXQDDFWLYLGDGcostosaQRHVQHFHVDULDPHQWHPDOD\DTXHORTXHHQYHUGDGGHEHHYDOXDUVHHVVLVHMXVWL¿FDQPpGLFDPHQWHORVPHGLRV
utilizados en relación a los resultados obtenidos.
De forma sintética entonces: es mandatorio reaOL]DUVLPXOWiQHDPHQWHXQDHYDOXDFLyQPpGLFD\
XQD HFRQyPLFD SDUD DOFDQ]DU XQD DWHQFLyQ H¿ciente en el manejo de los recursos.
Analítica metodológica
Se consideran usualmente las siguientes unidades de organización de un establecimiento asisWHQFLDOGHDFXHUGRDOSURGXFWR¿QDO
, 6HFWRUHV )LQDOHV R GH OtQHD ORV VHUYLFLRV
LQYROXFUDGRV GLUHFWDPHQWH HQ ORV SURGXFWRV
KRVSLWDODULRV ¿QDOHV \ EiVLFRV FRQVXOWDV \
egresos. Implican a toda la nómina de proIHVLRQDOHV PpGLFRV TXH UHDOL]DQ WDUHDV GH
FRQVXOWDH[WHUQDJXDUGLDHLQWHUQDFLyQ&DGD
uno de ellos es un centro de costos sobre el
TXHUHFDHXQWLSRGHFRVWR¿QDO
,, 6HFWRUHV ,QWHUPHGLRV VRQ DTXHOORV VHUYLFLRV TXH EULQGDQ DSR\DWXUD D ORV SULPHURV
VLQLQWHUYHQLUGLUHFWDPHQWHHQHOSURGXFWR¿QDOHVGHFLUSURYHHQDOSHUVRQDOPpGLFRODV
facilidades y ayuda necesaria para generar
ORVVHUYLFLRVGHOtQHD,QFOX\HQSRUHMHPSOR
HQIHUPHUtD TXLUyIDQRV HVWHULOL]DFLyQ IDUPDFLDHWF
,,, 6HFWRUHV JHQHUDOHV VRQ DTXHOORV QHFHVDULRV SDUD OD PDUFKD GH OD RUJDQL]DFLyQ TXH
WDPSRFR SDUWLFLSDQ GH IRUPD DFWLYD HQ OD
SURGXFFLyQ ,QFOX\HQ 'LUHFFLyQ $GPLQLVWUDFLyQ &RQWDGXUtD 6HUYLFLRV *HQHUDOHV
$XGLWRUtD0pGLFD&RPSUDVHWF
9pDVHSRUHMHPSORGHOD3DUUD-HQAuditoría Médica%XHQRV$LUHV(G)XQGDFLyQ)DYDORUR
178 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
(Q OD SUiFWLFD \ D ORV ¿QHV GH FRQRFHU ORV
FRVWRV SRU SURGXFWR ¿QDO FRQVXOWDV HJUHVRV
HWF VHSURFHGHFRPRVLJXH YpDQVH¿JXUDV
y especialmente 8.6 para seguir la explicación
1. La primera y segunda columna dan cuenta
GHODVXQLGDGHVJHQHUDOHVGHGLVWULEXFLyQHQ
IRUPDGH6HFWRUHV)LQDOHV $ 6HFWRUHV,QWHUPHGLRV % \6HFWRUHV*HQHUDOHV & $VXYH]GHQWURGHVHFWRUHV¿QDOHVHQFRQWUDPRV &RQVXOWD ([WHUQD $ ,QWHUQDFLyQ
$ \*XDUGLDV $ (Q 6HFWRUHV ,QWHUPHGLRV % XELFDPRV
FRPRHMHPSORXQLGDGHVGHJHVWLyQRFHQWURV GH FRVWRV FRFLQD DQHVWHVLD HQIHUPHUtD IDUPDFLD QXUVHU\ QXWULFLyQ \ TXLUyIDQRVR%1 a B
)LQDOPHQWHHQ6HFWRUHV*HQHUDOHV & XELFDPRV VLHPSUH D PRGR GH HMHPSOR D FHQWURVGHFRVWRVRXQLGDGHVGHJHVWLyQQRminados C1 a C11 R ELHQ 'LUHFFLyQ$GPLQLVWUDFLyQ $XGLWRUtD)DFWXUDFLyQ $UFKLYR
*HQHUDO 5HFHSFLyQ ,QWHUQDFLyQ /HJDOHV
$PRUWL]DFLRQHV3HUVRQDO&RPHUFLDOL]DFLyQ
y Compras.
5. Las siguientes tres amplias columnas de la plaQLOODVHUH¿HUHQD&RVWRV'LUHFWRV , &RVWRV
,QGLUHFWRVGH6HFWRUHV*HQHUDOHV ,, \&RVWRV
,QGLUHFWRVGH6HFWRUHV,QWHUPHGLRV ,,, 6. Cerramos la planilla con tres columnas de
UHVXPHQWRWDO ,99\9, \3URGXFFLyQ)LQDO ,; GLVFULPLQDGD SRU FHQWUR GH FRVWRV
3&RQVXOWD3(JUHVRVSDFLHQWHGtD\GtD
cama.
'HQWURGH&RVWRV'LUHFWRV , HQFRQWUDPRV
3HUVRQDO FRPSUHQGLHQGRWRGRVORVVXHOdos anualizados de cada sector considerado
HQFDGD¿OD2WURVFRVWRVGLUHFWRV LPSOLFD
FXDOTXLHU WLSR GH KRQRUDULR PpGLFR SDJDGR
TXH FLUFXOH SRU IXHUD GH ORV VXHOGRV FRPR
WDPELpQ FXDOTXLHU LQVXPR R HOHPHQWR DWULEXLEOHLQHTXtYRFDPHQWHDXQDHVSHFLDOLGDGR
FHQWURGHFRVWRV SRUHMHPSORXQRIWDOPRVFRSLRSDUDRIWDOPRORJtD SRU¿QODWHUFHUD
columna sumariza la adición de todas las anWHULRUHVWRWDOFRVWRVGLUHFWRV 8QDYH]WRWDOL]DGRVDVtHOJOREDOGHFRVWRV
WRWDOHV SRU VHFWRU GHEHPRV FRQVLGHUDU OD
SURGXFFLyQ TXH GHVLJQDUHPRV LQWHUPHGLD
9,, FRPHQ]DQGR FRQ OD GH ORV VHFWRUHV
JHQHUDOHV\HVWDEOHFLHQGRODSURGXFFLyQHQ
VtGHFDGDFHQWURGHFRVWRV 3, \XQ
FRH¿FLHQWHGHSURGXFFLyQ &3 TXH
será el factor a multiplicar para el prorrateo
de cada centro en los sectores generales y
VHREWLHQHGHOVLJXLHQWHPRGRVHFRQVLGHUD
SDUDFDGDWRWDO GHORVVHFWRUHVJHQHUDOHV
TXp SRUFHQWDMH UHSUHVHQWD GHO WRWDO GH VHFWRUHV¿QDOHVHLQWHUPHGLRV HVGHFLUHOWRWDO
JHQHUDOH[FOX\HQGRVHFWRUHVJHQHUDOHV 6LVH
GLVSRQHGHXQDPHGLGDHVSHFt¿FDGHSURGXFFLyQ SRUHMHPSORFRVWRSRUPHWUDMHFXDGUDGRHQPDQWHQLPLHQWRRVHUYLFLRVJHQHUDOHV éste será el criterio a utilizar para efectuar el
prorrateo.
8QD YH] REWHQLGR DVt HO JOREDO GH FRVWRV
JDVWRV\YDORUXQLWDULRGH6HFWRUHV*HQHUDOHV
& VHGHEHHIHFWXDUVXGHVFDUJDHQORV6HFWRUHV)LQDOHVH,QWHUPHGLRV
/D GHVFDUJD HQ VHFWRUHV ¿QDOHV FRQVLGHUD
hipotéticamente 4 centros de costos generaOHVDGHVFDUJDU &D&'LUHFFLyQ$GPLQLVWUDFLyQ$XGLWRUtD)DFWXUDFLyQ\$UFKLYR y el global.
11. El proceso de descarga en sí es: sea un coH¿FLHQWHGHFDGDFHQWURGHFRVWRVJHQHUDO\
PXOWLSOtTXHVHSRUHOJOREDO GHODFROXPQDGHFRVWRVGLUHFWRV , SDUDFDGDFHQWURGH
FRVWRVGHORVVHFWRUHV¿QDOHVHLQWHUPHGLRV
$VtSRUHMHPSORHOFRH¿FLHQWHGHOFHQWURGH
costos Dirección C1 multiplicado por el total
GH FRVWRV GLUHFWRV GH OD HVSHFLDOLGDG ^$` GH FRQVXOWD H[WHUQD GD FRPR UHsultado la proporción del total de Dirección
TXHGHEHDSURSLDUODFRQVXOWDH[WHUQDGHHVD
HVSHFLDOLGDGLGHQWL¿FiQGRVHODHQODSODQLOOD
como la intersección C1 - A.1.1. y nominada
Ej1 - C1 - A.1.1. De igual modo se procede
FRQFDGDFHQWURGHFRVWRV¿QDOHLQWHUPHGLR
$O¿QDOGHODRSHUDFLyQODVXPDGHWRGRVORV
prorrateos de Dirección debe ser igual a su
WRWDOGHFRVWRVGLUHFWRV (Q OD SODQLOOD GH HMHPSOR OD LQWHUVHFFLyQ
, &QRPLQDGD(M,&GHEHVHU
igual al total de gastos directos de dirección.
$KRUDVHGLVSRQHGHORVFRVWRVWRWDOHVORV
GLUHFWRV\ORVLQGLUHFWRVGHORVVHFWRUHVLQWHUPHGLRV $JUHJDQGR QXHYDPHQWH OD SURGXFFLyQGH¿QLGDFRPRSURGXFFLyQLQWHUPHGLD 9,,, REWHQGUHPRVQXHYDPHQWHHOFRVWR
XQLWDULR SRU VHUYLFLR SURGXFLGR HQ QXHVWUR
HMHPSOR REWHQGUHPRV FRVWRV XQLWDULRV SDUD
UDFLyQDOLPHQWLFLD % DFWRDQHVWpVLFR % KRUDGHHQIHUPHUtDKRUDGHTXLUyIDQRHWF$
VXYH]DOREWHQHUHOWRWDOGHFRVWRVGLUHFWRV
PiVLQGLUHFWRVGHVHFWRUHVJHQHUDOHVHVWDUH-
8 - Gestión presupuestaria y gestión de costos en la organización / 179
SERVICIO
A
B
C
D
MEDICINA
CIRUGÍA
PEDIATRÍA
4.6
4
1.5
OBSTETRICIA
Tabla 8.1: Estándares de tiempo de enfermería (en horas) por tipo de servicio, según diversas fuentes
A: EEUU, sobre 20 hospitales
B: Universidad Nacional de Columbia
C: Guías para dotación de personal. OMS, Cuaderno Nº 31
D: Barquín. Dirección de hospitales
DEPENDENCIA A
1
MÍNIMA
INTERMEDIA
ALTA
B
C
1
4.5
6
Tabla 8.2: Estándares de tiempo de enfermería por tipo de paciente (tomada de Asenjo y Bohigas)
A: Guías OMS, op cit.
B: Enfermería hospitalaria. Eseverri
C: Cuadernos OMS, op cit.
PRV HQ FRQGLFLRQHV GH HIHFWXDU XQD QXHYD
GHVFDUJD HVWD YH] GH ORV VHFWRUHV LQWHUPHGLRVVREUHORVVHFWRUHV¿QDOHV
8QDYH]¿QDOL]DGDODPLVPDSRGUHPRVFDOFXODU FRQ OD SURGXFFLyQ ¿QDO ,; GH FRQVXOWDV \ HJUHVRV HO FRVWR ¿QDO GH FDGD XQR
GHHVWRVtWHPVPiVORVFRUUHVSRQGLHQWHVSRU
SDFLHQWHGtD \ GtDFDPD FOtQLFR TXLU~UJLFR
XREVWpWULFRRGHWHUDSLDLQWHQVLYD
(Q~OWLPRWpUPLQRFDOFXODPRVFRQEDVHHQ
esta planilla y efectuando diferentes sustracFLRQHVHOFRVWRGHOGtDFDPDHQIXQFLyQGH
ORV GLYHUVRV WLSRV GH HJUHVRV FRPR VH FRmenta más adelante en otro apartado.
Puede ampliarse un segmento de esta gran
planilla de resultados generales introduciendo una
QXHYDYHUWLHQWHFRPRODFRQVLGHUDFLyQGHODFXDOLGDGGH¿MRRYDULDEOHGHFDGDFRVWRGHVFDUJDGR
\DTXHKDVWDDKRUDVyORFRQVLGHUDPRVORVFRVWRV
directos e indirectos. Se obtiene de este modo un
FRVWR¿QDOSDUDSDWRORJtDRLQWHUYHQFLyQODSURSRUFLyQGHFDGDXQRTXHHVGLUHFWRRLQGLUHFWRHO
SRUFHQWDMH¿MRRYDULDEOH\HOYDULDEOHVLQKRQRUDULRVRPDUJLQDO$OPLVPRWLHPSRVHFRQVLGHUD
HOFRVWRSRUSDWRORJtDRLQWHUYHQFLyQHQIXQFLyQ
GHXQHVWiQGDULGHDOSDUDODPLVPD\DTXHGHQR
SURFHGHUDVtSRGUtDUHVXOWDUTXHXQHTXLSRUHVXOWDUDPiVH¿FLHQWH±DOEDMDUVXVFRVWRVGLDULRV±SRU
HMHPSORFXDQWRVPiVGtDVWXYLHUDLQWHUQDGRDXQ
enfermo. De esta manera debería considerarse un
costo óptimo para una determinada cantidad ideal
GHGtDVSDVDGRVORVFXDOHVHOFRVWRVHHQFDUHFH
HQDOPHQRVXQGtDTXLU~UJLFRSRUGtDFDOHQGDULR
HQ H[FHVR R VH DEDUDWD SRU FDGD GtD PHQRV GH
LQWHUQDFLyQ GHQWUR GH FLHUWRV OtPLWHV /XHJR GH
considerar los costos por egreso puede procurarVHXQDYLVLyQPiVPLFURPpWULFDGLVFULPLQiQGRVH
dentro de toda la erogación en los grandes grupos
FOtQLFDPpGLFDFLUXJtDJHQHUDO\REVWHWULFLD DOJXQRVWLSRVHVSHFt¿FRVGHHJUHVRSDUDRWRUJDUOHV
XQYDORUGH¿QLGRDOHJUHVR\DOGtD/RVKDOOD]JRV
VLJQL¿FDWLYRV HQFRQWUDGRV VH UH¿HUHQ D OD JUDQ
YDULDELOLGDG GH FRVWRV WDQWR HQWUH HJUHVRV GLIHrentes dentro de la misma especialidad como en
los costos por paciente día. A tal punto llega esta
YDULDELOLGDGTXHVHSXHGHFRQVLGHUDUXQDVREUHVLPSOL¿FDFLyQ VHJXLU KDEODQGR SRU HMHPSOR GH
HJUHVR FOtQLFR R TXLU~UJLFR X REVWpWULFR VLHQGR
PiVSURSLRKDEODUSRUHMHPSORGHHJUHVRSDUWR
RFHViUHDRKHUQLDRLQIDUWRGHPLRFDUGLR\DVt
VXFHVLYDPHQWH2WURWDQWRRFXUUHFRQORVGtDV\D
TXHQRH[LVWHSURSLDPHQWHXQGtDTXLU~UJLFRVLQR
un día de hernia o de colecistectomía laparoscó-
180 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
SLFDRGHSDUWRHWF(VWHKDOOD]JRQRVDSUR[LPD
DODLGHDGHFRVWRSRUSURGXFWRKRVSLWDODULRcase
mixRFDWiORJRGHSURGXFWRV\GHDOOtD*5'OR
TXHVHUiFRPHQWDGRHQGHWDOOHHQRWUDSDUWH
(QHOFHQWURGHFRVWRVHQIHUPHUtDSRUVXSDUWHHOSHUVRQDOHVFRQPXFKRHOUHFXUVRPiVRQHroso y por tanto su principal fuente de costos.
Los cálculos más sencillos asignan un número
GHKRUDVGHHQIHUPHUtDHQIXQFLyQGHOVHUYLFLR
utilizándolo así como una medida de la depenGHQFLDGHOHQIHUPRYDULDQGRHOQ~PHURGHKRUDV
VHJ~QODHVSHFLDOLGDGFRPRVHYHHQODVWDEODV
\PRGL¿FDGDVGH$VHQMR\%RKLJDV/RV
estándares así hallados constituyen una estimaFLyQ YDORUDWLYD GH OR TXH GHEHUtD VHU HV GHFLU
un ideal. Cada uno puede utilizar sus propios
HVWiQGDUHV R XWLOL]DU ORV FDOFXODGRV SRU RWURV
FRQVLGHUDQGRVLHPSUHTXHFDGDWLSRGHHVWiQGDU
puede estar apoyado en circunstancias disímiles
y por lo tanto no ser estrictamente comparables.
Agregaremos una tabla de tiempos publicaGDVHQQXHVWURPHGLRSRU$UDQJXUHQ\5H]]yQLFRHQVXOLEUR5:
Para calcular la apropiación de enfermería
tenemos a las horas trabajadas * costo por hora
* días de estada. Podría en este caso consideUDUVH WDPELpQ DO PRQWR DVLJQDGR D HQIHUPHUtD
FDQWLGDGGHKRUDVTXLU~UJLFDVHVGHFLUXQSURFHGLPLHQWRDQiORJRDOGHVXHOGRVSDUWLHQGRGH
ODEDVHGHTXHQRWRGRVORVSDFLHQWHVTXLU~UJLFRV
UHTXLHUHQLJXDOWLHPSRGHHQIHUPHUtD\DGHPiV
HVUD]RQDEOHTXHHVHWLHPSRJXDUGHUHODFLyQOLQHDOFRQHOWLHPSRRSHUDWRULR HVGHFLUDFLUXJtDV
TIPO DE PACIENTE
Clínico
Quirúrgico
Pediátrico
Obstétrico
3VLTXLDWUtDDJXGRV
3VLTXLDWUtDFUyQLFRV
87,
8&2
Cuidados intermedios
más prolongadas serán necesarias más horas de
HQIHUPHUtDGHSLVR (OFHQWURGHFRVWRV4XLUyIDQRVSRUVXSDUWH
incluye a todo el personal estable del sector. Es
XQFRVWR¿MRHLQGLUHFWRSDUDODVHVSHFLDOLGDGHV
TXLU~UJLFDVORPLVPRTXHHVWHULOL]DFLyQRQXUVHU\XR[tJHQR\DTXHHOJDVWRHVHOPLVPRVH
KDJDQyRSHUDFLRQHVKDVWDHOSXQWRHQTXH
VHH[FHGDODFDSDFLGDGSURGXFWLYDPi[LPD\VH
WHQJDTXHDPSOLDUODHVWUXFWXUD KXPDQDRHGLOLFLD GHQWURGHHVRVOtPLWHVORVVXHOGRVVHUYLFLRV\GHPiVFDUJRVVHSDJDQLJXDOTXL]iVtVH
gaste más en desinfectantes o insumos pero esto
HVIDUPDFLDTXHHVYDULDEOH
El centro de costos farmacia es el paradigPDGHXQFRVWRYDULDEOHTXHVHUHODFLRQDFRQHO
tiempo operatorio; representa el costo promedio
GHFRPSUDGHPHGLFDPHQWRV\GHVFDUWDEOHV XQ
GH SUHFLR GH IDFWXUDFLyQ XWLOL]DGRV HQ HO
acto operatorio.
El centro de costos laboratorio descarga de
XQDPDQHUDDQiORJDFDOFXOiQGRVHGHODPLVPD
base antes mencionada el consumo promedio
GHOtWHPSRUHJUHVR\SRUSDWRORJtDRLQWHUYHQFLyQHVSHFt¿FD
PRODUCTO HOSPITALARIO
7UDGLFLRQDOPHQWHVHFRQVLGHUDEDTXHHOKRVSLWDO
HVWDEDIRUPDGRSRUSHUVRQDVTXHGHVDUUROODEDQ
GLIHUHQWHVIXQFLRQHVWRGDVHOODVRULHQWDGDVDOD
DWHQFLyQ \ WUDWDPLHQWR GH SDFLHQWHV TXH DFXATENCIÓN EN HS. POR PACIENTE - DÍA
KVSRUSDFLHQWHGtD
KVSRUSDFLHQWHGtD
KVSRUSDFLHQWHGtD
KVSRUSDFLHQWHGtD
KVSRUSDFLHQWHGtD
KVSRUSDFLHQWHGtD
DKVSRUSDFLHQWHGtD
DKVSRUSDFLHQWHGtD
KVSRUSDFLHQWHGtD
Tabla 8.3: Estándares de tiempo de enfermería por tipo de paciente (Aranguren y Rezzonico, 1996)
Auditoría Médica. Garantía de calidad en atención de la salud7RPRV,D,,,%XHQRV$LUHV&HQWUR(GLWRUGHOD
)XQGDFLyQ)DYDORUR
5
8 - Gestión presupuestaria y gestión de costos en la organización / 181
DESCARGAN
SECTORES
GENERALES
SERVICIOS
FINALES
DESCARGAN
SECTORES
INTERMEDIOS
-#"&( '*'%"
- "'%"2"% - (%&
DESCARGAN
SECTORES
GENERALES
PRODUCTOS
HOSPITALARIOS
SECTORES
INTERMEDIOS
-#$%1
-(%2"#&
-"%!%1
- !"'2"
-&'% ,2"
-(%&%+
PRODUCTO
HOSPITALARIO
FINAL
CONSULTAS
EXTERNAS
EGRESOS
SUBPRODUCTOS
INTERMEDIOS
PRESTACIONES
/
IMÁGENES
SECTORES
GENERALES
-%2"
-!"&'%2"
-('#%1!0
-#"'(%1
- !$(&'#&'&&
-%)#&% &
Figura 8.5: Esquema de descarga de costos (explicación en el texto)
GtDQDpO(VWDVIXQFLRQHVSRGtDQVHUPpGLFDV
GHHQIHUPHUtDDGPLQLVWUDWLYDV\GHVRSRUWH/D
suma de todas ellas constituía el total de la acWLYLGDG GHO KRVSLWDO TXH D QLYHO DVLVWHQFLDO VH
PHGtDSRUHOQ~PHURGHLQJUHVRVFRQVXOWDVLQWHUYHQFLRQHVTXLU~UJLFDVXUJHQFLDVSUXHEDVGH
ODERUDWRULRHWF(VWDLGHDGHKRVSLWDOFRPLHQ]D
D FDPELDU HQ ORV DxRV IHFKD HQ OD TXH HO
hospital pasa a ser considerado como una emSUHVDGHVHUYLFLRV3HURHVWHKHFKR±FRQVLGHUDU
al hospital como empresa– hacía necesario de¿QLUFRQFODULGDGVXSURGXFWRSRUTXHHQWRQFHV
OR TXH LQWHUHVD \D QR VRQ WDQWR ODV IXQFLRQHV
TXHUHDOL]DQODVGLVWLQWDVSHUVRQDVVLQRORTXH
el hospital produce.
7DQWHPSUDQRFRPRHQ&RGPDQWUDWy
de desarrollar el interés de los hospitales por
HO SURGXFWR ¿QDO ORV FDVRV WUDWDGRV PiV TXH
VREUHODDFWLYLGDGGHVDUUROODGD&KDVH\$TXLOLDQRGH¿QLHURQHOSURGXFWRFRPR³HOUHVXOWDGR
GH XQ VLVWHPD SURGXFWLYR RIUHFLGR D OD YHQWD
HQ HO FDVR GH XQD HPSUHVD R TXH SXHGH HVWDUGLVSRQLEOH HQHOFDVRGHXQDRUJDQL]DFLyQ
¿ODQWUySLFD R JXEHUQDPHQWDO SDUD DOJXQRV
FRQVXPLGRUHV´ 3HUR OD PD\RU DSUR[LPDFLyQ
DODGH¿QLFLyQproducto hospitalarioHVODH[presada por el término case mix o mezcla de
casos o conjunto de procesos hospitalarios. El
FRQFHSWRGHSURGXFWRKRVSLWDODULRYDOLJDGRGH
IRUPDGLUHFWDDORVVHUYLFLRVTXHSUHVWDHOKRVSLWDO\SRUWDQWRYDDUHIHULUVHDODWLSRORJtDGH
FDVRV TXH VH DWLHQGHQ DVt FRPR D OD JDPD GH
FXLGDGRVTXHVHSUHVWDDOSDFLHQWHKDVWDVXDOWD
KRVSLWDODULD 6LQ HPEDUJR OD JUDQ YDULHGDG \
HOHOHYDGRQ~PHURGHSURGXFWRVHODERUDGRVSRU
HOKRVSLWDOFDUHFHQGHXWLOLGDGSUiFWLFD\DTXH
PXFKRVGHHOORVQRSXHGHQVHULGHQWL¿FDGRVQL
PHGLGRV\RWURVVRQKHWHURJpQHRVSRFRHODERUDGRVRPX\SULPDULRV7RGRHVWRKDPRWLYDGR
ODQHFHVLGDGGHHVWDEOHFHUJUXSRVKRPRJpQHRV
PiVUHGXFLGRV\PDQHMDEOHVFRQHO¿QGHSRder concentrar todos los esfuerzos de gestión
HQ HO DXWpQWLFR SURGXFWR ¿QDO KRVSLWDODULR DO
FRQVWLWXLUVH pVWH HQ XQ H[WUDRUGLQDULR LQVWUXPHQWRGHPHGLGDGHODH¿FLHQFLDKRVSLWDODULD
8QD FODVL¿FDFLyQ EDVDGD VyOR HQ GLDJQyVWLFRV FRGL¿FDGRV VHJ~Q &,( QR FRQVWLWX\H XQD
PXHVWUD ¿HO GHO SURGXFWR KRVSLWDODULR GHELGR
sobre todo a la heterogeneidad de cada una de
ODV FDWHJRUtDV$~Q DVt HO YROXPHQ \ OD WLSRORJtD GH SDFLHQWHV DWHQGLGRV FRPR H[SUHVLyQ
GH OD SURGXFFLyQ KRVSLWDODULD VyOR HV SRVLEOH
VLVHGLVSRQHGHXQVLVWHPDGHFODVL¿FDFLyQGH
pacientes.
Sectores Finales
A.1.2
A.1.3
A.1.4
A.1.5
A.1.6
Especialidad 2
Especialidad 3
Especialidad 4
Especialidad 5
Especialidad 6
A.2.3
A.2.4
Especialidad 3
Especialidad 4
Cocina
B.i
A.3.3
Especialidad 3
Sect. Intermedios (B)
A.3.2
Especialidad 2
Especialidad 1
A.3.1
A.2.2
Especialidad 2
Guardia (A.3)
A.2.1
Especialidad 1
Internación (A.2)
A.1.1
Especialidad 1
Consulta Externa (A.1)
Sectores Finales (A)
Personal
(1)
Otros
CD
(2)
Costos Directos (I)
Total
costos
directos
(3)
prorrateo
Admin.
C.ii
Dirección
C.i
EJ1
C1-A1.1
prorrateo
Audot.
Fac
C.iii
prorrateo
Archivo
C.iv
Admin
C.ii
Audot/
Fact C.iii
Archivo
C.iv
Costos Indirectos de Sectores Generales (II)
DESCARGA 1
prorrateo
C.i
Costos Indirectos de Sectores Generales (II)
Total de costos
Ind S Gen (S)
Total costos
Ind.
Sec Gen (4)
Unit.
Prod.
criterio
B.iii
DESCARGA 3
criterio
B.ii
Costo
Unit.
Prod. Int. (VIII)
criterio
B.i
criterio
B.iv
criterio
B.v
criterio
B.vi
Costos Indirectos de Sectores Intermedios (III)
criterio
B.vii
Total
costos
Ind Sec
Int (5)
Total Costos
Indirectos
(Sec Gen
+Int) (IV)
Total
Costos
Directos
(V)
Total
general (C
Dir C Ind
Sec Gen e
Int (VI)
C Guardia
Egresos
Producción
consultas
(P1)
Costo
CG (P10)
Costo
Egresos
Costo
Unitario
o Cons
(P2)
Producción
Final (IX)
182 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
(continúa en página siguiente)
Sectores Intermedios
Sectores Generales
B.iii
B.iv
B.v
B.vi
B.vii
Enfermería
Farmacia
Nursery
Nutrición
Quirófanos
C.i
C.ii
C.iii
C.iv
C.v
C.vi
C.vii
C.viii
C.ix
C.x
C.xi
Dirección
Administración
Auditoría / Facturación
Archivo genreal
Recepción
Internación
Legales
Amortizaciones
Personal
Comercialización
Compreas
Sect. Generales (C)
Totales
B.ii
Anestesia
EJ2_13C1
PL2
PL1
Prod.
C. Unit 2
C. Unit 1
Coef.
Unit
Prod. Intermedia (VII)
EJ2_13C1
DESCARGA 2
Unit.
Quir.
Unit.
Nut.
Unit.
Nurs.
Unit.
Farm.
Unit.
Enf.
Unit.
Anes.
Unit.
coc
Costo
hora
quir.
DIA (P7)
CAMA (P5)
PD (P8)
DC (P8)
8 - Gestión presupuestaria y gestión de costos en la organización / 183
Figura 8.6: Planilla de descarga de costos (explicación en el texto)
184 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
Sistema de clasificación de pacientes
(OGHVDUUROORGHORVVLVWHPDVGHFODVL¿FDFLyQGH
pacientes se relaciona con el auge de la gestión
SRU OtQHD GH SURGXFWR DO WUDWDUVH GH PD\RU
DFHUFDPLHQWRDORTXHUHDOPHQWHFRQVWLWX\HHO
SURGXFWRILQDOKRVSLWDODULR6HWUDWDSRUWDQWR
GHVLVWHPDVTXHWLHQHQHQFXHQWDODFRPSRVLFLyQ GH FDVRV case mix D OD KRUD GH PHGLU
OD SURGXFFLyQ KRVSLWDODULD (Q OD DFWXDOLGDG
estos sistemas están elaborados en función de
OD ILQDOLGDG HVSHFtILFD SDUD OD TXH VH SUHWHQGHXWLOL]DUFDGDXQRGHHOORVGHWDOIRUPDTXH
unos sistemas se aplican en el control de caliGDGHQODJHVWLyQ\IDFWXUDFLyQHWFPLHQWUDV
TXHRWURVVHEDVDQHQHOFRQVXPRGHUHFXUVRV
HQHOGLDJQyVWLFRHQODFRPSOHMLGDGHWF&DGD
JUXSRSUHVHQWDXQDFDUDFWHUtVWLFDGHWHUPLQDGD
TXHSHUPLWHLGHQWLILFDUDWRGRVVXVHOHPHQWRV
SRULJXDO\DOPLVPRWLHPSRORGLIHUHQFLDGHO
UHVWRGHORVJUXSRV$VtORVJUXSRVGHLVRGLDJnóstico utilizan el diagnóstico principal como
FULWHULR GH FODVLILFDFLyQ PLHQWUDV TXH ORV GH
LVRFRPSOHMLGDGXWLOL]DQORVGLYHUVRVJUDGRVGH
afectación para clasificar a los pacientes con
el mismo diagnóstico principal.
/D FODVL¿FDFLyQ LQWHUQDFLRQDO GH HQIHUPHdades utiliza la etiología como criterio de claVL¿FDFLyQ GH WDO IRUPD TXH SHUPLWH DO KRVSLtal diferenciar a los pacientes –bien sea por la
FDXVD TXH RULJLQD OD HQIHUPHGDG ELHQ SRU OD
IRUPD HQ TXH pVWD VH PDQL¿HVWD± D WUDYpV GHO
GLDJQyVWLFR FOtQLFR DO PRPHQWR GHO DOWD SHUR
HVWDFODVL¿FDFLyQHVXQVLVWHPDTXHSRUVtPLVPRFDUHFHGHFDSDFLGDGSDUDPHGLUODSURGXFFLyQKRVSLWDODULD\DTXHHVWiGHPRVWUDGRTXH
para agrupar a los pacientes con necesidades de
FXLGDGRVVLPLODUHVQREDVWDVyORFRQHOGLDJQyVWLFR SULQFLSDO VLQR TXH HV SUHFLVR FRQRFHU
otros factores íntimamente relacionados con la
SURYLVLyQGHFXLGDGRVGHVDOXGFRPRVRQGLDJQyVWLFR VHFXQGDULR SURFHGLPLHQWRV TXLU~UJLFRV FRPSOLFDFLRQHV HGDG FRPSOHMLGDG GH OD
HQIHUPHGDGHWF
El comportamiento del paciente en su reODFLyQ FRQ HO GLVSRVLWLYR DVLVWHQFLDO YD D HVWDU
FRQGLFLRQDGR SRU OD HVSHFLDO LPSRUWDQFLD TXH
DGTXLHUHXQDVHULHGHUDVJRVTXHOHVRQSURSLRV
HGDGHQIHUPHGDGTXHSDGHFHHWF RTXHHVWiQ
UHODFLRQDGRVFRQpO VLWXDFLyQVRFLRHFRQyPLFD
DPELHQWHODERUDO $VtODIRUPDGHPDQLIHVWDUse un paciente no cambia en razón del color de
VXVRMRVRGHVXFDEHOORSHURVtSRUSDGHFHUXQD
HQIHUPHGDG ,$0EURQTXLWLV RVHUVRPHWLGRD
XQDLQWHUYHQFLyQTXLU~UJLFD
(VWD GLYHUVLGDG GH VLWXDFLRQHV KDFH TXH
cada paciente sea totalmente diferente a otro
TXHSDGHFHODPLVPDHQIHUPHGDGORTXHH[SOLFDODJUDQYDULHGDGGHSDFLHQWHVVXVFHSWLEOHVGH
VHUWUDWDGRVHQHOKRVSLWDO3RUWDQWRGHVGHHVWD
SHUVSHFWLYD HO GLVSRVLWLYR DVLVWHQFLDO HODERUD
WDQWRV SURGXFWRV ¿QDOHV FRPR SDFLHQWHV VRQ
DWHQGLGRV )HOGVWHLQ LQWURGXFH HO FRQFHSWR GH
case mix en el análisis de los costos hospitalaULRVUHIHULGRDODVFDUDFWHUtVWLFDVGHORVSDFLHQtes. El concepto de case mix hace referencia a
OD FRPSRVLFLyQ GH FDVRV R GLYHUVLGDG GH WLSR
GHSDFLHQWHTXHVRQWUDWDGRV\GLDJQRVWLFDGRV
HQHOKRVSLWDO(QGH¿QLWLYDSXHGHGH¿QLUVHHO
case mix como el catálogo de diagnósticos de
HQIHUPHGDGHVTXHUHVXOWDGHODFRPELQDFLyQGH
las diferentes enfermedades y problemas de saOXGHVSHFt¿FRVGHXQDGHWHUPLQDGDLQVWLWXFLyQ
o sistema sanitario.
/D YLVLyQ DFWXDO GH OD JHVWLyQ SRU case mix
GL¿HUHGHIRUPDVLJQL¿FDWLYDGHODH[LVWHQWHKDFH
DxRVEDVDGDSRUVREUHWRGRHQODHVWDQFLDPHGLD
\ODSURYLVLyQGHFXLGDGRVH[WUDRUGLQDULRVHQWUH
RWURV DVSHFWRV$TXHOOD JHVWLyQ HVWDED LPSUHJnada de una orientación netamente funcional en
OD TXH VH PHGtD OD DFWLYLGDG KRVSLWDODULD FRPR
OD VXPD GH OD DFWLYLGDG UHDOL]DGD SRU FDGD XQD
GHODVXQLGDGHVRVHUYLFLRVTXHORFRPSRQHQ(O
case mix managementDSRUWDXQQXHYRHVWLORGH
JHVWLyQ EDVDGR HQ OD PHGLGD GHO SURGXFWR TXH
VHREWLHQHGHODDFWLYLGDGDVLVWHQFLDOVLQDEDQGRQDUODJHVWLyQSRUVHUYLFLRVRGHSDUWDPHQWRV
Desde esta óptica es apenas propio hablar de
días de estada por especialidad sin referirse al
WLSRGHHQIHUPRTXHVHDWLHQGHHQHOKRVSLWDO\
TXHGHWHUPLQDUiDTXpOORV
El case mix managementVHGH¿QHFRPROD
JHVWLyQGHOKRVSLWDOHQIXQFLyQGHODGLYHUVLGDG
GHSDFLHQWHVRPH]FODGHFDVRV(VWDJUDQGLYHUsidad de pacientes constituye un elemento poco
manejable y difícilmente medible a efectos de
JHVWLyQ SRU OR TXH VH KDFH QHFHVDULR XWLOL]DU
sistemas de agrupación de pacientes por tipo o
línea de producto.
Para la puesta en marcha en el hospital de
un sistema de gestión por case mix HV SUHFLVR
GLVSRQHU GH D 8Q VLVWHPD GH DJUXSDFLyQ GH
SDFLHQWHVTXHSHUPLWDGH¿QLU\FODVL¿FDUHOSURGXFWRKRVSLWDODULRE 8QVLVWHPDGHLQIRUPDFLyQ
TXHLQWHJUHORVVLJXLHQWHVDVSHFWRVDGPLQLVWUDWLYRFOtQLFR\¿QDQFLHUR/DLQIRUPDFLyQFOtQLFD
8 - Gestión presupuestaria y gestión de costos en la organización / 185
corresponde a los códigos de la CIE asignados
DO GLDJQyVWLFR SULQFLSDO GLDJQyVWLFRV VHFXQGDULRV LQWHUYHQFLRQHV TXLU~UJLFDV \ RWURV SURFHdimientos médicos. Los datos acerca de edad y
VH[RGHOSDFLHQWHIHFKDGHLQJUHVRDOWDHVWDGR
HQHOPRPHQWRGHODOWD¿QDQFLDFLyQVHUYLFLRR
PpGLFRUHVSRQVDEOHUHJLVWURGHFRQVXPRVHWF
FRUUHVSRQGHQ D OD LQIRUPDFLyQ DGPLQLVWUDWLYD
(ODVSHFWR¿QDQFLHURFRPSUHQGHODLQIRUPDFLyQ
VREUHIDFWXUDFLyQUHJLVWURGHJDVWRVFRQWDELOLGDGGHFRVWRVHWF
(OSULQFLSLRTXHULJHORVGLIHUHQWHVVLVWHPDV
de medida del case mix se basa en el establecimiento de grupos homogéneos de pacientes con
UHVSHFWR D XQD R YDULDV FDUDFWHUtVWLFDV UHOHYDQWHV\HVWDKRPRJHQHLGDGTXHGDUHÀHMDGDDWUDYpVGHODVWpFQLFDVTXHXWLOL]DQODFODVL¿FDFLyQ
como base de medida del case mix DO PLVPR
WLHPSRTXHRWUDVVHDFRPSDxDQGHXQDHVFDODGH
SXQWXDFLyQFRPRLQVWUXPHQWRSDUDYDORUDUDORV
pacientes.
(OGLDJQyVWLFRFRPRH[SUHVLyQGHOSURFHVR
FOtQLFR GHO SDFLHQWH \ SRU WDQWR GHO SURGXFWR
¿QDO KRVSLWDODULR FRQVWLWX\H XQ HOHPHQWR FX\D
FODVL¿FDFLyQ EDVDGD HQ OD &,( IRUPD SDUWH GH
la construcción de muchos de los sistemas de
medición del case mix 6LQ HPEDUJR SDUD SRder medir el case mix hospitalario es necesario
utilizar sistemas de agrupación de diagnósticos
FRQHO¿QGHLGHQWL¿FDUGHIRUPDPiVSUHFLVDHO
producto hospitalario.
Técnicas de medición del case mix
Algunas técnicas de medición del case mixTXH
VH GHVFULEHQ D FRQWLQXDFLyQ XWLOL]DQ VLVWHPDV
GLIHUHQWHV GH FODVL¿FDFLyQ GH SDFLHQWHV $Vt
PLHQWUDVTXHXQRVVHEDVDQHQOD&,(RHQFULWHULRVGHXWLOL]DFLyQRWURVORKDFHQHQODHYDOXDFLyQGHODFRPSOHMLGDGRHQODFXDQWL¿FDFLyQGHO
consumo de recursos. Alguna de estas técnicas
VHHQFXHQWUDQHQGHVXVRHQODDFWXDOLGDGSRUOR
TXH VH DERUGDUiQ VyOR ODV TXH JR]DQ GH PD\RU
predicamento.
1. Sistemas de case mix basados en la CIE
‡Disease Staging '6 (VWDGLRVHYROXWLYRVGH
enfermedad
‡ Diagnostic Related Groups *5' *UXSRV
relacionados con el diagnóstico
PROTOCOLO
PUNTO DE ENTRADA
MARCO
NORMATIVO
PROCESO
ORGANIZATIVO
PUNTO DE
ENTRADA
PROTOCOLOS
PROCESO
CLÍNICO
PRODUCTO
PRESTACIONES
DIAGNÓSTICOS
CATÁLOGOS DE
PRODUCTOS GRD
RECURSOS CLÍNICOS
SÍNTESIS
CONSENSUADA DEL
CONOCIMIENTO
ENTRE PROFESIONALES
TIEMPO A
Figura 8.7: Producto hospitalario
ENFERMO
LÍNEA CLÍNICA DE GESTIÓN
EXTRACCIÓN DE LAS NECESIDADES
DE RECURSOS Y DEL MODELO DE GESTIÓN
TIEMPO B
TIEMPO C
186 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
‡Patient Management Categories 30& &Dtegorías de gestión de pacientes
los GRD fue la identificación de la estancia
KRVSLWDODULD FRPR YDULDEOH GHSHQGLHQWH TXH
H[SUHVDHOFRQVXPRKRPRJpQHRGHUHFXUVRV
Para identificar a estos factores se utilizaron
2. Sistemas de case mix basados en criterios de
YDULHGDG GH WpFQLFDV DSOLFDGDV VREUH GLDJutilización
QyVWLFRVSURFHGLPLHQWRV\GDWRVDGPLQLVWUD‡*5'
WLYRVDOPDFHQDGRVHQXQDEDVHGHGDWRVTXH
‡$6Score
‡Patient Severity Index 36, ËQGLFHGHJUDYH- FRQWHQtDODIULROHUDGHUHJLVWURV/RV
criterios utilizados en el diseño y construcdad de los pacientes
‡Computerized Severity Index &6, ËQGLFHGH FLyQGHORV*5'IXHURQVXPDULDPHQWH
JUDYHGDGFRPSXWDUL]DGR
‡/DFODVL¿FDFLyQGHEtDGDUOXJDUDXQQ~PHUR
manejable de grupos.
3. Sistemas de case mix que evalúan la gravedad
‡ &DGD XQR GH HOORV GHEtD VHU KRPRJpQHR HQ
‡'636,&6,$6Score
cuanto al consumo de recursos.
‡ Acute Physiology and Chronic Health Eva‡'HEtDQVHUPXWXDPHQWHH[FOX\HQWHV
luation $3$&+(
‡'HEtDQVHUGHIiFLOLQWHUSUHWDFLyQ
‡ /D LQIRUPDFLyQ XWLOL]DGD HQ OD FODVL¿FDFLyQ
4. Sistemas de case mix que cuantifican el consudebía estar fácilmente disponible.
mo de recursos
‡Resource Utilization Groups 58* *UXSRV
/DVYDULDEOHVXWLOL]DGDVSDUDFODVL¿FDUDORV
de utilización de recursos
‡Ambulatory Visit Groups $9* *UXSRVGH pacientes en GRD son las siguientes:
YLVLWDRFRQVXOWDDPEXODWRULD
‡(GDG
‡6H[R
Importancia de los GRD
‡'[SULQFLSDO
‡'[VHFXQGDULRV
Los grupos relacionados con el diagnóstico
*5' FRQVWLWX\HQ XQ PpWRGR GH FODVL¿FDFLyQ ‡3URFHGLPLHQWRVTXLU~UJLFRV\PpGLFRV
GHSDFLHQWHVTXHVHEDVDHQODDJUXSDFLyQGHORV ‡6LWXDFLyQHQHOPRPHQWRGHODOWD GHIXQFLyQ
HWF
diagnósticos emitidos al dar de alta al paciente y
son el sistema de medida del case mixFRQHOTXH
6LHFKDPRVXQYLVWD]RDFXDOTXLHUPHPRULD
VHWLHQHPD\RUH[SHULHQFLD(VWRVSDFLHQWHVSUHVHQWDQXQDVHULHGHFDUDFWHUtVWLFDVVLJQL¿FDWLYDV DQXDOGHKRVSLWDORVLDQDOL]DPRVFXDOTXLHUGRTXH SHUPLWHQ SUHGHFLU HO QLYHO GH UHFXUVRV TXH FXPHQWRGHREMHWLYRVWDQWRGHOKRVSLWDOFRPR
consumen; alguna de estas características son GHXQVHUYLFLRPpGLFRRHVSHFLDOLGDGORVGDWRV
propias del paciente y otras corresponden a la TXHVHH[SUHVDQVHPLGHQVHFRPSDUDQRYDORUDQ VRQ GDWRV GH DFWLYLGDG LQJUHVRV HVWDQHQIHUPHGDGTXHSDGHFH
En un principio se desarrollaron los GRD FLDVLQWHUYHQFLRQHVTXLU~UJLFDVHVWXGLRV /RV
con unos propósitos diferentes a los actuales. índices de rendimiento surgen de estos datos
La idea original trataba de elaborar un siste- REMHWLYRVUHODFLRQDGRVHQWUHVt%DViQGRVHHQ
PDTXHSHUPLWLHUDQRVyORPHGLU\HYDOXDUOD estos datos se realiza clásicamente la gestión
DFWLYLGDG GHO KRVSLWDO FRQ HO ILQ GH IDFLOLWDU GHORVVHUYLFLRV\GHOKRVSLWDO/RVPpWRGRVGH
VXJHVWLyQVLQRWDPELpQVHUYLUFRPRLQVWUX- JHVWLyQ UHFXUVRV DFWLYLGDG UHQGLPLHQWR VRQ
mento de comunicación entre los profesio- HQHVHQFLDORVPLVPRVSDUDODDFWLYLGDGKRVWHnales. Los grupos relacionados con el diag- OHUDTXHSDUDHOVHUYLFLRGHFDUGLRORJtDRHOiUHD
QyVWLFRIXHURQFUHDGRVHQOD8QLYHUVLGDGGH GHTXLUyIDQRV6HSXHGHD¿UPDUTXHODJHVWLyQ
<DOHSRU)HWWHU\7KRPSVRQHQHODxR FOiVLFDGHORVKRVSLWDOHV\VHUYLFLRVPpGLFRVOR
a instancias de la Health Care Financing Ad- HV GH DFWLYLGDGHV \ UHQGLPLHQWRV QR XQD JHVministration FRQ OD ILQDOLGDG GH SRGHU FRQ- WLyQGHODHVHQFLDGHODSURGXFFLyQTXHVRQORV
WURODU ORV FRVWRV KRVSLWDODULRV DO FRQVLGHUDU productos.
Las consecuencias son incalculables.
HO DKRUUR TXH SXGLHUD REWHQHUVH GH OD DSOLFDFLyQ LQFHQWLYRV D OD HILFDFLD KRVSLWDODULD 3XHGHRFXUULUTXHFRQtQGLFHVDOWRVGHUHQGL(O SULQFLSLR TXH JXLDED OD FRQVWUXFFLyQ GH PLHQWRODHILFDFLDILQDOODSURGXFWLYLGDGVHD
8 - Gestión presupuestaria y gestión de costos en la organización / 187
EDMD 6H SXHGH UHDOL]DU XQ Q~PHUR H[WUDRUGLQDULRGHHVWXGLRVUDGLRJUiILFRVGHHFRJUDItDV LQFOXVR WHyULFDPHQWH GH LQWHUYHQFLRQHV TXLU~UJLFDV \ UHDOPHQWH UHVROYHU SRFRV
casos. Se puede mantener lleno el hospital
con estancias medias muy largas. Se puede
incluso mantener unos costos de unidades
GHSURGXFFLyQEDMRV\HOFRVWRGHOSURGXFWR
ILQDOVHUGHVPHVXUDGR1RHVH[DJHUDGRDILUPDUTXHODJHVWLyQSRUODDFWLYLGDGHQHVHQFLDHVXQDJHVWLyQEXURFUiWLFDFRQWRGDVODV
FRQQRWDFLRQHV GHO WpUPLQR$GHPiV HQ XQD
gestión de este tipo la parte del león y su diPHQVLyQYLHQHGDGDSRUODHVWUXFWXUDPiVTXH
por la producción final.
Lo anterior no debe entenderse como una
GHVFDOL¿FDFLyQGHORVVLVWHPDVGHJHVWLyQHQOR
UHIHUHQWHDDFWLYLGDG\UHQGLPLHQWRV\DTXHVH
trata de una gestión departamental siempre neFHVDULD VL ELHQ DO VHUYLFLR GHO SURGXFWR ¿QDO
2EYLDPHQWH HV PHMRU JHVWLRQDU SRU DFWLYLGDG
TXH QR JHVWLRQDU GH QLQJ~Q PRGR (Q XQD UHpresentación ideal del proceso esencial del producto hospitalario se distinguen dos aspectos
fundamentales.
El principal está ligado a las decisiones
GHO UHVSRQVDEOH PpGLFR TXH GHWHUPLQDQ D
partir de las situaciones clínicas del enferPR ODV DFWXDFLRQHV FOtQLFDV SRU UHDOL]DU
cuándo y cómo. El accesorio está represenWDGRSRUHOFRQMXQWRGHDFWXDFLRQHVGHGLYHUVDtQGROH SUXHEDVGLDJQyVWLFDVFXLGDGRVGH
HQIHUPHUtD HQ SODQWD Q~PHUR GH HVWDQFLDV
FRQVXPLGDV IiUPDFRV HWF SURGXFLGDV R
VHUYLGDVSRUGLIHUHQWHVVHUYLFLRV\XQLGDGHV
GHO KRVSLWDO UDGLRGLDJQyVWLFR ODERUDWRULRV
XQLGDGHVGHHQIHUPHUtDKRVWHOHUtDIDUPDFLD
HWF &DGDXQDGHHVWDVXQLGDGHVRVHUYLFLRV
GHEHJHVWLRQDUVXDFWLYLGDGFRQORVSDWURQHV
FOiVLFRV GH PRGR TXH VX SURGXFFLyQ VHD
rentable y eficaz: responder rápidamente a
ODVGHPDQGDVFRQFDOLGDGGHODSUHVWDFLyQ\
los menores costos posibles. Pero lo fundaPHQWDOHQHOUHVXOWDGRILQDOHVHOHQVDPEODMH
OD SURJUDPDFLyQ HO FRQMXQWR GH GHFLVLRQHV
acertadas sobre la utilización de estos reFXUVRVGLVSRQLEOHV SURGXFWRVHQVtPLVPRV
pero productos intermedios a disposición del
UHVSRQVDEOHGHOSURGXFWRILQDO FX\DFRQWLQXLGDG HQ HO WLHPSR YD D FRQIRUPDU HO SURFHVR HO WLHPSR WRWDO HPSOHDGR HO QLYHO GH
FDOLGDGILQDOORVUHFXUVRVFRQVXPLGRV\SRU
HQGHHOFRVWRILQDO
6HSODQWHDQSXHVGRVQLYHOHVGHJHVWLyQOD
JHVWLyQSRUVHUYLFLRVRGHSDUWDPHQWDO\ODJHVtión por procesos.
(VSHFLDOPHQWHHQHOFRQWH[WRVDQLWDULRS~EOLFRODFRQWUDWDFLyQGHVHUYLFLRVVDQLWDULRVHV
un instrumento importante desarrollado en los
últimos años para facilitar una asistencia saniWDULD GH FDOLGDG JDUDQWL]DQGR OD HTXLGDG \ OD
H¿FLHQFLDHQODSUHVWDFLyQGHORVVHUYLFLRVVDQLWDULRVFX\DGHPDQGDFUHFHDXQULWPRVXSHULRU
al de los recursos disponibles. La contratación
GH VHUYLFLRV VDQLWDULRV HQ HO FRQWH[WR S~EOLFR
constituye una base fundamental de la relación entre los compradores públicos y la red
GHSURYHHGRUHVGHVHUYLFLRVSHUVLJXLHQGRFRQ
la introducción de los contratos los siguientes
REMHWLYRV
0HMRUDU ORV VHUYLFLRV DVLVWHQFLDOHV WHQLHQGR
HQFXHQWDHQHOSURFHVRGHDVLJQDFLyQGHUHFXUVRV PHGLDQWH ORV FRQWUDWRV ODV SULRULGDGHVGH¿QLGDVHQODSROtWLFDVDQLWDULD
0HMRUDUODH¿FLHQFLDGHORVSURYHHGRUHVPHGLDQWH LQFHQWLYRV DUWLFXODGRV PHGLDQWH ORV
contratos.
)DYRUHFHU OD VHSDUDFLyQ GH IXQFLRQHV GLIHUHQFLDQGRODFRPSUD\ODSURYLVLyQGHVHUYLcios asistenciales.
)DYRUHFHUODLQWURGXFFLyQGHPHFDQLVPRVGH
PHUFDGRRFRPSHWHQFLDHQWUHSURYHHGRUHV
(QHOFRQWH[WRGHODFRQFHSWXDOL]DFLyQGH
FRPSUD GH VHUYLFLRV DVLVWHQFLDOHV SURQWR VH
KL]R HYLGHQWH TXH HUD QHFHVDULR GHVDUUROODU
sistemas de medición agregada del producWR KRVSLWDODULR TXH SHUPLWLHUDQ LGHQWLILFDU \
IDFWXUDU XQLGDGHV SURGXFWLYDV DVt FRPR PHGLU \ FRPSDUDU OD SURGXFWLYLGDG HQWUH KRVSLWDOHV8QDGHODVSULPHUDVPHGLGDVDJUHJDGDV
GH DFWLYLGDG IXH OD XQLGDG EiVLFD GH DVLVWHQFLD 8%$ GHVDUUROODGD HQ &DWDOXxD SDUD
UHHPEROVDUDORVKRVSLWDOHV6LQHPEDUJRQR
HVKDVWDODGpFDGDGHFXDQGRHQ(VWDGRV
8QLGRVVHFRQVLJXHDYDQ]DUHQSDUiPHWURVGH
DFWLYLGDGTXHLQFRUSRUHQODYDULDEOHULHVJR\
RFRPSOHMLGDGGHOSURGXFWRHVGHFLUVREUHHO
case mix$FRPLHQ]RVGHODGpFDGDGH\
FRPRFRQVHFXHQFLDGHGLYHUVRVIDFWRUHVH[LVte ya un amplio consenso acerca del modelo
conceptual de medición de la producción. A
SDUWLUGHOD$GPLQLVWUDFLyQQRUWHDPHULcana generaliza el empleo de los grupos reODFLRQDGRVGHGLDJQyVWLFR *5' FRPREDVH
188 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
GHXQQXHYRVLVWHPDGHSDJRSURVSHFWLYRSRU &RQHVWD¿QDOLGDGHQVHGH¿QLyXQSULPHU
FDVR\SDVDQDVHUODQRUPDHQFXDQWRDVLVWH- VLVWHPDGHFRPSUDSURVSHFWLYRTXHEstablecía
mas de medición del case mix6.
una unidad básica de actividad, la UBA,HTXLYDOHQWHDXQDHVWDQFLDKRVSLWDODULDFRPRHOHPHQWR
/RV PRGHORV GH FRQWUDWDFLyQ GH VHUYLFLRV GHPHGLGDGHWRGDODDFWLYLGDGKRVSLWDODULDde¿QtD WUHV QLYHOHV GH FRPSOHMLGDG GH ORV KRVSLasistenciales deben permitir:
talesKRVSLWDOHVJHQHUDOHVEiVLFRV FRPDUFDOHV 7UDWDU GH PDQHUD KRPRJpQHD ORV PLVPRV KRVSLWDOHVGHUHIHUHQFLD GHGLVWULWR \KRVSLWDOHV
GHDOWDWHFQRORJtD UHJLRQDOHV Determinaba,
SURGXFWRVRVHUYLFLRV
,QFHQWLYDURGHVLQFHQWLYDUOtQHDVGHSURGXFWR como factores moduladores de la actividad consegún las prioridades de la política sanitaria tratada XQD HVWDQFLD PHGLD (0 SRU DOWD XQ
7UDWDUGHIRUPDHTXLWDWLYDDGLVWLQWRVKRVSL- SRUFHQWDMHGHDFWLYLGDGDPEXODWRULDVREUHODDFWLYLGDGWRWDO\ODGLVWULEXFLyQGHOSDJREDViQGRtales.
VHHQXQVLVWHPDPL[WR
&RQ HO REMHWLYR GH LOXVWUDU OD IRUPD HQ TXH
Las transformaciones en la atención hospiKDQ HYROXFLRQDGR ORV VLVWHPDV GH FRQWUDWDFLyQ
GHVHUYLFLRVPHQFLRQDPRVPX\VXFLQWDPHQWHOD WDODULDFRQODPD\RULPSRUWDQFLDTXHYDDGTXLH[SHULHQFLDGH&DWDOXxD $VHQMR6HEDVWLiQ0$et ULHQGRODDFWLYLGDGDPEXODWRULDHOGHVDUUROORGH
al. GRQGHVHFUHyDOOiSRUOD;+83 DOWHUQDWLYDVDODKRVSLWDOL]DFLyQFRQYHQFLRQDO\OD
>5HG>;DU[D@+RVSLWDODULDGH8WLOL]DFLyQ3~EOL- aparición de tecnologías de alta complejidad moFDGH3URYHHGRUHV@TXHLQWHJUDHQXQDPLVPDUHG WLYDURQ XQD UHDGDSWDFLyQ GHO VLVWHPD 8%$ (Q
DVLVWHQFLDOWRGRVORVFHQWURVKRVSLWDODULRV\TXH HODxRVHHVWDEOHFLyHQ&DWDOXxDXQQXHYR
asegura la cobertura de las necesidades asisten- PRGHORGHFRQWUDWDFLyQ\DTXHSULQFLSDOPHQWH
ciales de la población. La heterogeneidad de ti- ODXQLGDGGHPHGLGDGHOSURGXFWRKRVSLWDODULROD
WXODULGDGGHORVFHQWURVLQWHJUDQWHVGHOD;+83 8%$EDVDGDHQXQSURGXFWRLQWHUPHGLRODHVWDQODGLYHUVLGDGHVWUXFWXUDO\HOFDUiFWHUGLIHUHQFLDO FLDKRVSLWDODULDQRWLHQHHQFXHQWDODFDVXtVWLFD
GH ORV VHUYLFLRV DVLVWHQFLDOHV TXH RIUHFHQ KL]R GHORVSDFLHQWHV HOcase mix \ODVHTXLYDOHQFLDV
necesario el establecimiento de un sistema de FRQ RWUDV OtQHDV SURGXFWR FRPR HV OD DFWLYLGDG
FRQWUDWDFLyQTXHLGHQWL¿FDUDORVVHUYLFLRVREMHWR DPEXODWRULDFDGDYH]FRQXQPD\RUSHVRSURJUHde compra y estableciera un sistema homogéneo VLYRQRUHÀHMDQODUHDOLGDGQLHQHOiPELWRFOtQLFR
y estructurado de contraprestación económica. ni probablemente en el de costos.
1RWRGDVVRQYHQWDMDVVLQHPEDUJRHQHOIRUPDWR*5'6HKDGLFKRSRUHMHPSORTXHHVWHPHFDQLVPRGHSDJRJHQHUD
LQHTXLGDGHVLPSRUWDQWHVHQORVSDFLHQWHVTXHXWLOL]DQWHUDSLDVLQWHQVLYDVPpGLFDV\DTXHWLHQGHQDDGPLWLUSDFLHQWHV
en el límite del continuumGHJUDYHGDGGHORVJUXSRV QRDVtODVWHUDSLDVTXLU~UJLFDVRODVXQLGDGHVFRURQDULDV 6HJ~Q
DOJXQRVDXWRUHVHOVLVWHPDGHSDJRSURVSHFWLYRSRU*5'HVnefastoSDUDKRVSLWDOHVXQLYHUVLWDULRVTXHWUDWDQDXQD
JUDQSURSRUFLyQGHSDFLHQWHVVHYHUDPHQWHHQIHUPRVFRQDOWRFRQVXPRGHWHUDSLDLQWHQVLYD8QHVWXGLRGHXQKRVSLWDO
VXEXUEDQRGH1XHYD<RUNGHFDPDV 0XxR]et al. SRUHMHPSORHVWDEOHFLyTXHHOPHFDQLVPRGHSDJRSRU
UHHPEROVREDVDGRHQ*5'JHQHUyDOKRVSLWDOXQDSpUGLGDGHFHUFDGHPLOORQHVGHGyODUHVGHDxRV(VLQWHUHVDQWH
FRPSDUDUHVWDD¿UPDFLyQFRQODSRVWXUDGHODGAO *HQHUDO$FFRXQWLQJ2I¿FHGHOJRELHUQRGHORV((88DOJRDVt
FRPROD2¿FLQD*HQHUDOGH&XHQWDV TXHUHDOL]DWDUHDVGHDXGLWRUtD\VXSHUYLVLyQGHSURJUDPDV\DFWLYLGDGHVGHO
JRELHUQR\GHWHUPLQDGHDOJXQDPDQHUDODVSROtWLFDVDUDQFHODULDVGHUHHPEROVRKRVSLWDODULRSDUDORVEHQH¿FLDULRVGH
Medicare HOSULQFLSDOVHJXURGHVDOXGGH((88TXHEULQGDFREHUWXUDDDOJRDVtFRPRPLOORQHVGHDPHULFDQRV
PD\RUHVGHDxRVLQVX¿FLHQWHVUHQDOHVFUyQLFRV\DOJXQRVGLVFDSDFLWDGRV VREUHSRUTXpQRVHPRGL¿FDQpVWDV
UHSUHVHQWDQGRODFDUD\FHFDGHXQDPLVPDUHDOLGDG(VSHFt¿FDPHQWHVHJ~QDOJXQRVDXWRUHV 2\H\%HOODP\ HQWUHXQGHORVSDFLHQWHVDGPLWLGRVHQXQD87,QXQFDUHFLELUiQWUDWDPLHQWRDFWLYR\KXELHUDQVLGRFDQGLGDWRV
DXQDXQLGDGGHFXLGDGRVLQWHUPHGLRVFRPRFRPHQWDPRVODGAO UHSRUWyTXHXQGHORVSDFLHQWHVDGPLWLGRV
HQOD87,WHQtDQPHQRVGHXQGHFKDQFHGHUHFLELUXQWUDWDPLHQWRDFWLYRSRUORTXHUHVSRQGLHQGRDTXLHQHVVH
TXHMDQGHLQDGHFXDFLyQGHSDJRVHOORVGLFHQKDEHULGHQWL¿FDGRXQVHJPHQWRQRGHVSUHFLDEOHGHSDFLHQWHVGH87,SDUD
TXLHQHVHVDLQWHUQDFLyQIXHLQQHFHVDULD HVGHFLUKXELHUDQVLGRWULEXWDULRVGHXQDXQLGDGLQWHUPHGLD ORTXHOOHYyDXQ
LQFUHPHQWRHQORVFRVWRV/D*$2FRQFOX\yVXSRVWXUDGLFLHQGRTXHORVSDJRVQRSRGUiQDXPHQWDUKDVWDWDQWRHVWRV
pacientes de bajo riesgo no dejen de ser admitidos en unidades críticas.
6
8 - Gestión presupuestaria y gestión de costos en la organización / 189
(OQXHYRVLVWHPDGHFRPSUDVHGH¿QLyFRQ
las siguientes premisas. Debe ser un instruPHQWR TXH SHUPLWD OD SUHVWDFLyQ GH VHUYLFLRV
FRQ OD JDUDQWtD GH FDOLGDG HTXLGDG \ H¿FLHQFLDTXHWUDWHKRPRJpQHDPHQWHDTXHOORTXHOR
VHDUHFRQRFLHQGRODVGLIHUHQFLDVLQWUtQVHFDVGH
ORV FHQWURV TXH SHUPLWD LQWURGXFLU HOHPHQWRV
LQFHQWLYDGRUHV R GHVLQFHQWLYDGRUHV D GHWHUPLnadas líneas de productos de manera global o
VHOHFWLYDHQIXQFLyQGHODSROtWLFDVDQLWDULDGHO
PRPHQWR\TXHGpXQWUDWRREMHWLYR\HTXLWDWLYRDORVFHQWURVFRQWUDWDGRV$OPLVPRWLHPSR
GHEH VHU XQ LQVWUXPHQWR ÀH[LEOH \ DGDSWDEOH
D ORV FDPELRV GHO HQWRUQR TXH SUHYHD ODV LQFLGHQFLDV GH IXWXUR VREUH WRGR ODV LQFRUSRUDFLRQHV GH VLVWHPD GH LQIRUPDFLyQ TXH D\XGHQ
DGHWHUPLQDUHOFRQRFLPLHQWRH[KDXVWLYRGHOD
DFWLYLGDG TXH VH UHDOL]D HQ ODV FRQVXOWDV DPEXODWRULDV\HQODVXUJHQFLDV\TXHSHUPLWDDO
comprador hacer una predicción presupuestaria
y gestionar el sistema con el mínimo coste adPLQLVWUDWLYRSRVLEOH
LECCIONES DE CATALUÑA: PARÁMETROS DE
CONTRATACIÓN Y SISTEMA DE PAGO POR LÍNEA DE
PRODUCTO
Hospitalización. El parámetro de compra es el
alta hospitalariaHLQFOX\HWDQWRHODOWDFRQYHQcional –la cirugía mayor ambulatoria– como la
hospitalización a domicilio. El sistema de pago
UHFRQRFHWDQWRODFDVXtVWLFDGHOFHQWURPHGLGD
HQ WpUPLQRV GH FRQVXPR UHODWLYR GH UHFXUVRV
como la capacidad estructural de éste.
Para el reconocimiento de la casuística atenGLGD XWLOL]D HO VLVWHPD GH FODVL¿FDFLyQ GH SDcientes GRD. Cada alta es asignada a un GRD
\FDGDXQRSRVHHXQSHVRUHODWLYRHQWHQGLHQGR
pVWHFRPRHOUHTXHULPLHQWRGHUHFXUVRVQHFHVDrios para abordar una patología concreta. Como
resultado de la composición de altas atendidas
VH REWLHQH HO SHVR UHODWLYR PHGLR GHO KRVSLWDO
350hosp 'H PDQHUD DQiORJD VH REWLHQH HO
SHVRUHODWLYRPHGLRGHOFRQMXQWRGHSURYHHGRUHV
GHOD;+83 350;+83 (OSHVRUHODWLYRGHFDGD
KRVSLWDOVHSRQHHQUHODFLyQFRQHOSHVRUHODWLYR
JOREDOGHOFRQMXQWRGHOD;+83\VHREWLHQHXQ
SHVR UHODWLYR FHQWUDGR TXH DFW~D GH LQWHQVLGDG
UHODWLYD GH UHFXUVRV ,55 GH DTXHO KRVSLWDO
'LFKR IDFWRU ,55 UHSUHVHQWD OD SRVLFLyQ TXH
cada hospital ocupa con respecto al global de la
;+83HQUHODFLyQFRQODSDWRORJtDTXHDWLHQGH
Para el reconocimiento de la estructura de los
FHQWURVVHXWLOL]DXQVLVWHPDGHQRPLQDGRGHJUDGRVGHSHUWHQHQFLD *3 EDVDGRHQHOPpWRGRHVtadístico grade of membership *3 GH0DQWRQ
TXHLGHQWL¿FDFXDWURWLSRVSXURVGHKRVSLWDOHVD
partir de un análisis estadístico de diferentes paUiPHWURVHVWUXFWXUDOHV Q~PHURGHFDPDVTXLUyIDQRVER[HVGHFRQVXOWDH[WHUQDHWF \RUJDQL]DWLYRV6HGHWHUPLQDSDUDFDGDKRVSLWDOODSUREDELOLGDGTXHWLHQHGHSHUWHQHFHUDFDGDXQRGHORV
WLSRVSXURVORTXHGDFRPRUHVXOWDGRFRQ¿JXUDFLRQHVHVWUXFWXUDOHVHVSHFt¿FDVSDUDFDGDFHQWUR
(OFRPSUDGRUS~EOLFR &DW6DOXW UHFRQRFHODHVWUXFWXUDGHORVFHQWURVGHDFXHUGRFRQFULWHULRV
GHXWLOL]DFLyQH¿FLHQWHGHORVUHFXUVRVWHQLHQGR
HQ FXHQWD OD DFWLYLGDG FRQWUDWDGD \ HO FRQFHSWR
de capacidad necesaria en función de criterios de
SODQL¿FDFLyQHVGHFLUQRWRGRVORVLQFUHPHQWRV
estructurales de los centros deben ser reconocidos
SRUOD*3&RQOD¿QDOLGDGGHXQL¿FDUORVSDUiPHWURVGHFRPSUDVHGH¿QHXQtQGLFHUHODWLYRGH
HVWUXFWXUD ,5( ~QLFRSDUDFDGDKRVSLWDO ,5( \TXHHVWDEOHFHODUHODFLyQHQWUHHOSUHFLRGHDOWD
por estructura de dicho hospital y el precio medio
SRUDOWDGHOD;+83
El IRR se calcula anualmente a partir de los
GDWRVGHO&0%'$+TXHIDFLOLWDFDGDKRVSLWDO\
recoge la casuística atendida durante el segundo
semestre de hace dos años y el primer semesWUHGHODxRDQWHULRU(O,5(VHYXHOYHDFDOFXODU
cada 4 años a partir de los datos recogidos en
una encuesta sobre la estructura del hospital.
A partir del presupuesto global destinado a la
compra para hospitalización y el número de alWDVDFRQWUDWDUVHGHWHUPLQDHOSUHFLRPHGLRSRU
DOWD SRU FRPSOHMLGDG \ HVWUXFWXUD GH OD ;+83
8QDYH]GH¿QLGRHOSHVRTXHVHDVLJQDDOIDFWRU
complejidad y al factor estructura\FRQRFLHQGR
HO,55\HO,5(GHFDGDKRVSLWDOVHGHWHUPLQD
anualmente el precio por alta de cada hospital.
Consultas externas. El parámetro de compra
son las primeras visitas. El sistema de pondeUDFLyQUHFRQRFHSRUXQODGRHOSDSHOTXHFDGD
centro debe tener en el sistema diferenciando
FXDWURQLYHOHVGHKRVSLWDOHVHQXQDFODVL¿FDFLyQ
GLVFUHWD QLYHO KRVSLWDO DLVODGR JHRJUi¿FDPHQWHQLYHOKRVSLWDOJHQHUDOEiVLFRQLYHO
KRVSLWDOGHUHIHUHQFLD\QLYHOKRVSLWDOGHDOWD
WHFQRORJtD(OSUHFLRSRUYLVLWDYDUtDVHJ~QHOQLYHOGHKRVSLWDO(OYROXPHQWRWDOGHYLVLWDVTXH
hay por contratar se determina según las necesiGDGHVGHODSREODFLyQGHOiUHDGHLQÀXHQFLD\VH
FDOFXODDSOLFDQGRODWDVDGHUHLWHUDFLyQGH¿QLGD
190 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
SDUDHOKRVSLWDO UDWLRVXFHVLYDVSULPHUDV VHJ~Q
ODFRPSRVLFLyQGHODVSULPHUDVYLVLWDVSRUHVSHcialidad y los ratios estándares de reiteración.
Urgencias. ([LVWHQGRVWLSRVGHFRQWUDWDFLyQ
GHHVWDOtQHDGHSURGXFWR8QDSDUWHGHOSUHVXpuesto se destina al reconocimiento de estrucWXUDV PtQLPDV GH VHUYLFLRV GH XUJHQFLDV SDUD
DTXHOORV FDVRV HQ ORV TXH VH KD SODQL¿FDGR OD
QHFHVLGDG GH H[LVWHQFLD GHO VHUYLFLR SHUR GLItFLOPHQWH SRGUtD VHU YLDEOH HVWH GLVSRVLWLYR VL
WXYLHUDTXHDXWR¿QDQFLDUVHFRQODDFWLYLGDGTXH
UHDOL]D6RQORVFDVRVGHGLVSRVLWLYRVGHXUJHQFLDV DLVODGRV JHRJUi¿FDPHQWH FRQ HVFDVD GLmensión o ambas circunstancias.
La otra parte del presupuesto se destina a la
FRPSUD GH OD DFWLYLGDG XUJHQWH TXH GH IRUPD
SRQGHUDGDFDGDFHQWURGHEHUHDOL]DUGHQWURGHO
VLVWHPDGHKRVSLWDOJHQHUDOEiVLFRGHUHIHUHQFLD
RDOWDWHFQRORJtDUHFRQRFLHQGRDOLJXDOTXHSDUD
ODFRQVXOWDH[WHUQDFXDWURQLYHOHVGHKRVSLWDOHV
FRQXQSUHFLRHVSHFt¿FRSRUXUJHQFLDDWHQGLGD
SDUDFDGDQLYHOGHKRVSLWDO
Técnicas, tratamientos y procedimientos esSHFt¿FRV(VWDOtQHDLQFOX\HORVSURFHGLPLHQWRV
WpFQLFDV\WUDWDPLHQWRVLQGLYLGXDOL]DGRVTXHVH
OOHYDQ D FDER GHQWUR GHO iPELWR KRVSLWDODULR
no incluidos en otras líneas de producto y cuya
UHDOL]DFLyQHVWiYLQFXODGDDODH[LVWHQFLDGHGLVSRVLWLYRVDVLVWHQFLDOHVHVSHFt¿FRVLQGHSHQGLHQtemente de la complejidad de la técnica y de la
necesidad de ingreso del paciente. Se incluyen
ODFLUXJtDPHQRUDPEXODWRULDODDFWLYLGDGHQUpJLPHQGHOKRVSLWDOGHGtDODUDGLRORJtDLQWHUYHQFLRQLVWDODUDGLRWHUDSLDODUHKDELOLWDFLyQDPEXODWRULDODKHPRGLQiPLFDFDUGLDFD\KHSiWLFDHO
diagnóstico prenatal y las pruebas diagnósticas
de alta complejidad.
El parámetro de compra es por caso atendiGR GHWHUPLQDQGR HO Q~PHUR GH FDVRV GH FDGD
categoría a contratar y el precio según se aprueba en el catálogo anual.
&RQWUDWDFLyQ HVSHFt¿FD GH RWURV VHUYLFLRV
(OVLVWHPDGHSDJRVHUHVHUYDODSRVLELOLGDGGH
¿QDQFLDUGHIRUPDHVSHFt¿FDGHWHUPLQDGRVVHUYLFLRV R GLVSRVLWLYRV TXH UH~QDQ XQDV FDUDFWHUtVWLFDVHVWDEOHFLGDVD SUR\HFWRVTXHSHUPLWDQ
ODYLDELOLGDGGHGLVSRVLWLYRVHVSHFLDOHVGHUHFRQRFLGDQHFHVLGDG SHMXQDXQLGDGGHTXHPDGRV E DFWLYLGDGHVVHOHFWLYDVTXHHVQHFHVDULR
LQFHQWLYDURUHJXODUGHDFXHUGRFRQFULWHULRVGH
SROtWLFDVDQLWDULDF D\XGDHQORVSULPHURVWLHPSRVGHIXQFLRQDPLHQWRGHQXHYRVGLVSRVLWLYRVR
FHQWURVKDVWDDOFDQ]DUODGLPHQVLyQDGHFXDGD\
G UHFRQRFLPLHQWRGHODIXQFLyQGRFHQWH\XQLYHUVLWDULD GH ORV FHQWURV (VWRV SUR\HFWRV R VLtuaciones especiales se reconocen en el sistema
GHFRQWUDWDFLyQGHVHUYLFLRVPHGLDQWHODDUWLFXODFLyQGHSURJUDPDVHVSHFt¿FRV
Marginalidad. /D DFWLYLGDG TXH VH UHDOL]D
FRQ H[FHVR D OD FRQWUDWDGD WLHQH XQ WUDWDPLHQto de marginalidad. Éste es un tratamiento esSHFLDOPRGXODGRU\HQJHQHUDOHOSDJRHVVyOR
XQ SRUFHQWDMH GHO SUHFLR FRQWUDWDGR$Vt HQ OD
KRVSLWDOL]DFLyQXQH[FHVRGHDFWLYLGDGGHKDVWD
XQ GH OD PLVPD VH DERQD VyOR D XQ GHO SUHFLR GHO DOWD KRVSLWDODULD \ VL VH H[FHGH
HVWHHQWRQFHVODWDULIDSDVDDVHUGHVyORHO
GHOSUHFLRLQLFLDO(QODDFWLYLGDGGHFRQVXOWDVH[WHUQDV\XUJHQFLDVFXDOTXLHUH[FHVRGH
DFWLYLGDGTXHVXSHUHODFRQWUDWDGDVHSDJDDXQ
\DXQUHVSHFWLYDPHQWHGHODWDULID(VWH
mecanismo responde conceptualmente a la diIHUHQFLDFLyQHQWUHFRVWHVWRWDOHV\PDUJLQDOHV\
HV EiVLFR SDUD HO FRPSUDGRU \D TXH OH SHUPLWH
OLPLWDUODVGHVYLDFLRQHVVREUHHOSUHVXSXHVWRGH
compra acordado.
NUEVAS TENDENCIAS
EN LA CONTRATACIÓN DE SERVICIOS
/RVVLVWHPDVGHFRQWUDWDFLyQGHVHUYLFLRVDVLVWHQFLDOHV EDViQGRVH HQ OD DFWLYLGDG R ORV SURJUDPDV VLPLODUHV DO TXH VH DSOLFD HQ &DWDOXxD KDQ DSRUWDGR HOHPHQWRV SRVLWLYRV FRPR
OD PHMRUD GH OD H¿FLHQFLD GH ORV SURYHHGRUHV
GHELGRDODFRPSUDSURVSHFWLYDGHVHUYLFLRVOD
LQFRUSRUDFLyQGHHOHPHQWRVPiVFXDOLWDWLYRVGH
HYROXFLyQ GH ORV UHVXOWDGRV GH ORV FRQWUDWRV D
FDXVDGHORVREMHWLYRVYLQFXODGRVDODSROtWLFD
VDQLWDULD\DORVSODQHVGHVDOXGODLQFHQWLYDFLyQRGHVLQFHQWLYDFLyQGHGHWHUPLQDGDVOtQHDV
GH VHUYLFLR OD VHSDUDFLyQ GH ODV IXQFLRQHV GH
FRPSUD\SURYLVLyQGHVHUYLFLRV\ODPHMRUDGH
los sistema de información sobre el producto
KRVSLWDODULR 6LQ HPEDUJR GLFKRV VLVWHPDV GH
FRQWUDWDFLyQSUHVHQWDQFODUDVOLPLWDFLRQHVTXH
es necesario superar:
1.Se basan en productos intermedios del proFHVRVLQRULHQWDUVHDOFRQMXQWR\HVSHFL¿FDmente al resultado del acto asistencial sobre
la salud.
6RQVLVWHPDVGH¿QLGRVSULQFLSDOPHQWHDSDUWLUGHODRIHUWDH[LVWHQWH\QRGHODGHPDQGD
y necesidades de la población.
8 - Gestión presupuestaria y gestión de costos en la organización / 191
6RQFRPSDUWLPHQWDGRV\QRIDYRUHFHQODFRODERUDFLyQHQWUHSURYHHGRUHV
4.Son sistemas fragmentados por línea de
SURGXFWR OR TXH RULJLQD GXSOLFLGDGHV VLQ
LQFHQWLYDU DFWXDFLRQHV GHQWUR GH XQ PLVPR
SURYHHGRURHQWUHSURYHHGRUHVTXHEXVTXHQ
VLQHUJLDV R QXHYDV IyUPXODV PiV H¿FLHQWHV
de atención por medio de la sustitución entre
líneas de atención.
6RQ VLVWHPDV TXH VyOR LQFRUSRUDQ PHGLGDV
ad hoc GH FDOLGDG GH ORV VHUYLFLRV GH FDGD
OtQHDGHSURGXFWR\VLQXQDHYDOXDFLyQJORbal del impacto de todas las actuaciones del
SURYHHGRUVREUHODVDOXGGHODSREODFLyQGH
referencia.
6RQVLVWHPDVTXHLQFHQWLYDQHOLQFUHPHQWRGH
DFWLYLGDGFRQHOULHVJRGHJHQHUDUXQDGHPDQGDLQGXFLGDDSHVDUGHH[LVWLUPDUJLQDOLGDG
El médico responsable siempre ha entendiGRORTXHHVJHVWLRQDUXQHQIHUPRFRQFUHWRGH
PDQHUD H¿FD] (O SUREOHPD GH WUDWDU HVWDGtVWLFDPHQWHHOFRQMXQWRGHORVSURFHVRVDOQRHVWDU
GH¿QLGRV\DJUXSDGRVHUDTXHLPSHGtDXWLOL]DU
instrumentos de gestión del conjunto de los procesos. El case mix ha demostrado ser ese instrumento. Hoy ya se puede gestionar la producFLyQGHXQKRVSLWDOGHXQVHUYLFLRHLQFOXVRGH
FDGDPpGLFRFOtQLFR UHVSRQVDEOHGHSDFLHQWHV teniendo en cuenta los procesos médicos. PueGHQ GH¿QLUVH SURWRFRORV SDUD WRPDU GHFLVLRQHV
para cada proceso o grupo de procesos simila-
res. Pueden controlarse los resultados y compaUDUVHFRQHOREMHWLYR/RVVLVWHPDVGHLQIRUPDción permiten conocer los consumos medios de
UHFXUVRV R SURGXFWRV LQWHUPHGLRV SRU SURFHVR
VHUYLFLR\PpGLFRDVtFRPRODVGHVYLDFLRQHV\
analizar sus causas.
(V YLWDO SDUD OD JHVWLyQ GH¿QLU \ FRQWURODU
los circuitos y tiempos de las dos o tres enferPHGDGHV PiV IUHFXHQWHV GH FDGD HVSHFLDOLGDG
TXHUHSUHVHQWDQPiVGHOGHVXVSDFLHQWHV
(VWHSDWUyQLQGLYLGXDOL]DGRSRUSURFHVRSHUPLWH
plantear políticas de calidad sobre el producto
¿QDOWHUPLQDGR TXHQRHVVLPSOHPHQWHODVXPD
GH ODV FDOLGDGHV GH ORV FRPSRQHQWHV 3RU RWUD
SDUWHYXHOYHDDVLJQDUDOPpGLFRHOSDSHOGHUHVSRQVDEOHPi[LPRGHFDGDSURFHVRFRQWRGROR
TXHVLJQL¿FDPLHQWUDVWRGDODHVWUXFWXUDKRVSLWDODULDVHRUJDQL]DDOVHUYLFLRGHOSURGXFWR¿QDO\
por tanto a disposición de las decisiones responsables del médico implicado. En un sistema de
LQIRUPDFLyQHQHOTXHQRVRODPHQWHGLVSRQHPRV
del case mix sino además de costos de los proceVRVODJHVWLyQSRUSURFHVRVWDPELpQLQFOX\HVXV
FRVWRVWDQWR¿QDOHVRWRWDOHVFRPRGHORVGLYHUsos componentes. El médico es responsable del
FRVWR ¿QDO HQ FXDQWR D UHFXUVRV XWLOL]DGRV QR
en cuanto al costo unitario de cada uno de estos
UHFXUVRVTXHHVUHVSRQVDELOLGDGGHOVHUYLFLRTXH
ORSURGXFHRORVLUYH$PEDVFRVDVLQÀX\HQHQ
HOFRVWR¿QDOSHURVHJHVWLRQDQGHIRUPDLQGHpendiente.
CAPÍTULO 8 - ANEXO 1
MINUTA SOBRE ELABORACIÓN DE PRESUPUESTO
MINISTERIO DE SALUD - GOBIERNO DE LA CIUDAD DE BUENOS AIRES
1. OBJETIVO
Para la elaboración del presupuesto se utili]DQGLIHUHQWHVIRUPDVGHSUHVHQWDFLyQGHDFXHUElaborar el instrumento de programación eco- GRDGLIHUHQWHVFODVL¿FDFLRQHV
‡3RUREMHWRGHOJDVWR
nómica que materialice a corto plazo la política
GHOD-XULVGLFFLyQD¿QGHHVWDEOHFHUDFFLRQHV ‡3RUIXHQWHGH¿QDQFLDPLHQWR
‡3RUDSHUWXUDSURJUDPiWLFD
para el cumplimiento de sus funciones.
(OSUHVXSXHVWRGHEHH[SUHVDUODUHODFLyQItVL- 3.1 Clasificación por objeto del gasto
FR¿QDQFLHUDGHODDGPLQLVWUDFLyQS~EOLFDFRPR
Los insumos utilizables se resumen en cuatro
el resultado de un proceso de producción.
(QHVWHVHQWLGRODGH¿QLFLyQGHODQRUPDWL- categorías:
YDHVFHQWUDOL]DGDSRUXQyUJDQRUHFWRUPLHQWUDV ‡5HFXUVRV+XPDQRV ,QFLVR LQFOX\HODUHWULEXFLyQGHORVVHUYLFLRVSHUVRQDOHVSUHVWDTXHODHODERUDFLyQ\HMHFXFLyQHVGHVFHQWUDOL]Ddos en relación de dependencia y las corresda en las unidades ejecutoras.
pondientes contribuciones patronales. Abarca también las retribuciones en concepto de
DVLJQDFLRQHVIDPLOLDUHVVHUYLFLRVH[WUDRUGL2. ETAPAS PRESUPUESTARIAS
narios y prestaciones sociales recibidas por
los agentes del Gobierno de la Ciudad Autó‡ )RUPXODFLyQ (WDSD GH HODERUDFLyQ GHO SURnoma de Buenos Aires.
yecto de presupuesto
‡3URJUDPDFLyQ(WDSDGHGLDJUDPDFLyQGHOD ‡ %LHQHV GH &RQVXPR ,QFLVR 0DWHULDOHV
y suministros consumibles para el funcioejecución trimestral
namiento de los entes estatales. Las prin‡(MHFXFLyQ(WDSDGHUHDOL]DFLyQGHOJDVWR
FLSDOHV FDUDFWHUtVWLFDV TXH GHEHQ UHXQLU
‡(YDOXDFLyQ5HVXOWDGRGHODJHVWLyQDQXDO
los bienes comprendidos en este inciso son
WDOHV TXH SRU QDWXUDOH]D HVWpQ GHVWLQDGRV
DO FRQVXPR ¿QDO LQWHUPHGLR SURSLR R GH
3. TÉCNICA
WHUFHURV\TXHVXWLHPSRGHXWLOL]DFLyQVHD
UHODWLYDPHQWH FRUWR SRU OR JHQHUDO GHQWUR
La técnica utilizada por el Gobierno de la Ciudel ejercicio.
GDGHVHOSUHVXSXHVWRSRUSURJUDPDVFX\RSURFHVREiVLFRLPSOLFDODGH¿QLFLyQGHSURGXFFLyQ ‡6HUYLFLRV ,QFLVR &RPSUHQGHVHUYLFLRVEiVLFRVDOTXLOHUHVGHHGL¿FLRVWHUUHQRV\HTXLterminal de cada una de las unidades ejecutoras.
SRVVHUYLFLRVGHPDQWHQLPLHQWROLPSLH]D\
La producción terminal es el resultado de un
UHSDUDFLyQVHUYLFLRVSURIHVLRQDOHVWpFQLFRV
SURFHVR GH SURGXFFLyQ TXH FRPELQD DFFLRQHV
\RSHUDWLYRVSXEOLFLGDGHLPSUHVLyQVHUYLRSHUDFLRQDOHV FX\RV LQVXPRV \ SURGXFWRV VRQ
FLRVFRPHUFLDOHV\¿QDQFLHURVHWF
SHUIHFWDPHQWHGH¿QLEOHVHLQGHSHQGLHQWHV
194 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
‡%LHQHVGH8VR ,QFLVR *DVWRVTXHVHJHQHUDQ
SRUODDGTXLVLFLyQRFRQVWUXFFLyQGHELHQHVGH
FDSLWDOTXHDXPHQWDQHODFWLYRGHODVHQWLGDGHV
GHO 6HFWRU 3~EOLFR HQ XQ SHUtRGR GDGR VLHQGRpVWRVORVELHQHVItVLFRVFRQVWUXFFLRQHV\R
HTXLSRVTXHVLUYHQSDUDSURGXFLURWURVELHQHV
RVHUYLFLRVQRVHDJRWDQHQHOSULPHUXVRTXH
GHHOORVVHKDFHWLHQHQXQDGXUDFLyQVXSHULRUD
XQDxR\HVWiQVXMHWRVDGHSUHFLDFLyQ,QFOX\H
DVLPLVPRORVDFWLYRVLQWDQJLEOHV
(VWDDSHUWXUDFRQVWLWX\HODFODVL¿FDFLyQSRU
REMHWR GHO JDVWR XWLOL]DGD FRPR LQVWUXPHQWR
LQIRUPDWLYR SDUD HO DQiOLVLV \ VHJXLPLHQWR GH
OD JHVWLyQ ¿QDQFLHUD GHO VHFWRU S~EOLFR 3DUD
FRPSOHWDU GHEHUiQ WHQHUVH HQ FXHQWD DGHPiV
ODV SDUWLGDV GHO ,QFLVR ± 7UDQVIHUHQFLDV TXH
FRUUHVSRQGHQDWUDQVDFFLRQHVTXHQRVXSRQHQOD
FRQWUDSUHVWDFLyQGHELHQHVRVHUYLFLRV
3.2 Clasificación por fuentes
de financiamiento
/DIXHQWHGH¿QDQFLDPLHQWRHVWiOLJDGDDODQDturaleza legal del recurso; abarca dos grandes
grupos: los Recursos propiamente dichos y el
)LQDQFLDPLHQWRSURYHQLHQWHGHOXVRGHOFUpGLWR
ORV TXH D VX YH] VH VXEFODVL¿FDQ HQ GLVWLQWDV
FXHQWDV/DFODVL¿FDFLyQSRUIXHQWHGH¿QDQFLDmiento consiste en presentar los gastos públicos
YLQFXODGRVDORVUHFXUVRVTXHORV¿QDQFLDQ
(OJDVWRGHO0LQLVWHULRFODVL¿FDGRVHJ~QVX
¿QDQFLDPLHQWR VH FRQIRUPD FRQ ODV VLJXLHQWHV
fuentes:
‡11 Tesoro de la Ciudad: Recursos originados en los ingresos de rentas generales. Se
caracterizan por ser de libre disponibilidad y
VLQFDUJRGHGHYROXFLyQSRUORTXHH[FOX\H
las transferencias afectadas a programas esSHFt¿FRV GH OD$GPLQLVWUDFLyQ &HQWUDO \ HO
XVRGHOFUpGLWRLQWHUQRRH[WHUQR
‡5HFXUVRVFRQDIHFWDFLyQHVSHFt¿FD ReFXUVRVDIHFWDGRVSRUQRUPDVORFDOHVHQORV
WpUPLQRVGHODUWtFXORGHOD/H\1žSDUD
¿QDQFLDUHVSHFt¿FDPHQWHGHWHUPLQDGRVSURJUDPDV R DFWLYLGDGHV GH OD $GPLQLVWUDFLyQ
Central. No incluye las transferencias afecWDGDVDSURJUDPDVHVSHFt¿FRVGHOD$GPLQLVtración Central ni las transferencias internas.
3DUD HO FDVR HVSHFt¿FR GHO 0LQLVWHULR GH
6DOXGHVWRV5HFXUVRVVHFRQIRUPDQSRUODV
prestaciones médicas de los distintos hospitales de la Ciudad de Buenos Aires.
‡ 14 Transferencias afectadas: Incluye reFXUVRVSURYHQLHQWHVGHKHUHQFLDVOHJDGRV\
GRQDFLRQHV\DTXHOORVWUDQVIHULGRVSRU*Rbierno e instituciones nacionales.
‡ 15 Transferencias internas: Se caracterizan
SRU FRQVWLWXLU UHFXUVRV SURYHQLHQWHV GH XQD
HQWLGDG GHVFHQWUDOL]DGD GHVWLQDGRV DO ¿QDQciamiento de otra entidad descentralizada. En
HOSUHVXSXHVWRGHO0LQLVWHULRGH6DOXGGLFKD
)XHQWHGH)LQDQFLDPLHQWRVHFRQVWLWX\HFRQORV
UHFXUVRVSURYHQLHQWHVGHO,QVWLWXWRGHO-XHJR
‡ 22 Financiamiento externo: Créditos otorJDGRVSRUORVJRELHUQRVGHRWURVSDtVHVORV
organismos internacionales y las entidades
¿QDQFLHUDVS~EOLFDVRSULYDGDVGHOVHFWRUH[WHUQR(QHO0LQLVWHULRGH6DOXGORVJDVWRV
FRUUHVSRQGLHQWHV D ORV 3UR\HFWRV GH ,QYHUVLyQVH¿QDQFLDQSDUFLDOPHQWHFRQSUpVWDPR
del Banco Interamericano de Desarrollo.
3.3 Apertura programática
/DDSHUWXUDFRQVLVWHHQODGH¿QLFLyQGHODUHGGH
SURJUDPDV VXESURJUDPDV DFWLYLGDGHV SUR\HFtos y obras.
‡352*5$0$ Proceso de producción de un
SURGXFWR WHUPLQDO FRQWHQLGR HQ XQD UHG GH
acciones presupuestarias.
‡ 68%352*5$0$ Se utiliza cuando la
producción terminal de un programa admite
GHVDJUHJDFLRQHVTXHWDPELpQVRQSURGXFWRV
terminales del programa.
‡$&7,9,'$'(6 Es una acción presupuesWDULDGHPtQLPRQLYHOHLQGLYLVLEOHDORV¿QHV
de la asignación formal de recursos.
‡352<(&72(VWiIRUPDGRSRUDFWLYLGDGHV
y obras cuyo producto es un bien de capital y
tiene por objeto crear o ampliar la capacidad
GHRIHUWDGHELHQHV\VHUYLFLRV
‡OBRAS: Categoría programática de mínimo niYHOHQHOFDPSRGHODLQYHUVLyQTXHFRQVWLWX\H
dentro del proyecto una producción intermedia.
En el Ministerio de Salud la apertura proJUDPiWLFDSDUDHODxRUHVSRQGHDODLPSOHPHQWDFLyQGHODVSROtWLFDVS~EOLFDV¿MDGDVSDUD
HODxR6HRUJDQL]DHQRFKRSURJUDPDVSUHVXSXHVWDULRVGHSURGXFFLyQWHUPLQDODGLFLRQDOHV
DXQRGHDFWLYLGDGHVFHQWUDOHV\GRVGHDFWLYLGDdes comunes de cada una de las Subsecretarías.
'H HVWRV RFKR SURJUDPDV FLQFR FRUUHVSRQden a funciones de producción centralizadas:
8 - ANEXO 1 - Minuta sobre elaboración de presupuesto / 195
PROGRAMA
Atención Primaria de la Salud
Control de Zoonosis
Sistema de Atención de
Emergencias Médicas
Acciones en Salud de
Coordinación Centralizada
META
Población cubierta
Acciones de Zoonosis
Atención Médica de
Emergencias
UNIDAD DE MEDIDA
Persona cubierta
Prestaciones de Zoonosis
6HUYLFLR0pGLFRGH
Emergencias
Población cubierta
Persona bajo tratamiento
Atención Médica General
Prestaciones Hospitalarias
Atención de Salud Mental
Pretación hospitalaria de Salud
Mental
Prestación hospitalaria
PRQRYDOHQWH
3DWRORJtDV(VSHFt¿FDV
(JUHVRFOtQLFRTXLU~UJLFR
HTXLYDOHQWH
(JUHVRFOtQLFRTXLU~UJLFR
HTXLYDOHQWH
(JUHVRFOtQLFRTXLU~UJLFR
HTXLYDOHQWH
(VWDXQLGDGGHPHGLGDVHHODERUDDSDUWLUGHODVXPDDOJHEUDLFDGHORVHJUHVRVFOtQLFRVORVHJUHVRVGHXQLGDGFRURQDULDORV
HJUHVRVGHWHUDSLDLQWHQVLYD\FRQVXOWDVDPEXODWRULDVFRQXQSRQGHUDGRUGLVWLQWRSDUDFDGDXQR
RSRUWXQDPHQWHSRUOD2*(38GHO0LQLVWHULRGH
+DFLHQGDVHSURFHGLyDUHDOL]DUVROLFLWXGUHOHYDPLHQWRFRQVROLGDFLyQ\KRPRJHQHL]DFLyQGH
la información remitida por las unidades ejecutoras para esta etapa.
(QWUHORVSDVRVUHDOL]DGRVVHSURFHGLyDVROLFLWDUYtDPHPRUDQGR
‡ Direcciones Generales y Coordinaciones
(OUHVWRHVODSURGXFFLyQTXHFRUUHVSRQGHD del Ministerio:
GHVFULSFLyQ GH SODQHV SURJUDPDV DFWLYLGDla atención de personas para la solución de proGHVDFFLRQHV\UHVXOWDGRVDREWHQHU
EOHPDVGHVDOXGHVGHFLUODSURGXFFLyQKRVSL UHTXHULPLHQWRV GH UHFXUVRV KXPDQRV PDWHtalaria. Se organiza en tres grandes programas
riales y físicos
SUHVXSXHVWDULRV GDGR TXH LPSOLFDQ SURGXFWRV
‡ Hospitales: se remitió a los directores de
FXDOLWDWLYDPHQWHGLIHUHQWHV(VWRVVRQ
hospital y Administradores:
‡$WHQFLyQ0pGLFD*HQHUDO
GHVFULSFLyQ GH SODQHV SURJUDPDV DFWLYLGD‡$WHQFLyQGH6DOXG0HQWDO
GHVDFFLRQHV\UHVXOWDGRVDREWHQHU
‡3DWRORJtDVHVSHFt¿FDV
UHTXHULPLHQWRV GH UHFXUVRV KXPDQRV PDWHriales y físicos
Cada hospital constituye un subprograma y
HQ UHODFLyQ D ORV LQFLVRV \ SULQFLSDOHV
unidad ejecutora.
consumos
- inciso 4: bienes de uso
3.3.1 Metas físicas
/RV SURGXFWRV FRQVWLWX\HQ ELHQHV \ VHUYLFLRV
TXHVXUJHQGHODFRPELQDFLyQGHLQVXPRVFX\D
PHGLFLyQVHGH¿QHPHGLDQWHODVPHWDVItVLFDV$ 5. ANÁLISIS EFECTUADOS
WDO¿QVHHVWDEOHFHQXQLGDGHVGHPHGLGD
(QHO0LQLVWHULRGH6DOXGORVSURGXFWRV¿QD- 3DUDODLQWHJUDFLyQ¿QDOGHHVWDSUHVHQWDFLyQVH
OHVVHGH¿QHQHQODVPHWDVItVLFDVTXHVHPXHV- GHVWDFDQ DOJXQRV tWHPV TXH UHTXLHUHQ HVSHFLDO
énfasis. Se los detalla a continuación siguiendo
WUDQHQOD7DEOD
ODFODVL¿FDFLyQSRUREMHWRGHOJDVWR
‡,QIUDHVWUXFWXUD\(TXLSDPLHQWR
‡$WHQFLyQ3ULPDULDGHOD6DOXG
‡$FFLRQHVHQ6DOXGGH&RRUGLQDFLyQ&HQtralizada
‡6LVWHPDGH$WHQFLyQGH(PHUJHQFLDV0pdicas-SAME
‡&RQWUROGH=RRQRVLV
4. CRONOGRAMA 2008
Bienes de consumo
Con relación a la programación de las compras
&RQHOREMHWLYRGHIRUPXODUHODQWHSUR\HFWRSUH- de la Jurisdicción y considerando la puesta en
VXSXHVWDULR\DWHQGLHQGRDOFURQRJUDPDHQYLDGR YLJHQFLDGHODQXHYD/H\GHFRPSUDV1ž
196 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
VHSODQWHyXQHVTXHPDGHWUDEDMRTXHVHRULHQWD
DGRVYtDVGHDFFLyQ
‡Compra centralizada
‡Compra descentralizada
Bienes de uso (Inciso 4)
7UDGLFLRQDOPHQWHHOWHFKRTXHVH¿MDSDUDODUHSRVLFLyQGHOHTXLSDPLHQWRKRVSLWDODULRQRHVVX¿ciente para cubrir el desgaste en cada período. Por
ORTXHDQWHODSRVLELOLGDGGHHQIUHQWDUQXHYDVUHVCompra centralizada: (O REMHWLYR HV OD GH- WULFFLRQHVHQHVWHLQFLVRVHUHOHYyHQODVXQLGDGHV
¿QLFLyQGHORVDOFDQFHVGHXQD~QLFDFDQDVWDGH HMHFXWRUDVODVFDUSHWDVHIHFWLYDPHQWHLQLFLDGDV
2EUDVVLQGH¿QLFLyQ
LQVXPRVPHGLFDPHQWRV GHVFDUWDEOHV UHDFWLYRV
GHODERUDWRULRHWFSDUDODDGTXLVLFLyQGHDTXHllos bienes cuya característica sean las de mayor Gastos en personal (Inciso 1)
FRQVXPR FRQVLGHUDQGR FDQWLGDGHV R PRQWRV 3DUD OD GHWHUPLQDFLyQ GHO JDVWR HQ SHUVRQDO
FX\DHVWLPDFLyQUHDOL]DOD2*(38VHFRQVLGHVLJQL¿FDWLYRV
8QDYH]GH¿QLGDODFDQDVWDTXHQRFXEUHOD ra como punto de partida la cantidad de cargos
WRWDOLGDG GHO FRQVXPR KRVSLWDODULR HO REMHWLYR OLTXLGDGRVHQORVKDEHUHVGHOSHUVRQDOGHSODQWD
HV FDQDOL]DU HVWDV FRPSUDV SRU XQD ~QLFD YtD permanente correspondiente al mes de julio. SoFHQWUDOL]DGDHYLWDQGRODGXSOLFLGDGGHFRPSUDV EUH HVWD EDVH ORV KRVSLWDOHV GHEHQ UDWL¿FDU ORV
TXHVHSRGUtDSURGXFLUVLORVKRVSLWDOHVVLJXLHVHQ OLVWDGRVD¿QGHJDUDQWL]DUHO¿QDQFLDPLHQWRGH
WRGDVODVYDFDQWHVGHFDGDXQLGDG
DGTXLULHQGRSRUVXVVLVWHPDVGHFRPSUD
3DUDTXHODHVWLPDFLyQGHOJDVWRHQSHUVRQDO
Los consumos de las direcciones generales y
FRRUGLQDFLRQHV GH QLYHO FHQWUDO VH LQFOXLUiQ HQ TXHGHFRPSOHWDVHUHTXLHUHHVWLPDU\YDORUL]DU
HVWD FDQDVWD DO DWHQFLyQ SULPDULD GH VD- de modo adicional los siguientes ítems:
OXGUHGHVGHVDOXGVDOXGPHQWDOFRRUGLQDFLyQ ‡1RYHGDGHVGHQRPEUDPLHQWRVHQFXUVRHLQFRUSRUDFLRQHV QR OLTXLGDGRV KDVWD RGRQWROyJLFDHWF
GHDFXHUGRDORVH[SHGLHQWHVKR\HQWUiPLWH
Para el armado de la canasta se está trabajanen el Ministerio.
GRSRUJUXSRVGHLQVXPRVDVDEHUPHGLFDPHQWRVODERUDWRULRPDWHULDOGHVFDUWDEOHHLQVXPRV ‡ &DQWLGDG 5HVLGHQWHV GHELGR D TXH OD UHQRYDFLyQ VH SURGXFH KDFLD PHGLDGRV GH DxR
biomédicos. Se estima estar incluyendo entre el
WRGDYtDQRHVWiQODVOLVWDVQLQRPEUDPLHQWRV
\GHOFRQVXPRKRVSLWDODULR
para tomar como base.
‡&RQFXUVRVFRQIRUPHDODQRUPDWLYDYLJHQWH
Compra descentralizada:'H¿QLGDODFDQDV‡Módulos de enfermería: se estima cantidad en
WDGHFRPSUDFHQWUDOL]DGDTXHGDUtDDXWRPiWLFDEDVHDODHYROXFLyQKLVWyULFD
PHQWHVHOHFFLRQDGDODYDULHGDG\DOFDQFHGHOD
‡Suplencias de guardia: debería programarse una
FRPSUDGHVFHQWUDOL]DGDTXHHMHFXWDUiQORVKRVcantidad entre transitorias y permanentes.
SLWDOHVPHGLDQWHORVGLVWLQWRVPHFDQLVPRVTXH
‡ %HQH¿FLDULRV 'HFUHWR VH HVWLPDQ JORKDELOLWDODQXHYDOH\GHFRPSUDV
EDOPHQWHGDGRTXHWRGDYtDQRKD\OLVWDGRV
nominados.
$SDUWLUGHOGHHQHURGHVHSURGXFH
ODFDGXFLGDGGHOPHFDQLVPRGH)RQGRGH(PHU(OREMHWLYRSODQWHDGRSDUDHVWDWDUHDGHIRUJHQFLD TXH IXHUD XWLOL]DGR SRU ORV KRVSLWDOHV
como el principal mecanismo de compra en los PXODFLyQIXHPHMRUDUHOGHVHPSHxRTXHVHRE~OWLPRVGRVDxRV2WUDSUREOHPiWLFDYLQFXODGDD VHUYy HQ OD HMHFXFLyQ GHO SUHVXSXHVWR \
la descentralización de las compras es el proceso FRUUHJLU DTXHOODV GHELOLGDGHV TXH VH RPLWLHURQ
GH FDWDORJDFLyQ$ SDUWLU GH OD QXHYD OH\ SDUD HQODIRUPXODFLyQ
(QSODQLOODVDQH[DVVHSUHVHQWDHOSUHVXSXHVSRGHU WUDPLWDU VX FRPSUD HO VLVWHPD UHTXLHUH
OD FDWDORJDFLyQ GH WRGRV ORV LQVXPRV ([LVWHQ to de la Jurisdicción detallado de acuerdo a cada
FDVRVGHKRVSLWDOHVTXHYLHQHQFDWDORJDQGRVLQ una de las formas de presentación señaladas:
‡Por objeto del gasto
SUREOHPDVSHURWDPELpQH[LVWHQXQLGDGHVDVLVWHQFLDOHVTXHQRWLHQHQLQFOXLGRHVWHSDVRHQVX ‡Por apertura programática
‡3RUIXHQWHGH¿QDQFLDPLHQWR
procedimiento de compras.
CAPÍTULO 8 - ANEXO 2
CLASIFICADOR POR OBJETO DEL GASTO
%ROHWtQ2¿FLDO1žGHOGHHQHURGH
5HVROXFLyQ1ž
0RGLItFDVHHOFODVL¿FDGRUSRUREMHWRGHOJDVWRDSUREDGRSRUOD5HVROXFLyQ1ƒ6+<)
BO1ƒ
%XHQRV$LUHVGHGLFLHPEUHGH
9LVWR ORV 'HFUHWRV 1ž \ *&%$ BO 1ƒ \ OD 5HVROXFLyQ 1ƒ 6+<) BO1ƒ \
CONSIDERANDO:
4XH UHVXOWD FRQYHQLHQWH HIHFWXDU DGHFXDFLRQHV HQ HO FODVL¿FDGRU SRU REMHWR GHO JDVWR
YLJHQWHHQHOiPELWRGHO*RELHUQRGHOD&LXGDG
$XWyQRPD GH %XHQRV $LUHV DSUREDGR SRU OD
mencionada Resolución;
4XH HO DUWtFXOR ƒ GHO 'HFUHWR 1ƒ *&%$ BO1ƒ FLWDGRHQHO9LVWRIDFXOWD
DO6HFUHWDULRGH+DFLHQGD\)LQDQ]DVDHIHFWXDU
ODVDGHFXDFLRQHVTXHUHVXOWHQHFHVDULRLQWURGXFLU
HQODVFODVL¿FDFLRQHVSUHVXSXHVWDULDVYLJHQWHV
3RUHOOR
(/ 6(&5(7$5,2 '( +$&,(1'$ < ),NANZAS
5(68(/9(
$UWtFXORƒ0RGLItFDVHHO&ODVL¿FDGRUSRU
2EMHWRGHO*DVWRDSUREDGRSRUOD5HVROXFLyQ1ƒ
6+<) BO1ƒ GHDFXHUGRFRQHOGHWDOOHREUDQWHHQODVSODQLOODVDQH[DVTXHIRUPDQ
parte del presente artículo.
$UWtFXORƒ/DDSHUWXUDGHSDUWLGDVVXESDUciales estará a cargo de la Dirección General de
OD2¿FLQDGH*HVWLyQ3~EOLFD\3UHVXSXHVWR
$UWtFXOR ƒ 5HJtVWUHVH SXEOtTXHVH HQ HO
%ROHWtQ2¿FLDOGHOD&LXGDGGH%XHQRV$LUHV\
SDUDVXFRQRFLPLHQWR\GHPiVHIHFWRVUHPtWDVH
a las distintas Secretarías del Departamento Eje-
FXWLYRDOD'LUHFFLyQ*HQHUDOGHOD2¿FLQDGH
Gestión Pública y Presupuesto y a la Dirección
*HQHUDO GH &RQWDGXUtD *HQHUDO &XPSOLGR DUFKtYHVHPesce
ANEXO
Clasificación por objeto del gasto
Catálogo de cuentas
*DVWRVHQSHUVRQDO
1.1 Personal permanente
1.1.1 Retribución del cargo
5HWULEXFLRQHVTXHQRKDFHQDOFDUJR
1.1.4 Sueldo anual complementario
1.1.5 Otros gastos en personal
1.1.6 Contribuciones patronales
&RPSOHPHQWRV
1.2 Personal temporario
5HWULEXFLyQGHOFDUJR
5HWULEXFLRQHVTXHQRKDFHQDOFDUJR
6XHOGRDQXDOFRPSOHPHQWDULR
2WURVJDVWRVHQSHUVRQDO
&RQWULEXFLRQHVSDWURQDOHV
&RPSOHPHQWRV
&RQWUDWRVHVSHFLDOHV
1.3 Servicios extraordinarios
5HWULEXFLRQHVH[WUDRUGLQDULDV
6XHOGRDQXDOFRPSOHPHQWDULR
&RQWULEXFLRQHVSDWURQDOHV
5HWULEXFLRQHVQRUHPXQHUDWLYDV
$VLJQDFLRQHVIDPLOLDUHV
1.4.1 Asignaciones familiares
1.5 Asistencia social al personal
$VLVWHQFLDVRFLDOVLQGLVFULPLQDU
198 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
%HQH¿FLRV\FRPSHQVDFLRQHV
5HWLURYROXQWDULR
%HQH¿FLRV\FRPSHQVDFLRQHVVLQGLVcriminar
*DELQHWHGHDXWRULGDGHVVXSHULRUHV
5HWULEXFLyQGHOFDUJR
5HWULEXFLRQHVTXHQRKDFHQDOFDUJR
6XHOGRDQXDOFRPSOHPHQWDULR
2WURVJDVWRVHQSHUVRQDO
&RQWULEXFLRQHVSDWURQDOHV
&RPSOHPHQWRV
1.9 Personal sin discriminar
3HUVRQDOVLQGLVFULPLQDU
2 Bienes de consumo
3URGXFWRVDOLPHQWLFLRVDJURSHFXDULRV
y forestales
$OLPHQWRVSDUDSHUVRQDV
$OLPHQWRVSDUDDQLPDOHV
3URGXFWRVSHFXDULRV
3URGXFWRVDJURIRUHVWDOHV
0DGHUDFRUFKR\VXVPDQXIDFWXUDV
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
2.2 Textiles y vestuario
+LODGRV\WHODV
3UHQGDVGHYHVWLU
&RQIHFFLRQHVWH[WLOHV
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
2.3 Productos de papel, cartón e impresos
3DSHO\FDUWyQGHHVFULWRULR
3DSHO\FDUWyQSDUDFRPSXWDFLyQ
3URGXFWRVGHDUWHVJUi¿FDV
3URGXFWRVGHSDSHO\FDUWyQ
/LEURVUHYLVWDV\SHULyGLFRV
7H[WRVGHHQVHxDQ]D
(VSHFLHVWLPEUDGDV\YDORUHV
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
2.4 Productos de cuero y caucho
&XHURV\SLHOHV
$UWtFXORVGHFXHUR
$UWtFXORVGHFDXFKR
&XELHUWDV\FiPDUDVGHDLUH
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
3URGXFWRV TXtPLFRV FRPEXVWLEOHV \
lubricantes
&RPSXHVWRVTXtPLFRV
3URGXFWRVIDUPDFpXWLFRV\PHGLFLQDOHV
$ERQRV\IHUWLOL]DQWHV
,QVHFWLFLGDVIXPLJDQWHV\RWURV
7LQWDVSLQWXUDV\FRORUDQWHV
&RPEXVWLEOHV\OXEULFDQWHV
(VSHFt¿FRVYHWHULQDULRV
3URGXFWRVGHPDWHULDOSOiVWLFR
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
2.6 Productos de minerales no metálicos
3URGXFWRVGHDUFLOOD\FHUiPLFD
3URGXFWRVGHYLGULR
3URGXFWRVGHOR]D\SRUFHODQD
3URGXFWRVGHFHPHQWRDVEHVWR\\HVR
&HPHQWRFDO\\HVR
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
2.7 Productos metálicos
3URGXFWRVIHUURVRV
3URGXFWRVQRIHUURVRV
0DWHULDOGHJXHUUD
(VWUXFWXUDVPHWiOLFDVDFDEDGDV
+HUUDPLHQWDVPHQRUHV
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
0LQHUDOHV
0LQHUDOHVPHWDOtIHURV
3HWUyOHRFUXGR\JDVQDWXUDO
&DUEyQPLQHUDO
3LHGUDDUFLOOD\DUHQD
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
2.9 Otros bienes de consumo
(OHPHQWRVGHOLPSLH]D
ÒWLOHVGHHVFULWRULRR¿FLQD\HQVHxDQ]D
ÒWLOHV\PDWHULDOHVHOpFWULFRV
8WHQVLOLRVGHFRFLQD\FRPHGRU
ÒWLOHVPHQRUHVPpGLFRVTXLU~UJLFRV\
de laboratorio
5HSXHVWRV\DFFHVRULRV
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
3 Servicios no personales
3.1 Servicios básicos
(QHUJtDHOpFWULFD
$JXD
*DV
7HOpIRQRVWHOH[\WHOHID[
&RUUHRV\WHOpJUDIRV
5HGHVGHFRPXQLFDFLyQLQIRUPiWLFD
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
3.2 Alquileres y derechos
$OTXLOHUGHHGL¿FLRV\ORFDOHV
$OTXLOHUGHPDTXLQDULDHTXLSR\PHdios de transporte
$OTXLOHUGHHTXLSRVGHFRPSXWDFLyQ
$OTXLOHUGHIRWRFRSLDGRUDV
$UUHQGDPLHQWRGHWLHUUDV\WHUUHQRV
'HUHFKRVGHELHQHVLQWDQJLEOHV
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
0DQWHQLPLHQWRUHSDUDFLyQ\OLPSLH]D
0DQWHQLPLHQWR\UHSDUDFLyQGHHGL¿cios y locales
0DQWHQLPLHQWR\UHSDUDFLyQGHYHKtFXORV
0DQWHQLPLHQWR\UHSDUDFLyQGHPDTXLQDULD\HTXLSR
8 - ANEXO 2 - Clasificador por objeto del gasto / 199
4 Bienes de uso
0DQWHQLPLHQWR\UHSDUDFLyQGHYtDVGH
4.1 Bienes preexistentes
comunicación
7LHUUDV\WHUUHQRV
/LPSLH]DDVHR\IXPLJDFLyQ
(GL¿FLRVHLQVWDODFLRQHV
0DQWHQLPLHQWRGHHVSDFLRVYHUGHV
2WURVELHQHVSUHH[LVWHQWHV
+LJLHQHXUEDQD
4.2 Construcciones
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
&RQVWUXFFLRQHV HQ ELHQHV GH GRPLQLR
6HUYLFLRVSURIHVLRQDOHVWpFQLFRV\RSHSULYDGR
rativos
&RQVWUXFFLRQHV HQ ELHQHV GH GRPLQLR
(VWXGLRVLQYHVWLJDFLRQHV\SUR\HFWRV
público
de factibilidad
5HOOHQRVDQLWDULR
0pGLFRV\VDQLWDULRV
0DTXLQDULD\HTXLSR
-XUtGLFRV
0DTXLQDULD\HTXLSRGHSURGXFFLyQ
&RQWDELOLGDG\DXGLWRUtD
(TXLSRGHWUDQVSRUWHWUDFFLyQ\HOHYDFLyQ
'HFDSDFLWDFLyQ
(TXLSRVDQLWDULR\GHODERUDWRULR
'HLQIRUPiWLFD\VLVWHPDVFRPSXWDUL(TXLSRGHFRPXQLFDFLyQ\VHxDODPLHQWR
zados
(TXLSRHGXFDFLRQDOFXOWXUDO\UHFUHDWLYR
$UWtVWLFRV\FXOWXUDOHV
(TXLSRSDUDFRPSXWDFLyQ
2WURV QR HVSHFL¿FDGRV SUHFHGHQWH(TXLSRGHR¿FLQD\PREODMH
mente
+HUUDPLHQWDV\UHSXHVWRVPD\RUHV
3.5 Servicios empresariales comerciales y
(TXLSRVYDULRV
¿QDQFLHURV
(TXLSRGHVHJXULGDG
7UDQVSRUWH
(TXLSRGHVHJXULGDG
$OPDFHQDPLHQWR
4.5 Libros, revistas y otros elementos co ,PSUHQWD SXEOLFDFLRQHV \ UHSURGXFleccionables
ciones
/LEURVUHYLVWDV\RWURVHOHPHQWRVGHFR3ULPDV\JDVWRVGHVHJXURV
lección
&RPLVLRQHV\JDVWRVEDQFDULRV
4.6 Obras de arte
6LVWHPDVLQIRUPiWLFRV\GHUHJLVWUR
4.6.1 Obras de arte
&RUUHRV\WHOHFRPXQLFDFLRQHV
4.7 Semovientes
6HUYLFLRGHYLJLODQFLD
6HPRYLHQWHV
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
$FWLYRVLQWDQJLEOHV
3XEOLFLGDG\SURSDJDQGD
3URJUDPDVGHFRPSXWDFLyQ
3XEOLFLGDG\SURSDJDQGD
2WURVDFWLYRVLQWDQJLEOHV
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
4.9 Otros bienes de uso
3.7 Pasajes, viáticos y movilidad
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
3DVDMHV
5 Transferencias
9LiWLFRV
5.1 Transferencias al sector privado para
0RYLOLGDG
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH ¿QDQFLDUJDVWRVFRUULHQWHV
-XELODFLRQHV\RUHWLURV
3.8 Impuestos, derechos y tasas
3HQVLRQHV
,PSXHVWRVLQGLUHFWRV
%HFDV\RWURVVXEVLGLRV
,PSXHVWRVGLUHFWRV
5.1.4 Ayudas sociales a personas
'HUHFKRV\WDVDV
7UDQVIHUHQFLDV D LQVWLWXFLRQHV GH HQVH 0XOWDV \ UHFDUJRV \ VHQWHQFLDV MXGLñanza
ciales
7UDQVIHUHQFLDVSDUDDFWLYLGDGHVFLHQWt¿5HJDOtDV
cas o académicas
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
7UDQVIHUHQFLDV D RWUDV LQVWLWXFLRQHV VLQ
3.9 Otros servicios
¿QHVGHOXFUR
6HUYLFLRVGHFHUHPRQLDO
7UDQVIHUHQFLDVDFRRSHUDWLYDV
6HUYLFLRVGHFRPLGDVYLDQGDV\UHIUL7UDQVIHUHQFLDVDHPSUHVDVSULYDGDV
gerios
5.2 Transferencias al sector privado para
3UHPLRV\UHFRQRFLPLHQWRV
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH ¿QDQFLDUJDVWRVGHFDSLWDO
200 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
7UDQVIHUHQFLDVDSHUVRQDV
7UDQVIHUHQFLDVDLQVWLWXFLRQHVGHHQVHñanza
7UDQVIHUHQFLDVSDUDDFWLYLGDGHVFLHQWt¿FDVRDFDGpPLFDV
7UDQVIHUHQFLDVDRWUDVLQVWLWXFLRQHVVLQ
¿QHVGHOXFUR
7UDQVIHUHQFLDVDFRRSHUDWLYDV
7UDQVIHUHQFLDVDHPSUHVDVSULYDGDV
5.3 Transferencias al Sector Público NaFLRQDOSDUD¿QDQFLDUJDVWRVFRUULHQWHV
$ODDGPLQLVWUDFLyQFHQWUDOQDFLRQDO
$LQVWLWXFLRQHVGHVFHQWUDOL]DGDVQDFLRnales
$LQVWLWXFLRQHVGHVHJXULGDGVRFLDOQDcionales
$ RWUDV LQVWLWXFLRQHV S~EOLFDV QDFLRnales
5.4 Transferencias al Sector Público NaFLRQDOSDUD¿QDQFLDUJDVWRVGHFDSLWDO
5.4.1 A la administración central nacional
$LQVWLWXFLRQHVGHVFHQWUDOL]DGDVQDFLRnales
$LQVWLWXFLRQHVGHVHJXULGDGVRFLDOQDcionales
5.4.4 A otras instituciones públicas nacionales
5.5 Transferencias al Sector Público empresarial
7UDQVIHUHQFLDVDLQVWLWXFLRQHVS~EOLFDV
¿QDQFLHUDV SDUD ¿QDQFLDU JDVWRV FRrrientes
7UDQVIHUHQFLDVDHPSUHVDVS~EOLFDVQR
¿QDQFLHUDV SDUD ¿QDQFLDU JDVWRV FRrrientes
7UDQVIHUHQFLDV D HPSUHVDV S~EOLFDV
PXOWLQDFLRQDOHVSDUD¿QDQFLDUJDVWRV
corrientes
7UDQVIHUHQFLDVDLQVWLWXFLRQHVS~EOLFDV
¿QDQFLHUDV SDUD ¿QDQFLDU JDVWRV GH
capital
7UDQVIHUHQFLDVDHPSUHVDVS~EOLFDVQR
¿QDQFLHUDV SDUD ¿QDQFLDU JDVWRV GH
capital
7UDQVIHUHQFLDV D HPSUHVDV S~EOLFDV
PXOWLQDFLRQDOHVSDUD¿QDQFLDUJDVWRV
de capital
5.6 Transferencias a universidades nacionales
7UDQVIHUHQFLDVDXQLYHUVLGDGHVQDFLRQDOHVSDUD¿QDQFLDUJDVWRVFRUULHQWHV
7UDQVIHUHQFLDVDXQLYHUVLGDGHVQDFLRQDOHVSDUD¿QDQFLDUJDVWRVGHFDSLWDO
5.7 Transferencias a instituciones provinFLDOHV\PXQLFLSDOHVSDUD¿QDQFLDUJDVWRVFRrrientes
7UDQVIHUHQFLDVDJRELHUQRVSURYLQFLDOHV
7UDQVIHUHQFLDVDLQVWLWXFLRQHVS~EOLFDV
¿QDQFLHUDVSURYLQFLDOHV
7UDQVIHUHQFLDVDHPSUHVDVS~EOLFDVQR
¿QDQFLHUDVSURYLQFLDOHV
7UDQVIHUHQFLDVDHQWHVWULSDUWLWRV
7UDQVIHUHQFLDVDRWUDVLQVWLWXFLRQHVS~EOLFDVSURYLQFLDOHV
7UDQVIHUHQFLDVDJRELHUQRVPXQLFLSDOHV
7UDQVIHUHQFLDVDLQVWLWXFLRQHVS~EOLFDV
¿QDQFLHUDVPXQLFLSDOHV
7UDQVIHUHQFLDVDHPSUHVDVS~EOLFDVQR
¿QDQFLHUDVPXQLFLSDOHV
7UDQVIHUHQFLDV D RWUDV LQVWLWXFLRQHV
públicas municipales
5.8 Transferencias a instituciones provinciales
\PXQLFLSDOHVSDUD¿QDQFLDUJDVWRVGHFDSLWDO
7UDQVIHUHQFLDVDJRELHUQRVSURYLQFLDOHV
7UDQVIHUHQFLDVDLQVWLWXFLRQHVS~EOLFDV
¿QDQFLHUDVSURYLQFLDOHV
7UDQVIHUHQFLDVDHPSUHVDVS~EOLFDVQR
¿QDQFLHUDVSURYLQFLDOHV
7UDQVIHUHQFLDVDHQWHVWULSDUWLWRV
7UDQVIHUHQFLDV D RWUDV LQVWLWXFLRQHV
S~EOLFDVSURYLQFLDOHV
7UDQVIHUHQFLDVDJRELHUQRVPXQLFLSDOHV
7UDQVIHUHQFLDVDLQVWLWXFLRQHVS~EOLFDV
¿QDQFLHUDVPXQLFLSDOHV
7UDQVIHUHQFLDVDHPSUHVDVS~EOLFDVQR
¿QDQFLHUDVPXQLFLSDOHV
7UDQVIHUHQFLDV D RWUDV LQVWLWXFLRQHV
públicas municipales
5.9 Transferencias al exterior
7UDQVIHUHQFLDV D JRELHUQRV H[WUDQMHURV
SDUD¿QDQFLDUJDVWRVFRUULHQWHV
7UDQVIHUHQFLDVDRUJDQLVPRVLQWHUQDFLRQDOHVSDUD¿QDQFLDUJDVWRVFRUULHQWHV
7UDQVIHUHQFLDV D JRELHUQRV H[WUDQMHURV
SDUD¿QDQFLDUJDVWRVGHFDSLWDO
7UDQVIHUHQFLDVDRUJDQLVPRVLQWHUQDFLRQDOHVSDUD¿QDQFLDUJDVWRVGHFDSLWDO
$FWLYRV¿QDQFLHURV
6.1 Compra de acciones y participaciones
de capital
$SRUWHVGHFDSLWDODHPSUHVDVSULYDGDV
nacionales
$SRUWHVGHFDSLWDODHPSUHVDVS~EOLFDV
QR¿QDQFLHUDV
$SRUWHVGHFDSLWDODLQVWLWXFLRQHVS~EOLFDV¿QDQFLHUDV
8 - ANEXO 2 - Clasificador por objeto del gasto / 201
,QFUHPHQWRGHRWUDVFXHQWDVDFREUDUD
6.1.4 Aportes de capital a organismos internacorto plazo
cionales
,QFUHPHQWRGHFXHQWDVDFREUDUFRPHU6.1.6 Aportes de capital a otras organizaciones
ciales a largo plazo
GHOVHFWRUH[WHUQR
,QFUHPHQWRGHRWUDVFXHQWDVDFREUDUD
3UpVWDPRVDFRUWRSOD]R
largo plazo
3UpVWDPRVDFRUWRSOD]RDOVHFWRUSUL6.8 Incremento de documentos a cobrar
YDGR
,QFUHPHQWRGHGRFXPHQWRVFRPHUFLDOHV
3UpVWDPRVDFRUWRSOD]RDOVHFWRUS~a cobrar a corto plazo
blico nacional
,QFUHPHQWR GH RWURV GRFXPHQWRV D FR3UpVWDPRVDFRUWRSOD]RDSURYLQFLDV
brar a corto plazo
3UpVWDPRV D FRUWR SOD]R D PXQLFLSD,QFUHPHQWRGHGRFXPHQWRVFRPHUFLDOHV
lidades
a cobrar a largo plazo
3UpVWDPRVDFRUWRSOD]RDLQVWLWXFLRQHV
,QFUHPHQWR GH RWURV GRFXPHQWRV D FRS~EOLFDV¿QDQFLHUDV
brar a largo plazo
3UpVWDPRV D FRUWR SOD]R D HPSUHVDV
6.9 Incremento de activos diferidos y adeS~EOLFDVQR¿QDQFLHUDV
3UpVWDPRVDFRUWRSOD]RDOVHFWRUH[- lantos a proveedores y contratistas
,QFUHPHQWRGHDFWLYRVGLIHULGRVDFRUWR
terno
plazo
3UpVWDPRVDODUJRSOD]R
$GHODQWRVDSURYHHGRUHV\FRQWUDWLVWDVD
3UpVWDPRVDODUJRSOD]RDOVHFWRUSULcorto plazo
YDGR
,QFUHPHQWRVGHDFWLYRVGLIHULGRVDODUJR
3UpVWDPRVDODUJRSOD]RDOVHFWRUS~plazo
blico nacional
$GHODQWRVDSURYHHGRUHV\FRQWUDWLVWDVD
3UpVWDPRVDODUJRSOD]RDSURYLQFLDV
largo plazo
3UpVWDPRV D ODUJR SOD]R D PXQLFLSD7 Servicio de la deuda y disminución de
lidades
3UpVWDPRVDODUJRSOD]RDLQVWLWXFLRQHV otros pasivos
7.1 Servicio de la deuda interna
S~EOLFDV¿QDQFLHUDV
,QWHUHVHV GH OD GHXGD LQWHUQD D FRUWR
3UpVWDPRV D ODUJR SOD]R D HPSUHVDV
plazo
S~EOLFDVQR¿QDQFLHUDV
$PRUWL]DFLyQ GH OD GHXGD LQWHUQD D
3UpVWDPRVDODUJRSOD]RDOVHFWRUH[terno
corto plazo
&RPLVLRQHV\RWURVJDVWRVGHODGHXGD
7tWXORV\YDORUHV
7tWXORV\YDORUHVDFRUWRSOD]R
interna a corto plazo
7tWXORV\YDORUHVDODUJRSOD]R
,QWHUHVHV GH OD GHXGD LQWHUQD D ODUJR
6.5 Incremento de disponibilidades saldo
plazo
¿QDO
$PRUWL]DFLyQGHODGHXGDLQWHUQDDODU6.5.1 Incremento de caja y banco libre disgo plazo
ponibilidad
&RPLVLRQHV\RWURVJDVWRVGHODGHXGD
,QFUHPHQWR GH FDMD \ EDQFR UHFXUVRV
interna a largo plazo
afectados
7.2 Servicio de la deuda externa
,QFUHPHQWR GH FDMD \ EDQFR IRQGRV
,QWHUHVHV GH OD GHXGD H[WHUQD D FRUWR
constituidos
plazo
,QFUHPHQWRGHLQYHUVLRQHV¿QDQFLHUDV
$PRUWL]DFLyQ GH OD GHXGD H[WHUQD D
temporarias
corto plazo
2WUDVLQYHUVLRQHV¿QDQFLHUDV
&RPLVLRQHV\RWURVJDVWRVGHODGHXGD
6.6.1 Otros incrementos de disponibiliH[WHUQDDFRUWRSOD]R
dades
,QWHUHVHV GH OD GHXGD H[WHUQD D ODUJR
2WURV LQFUHPHQWRV GH LQYHUVLRQHV ¿plazo
nancieras
$PRUWL]DFLyQ GH OD GHXGD H[WHUQD D
6.7 Incremento de cuentas a cobrar
largo plazo
,QFUHPHQWRGHFXHQWDVDFREUDUFRPHU&RPLVLRQHV\RWURVJDVWRVGHODGHXGD
ciales a corto plazo
H[WHUQDDODUJRSOD]R
202 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
,QWHUHVHVSRUSUpVWDPRVUHFLELGRV
'LVPLQXFLyQ GH RWURV GRFXPHQWRV D
,QWHUHVHVSRUSUpVWDPRVGHOVHFWRUSULpagar a largo plazo
YDGR
7.7 Disminución de depósitos en institu,QWHUHVHVSRUSUpVWDPRVGHOVHFWRUS~- FLRQHVS~EOLFDV¿QDQFLHUDV
blico nacional
'LVPLQXFLyQGHGHSyVLWRVDODYLVWD
,QWHUHVHVGHSUpVWDPRVGHSURYLQFLDV
'LVPLQXFLyQGHGHSyVLWRVHQDKRUUR\
,QWHUHVHV GH SUpVWDPRV GH PXQLFLSDDSOD]R¿MR
lidades
7.8 Disminución de otros pasivos
,QWHUHVHV GH SUpVWDPRV GH HPSUHVDV
'LVPLQXFLyQ GH SDVLYRV GLIHULGRV D
S~EOLFDVQR¿QDQFLHUDV
corto plazo
,QWHUHVHV GH SUpVWDPRV GH LQVWLWXFLR'LVPLQXFLyQGHSUHYLVLRQHVSDUDFXHQQHVS~EOLFDV¿QDQFLHUDV
tas incobrables
,QWHUHVHV GH SUpVWDPRV GHO VHFWRU H[ 'LVPLQXFLyQ GH SUHYLVLRQHV SDUD DXterno
toseguro
'LVPLQXFLyQGHSUpVWDPRVDFRUWRSOD]R
'LVPLQXFLyQGHSURYLVLRQHV
3UpVWDPRVUHFLELGRVGHOVHFWRUSULYDGR
'LVPLQXFLyQGHUHVHUYDVWpFQLFDV
3UpVWDPRVUHFLELGRVGHOVHFWRUS~EOLFR
'LVPLQXFLyQ GH SDVLYRV GLIHULGRV D
nacional
largo plazo
3UpVWDPRVUHFLELGRVGHSURYLQFLDV
&RQYHUVLyQGHODGHXGD\RWURVJDVWRV
3UpVWDPRV UHFLELGRV GH PXQLFLSDOL- por deuda pública
dades
&RQYHUVLyQGHODGHXGDLQWHUQDDODUJR
3UpVWDPRV UHFLELGRV GH HPSUHVDV S~plazo en deuda interna a corto plazo
EOLFDVQR¿QDQFLHUDV
&RQYHUVLyQGHODGHXGDH[WHUQDDODUJR
3UpVWDPRV UHFLELGRV GH LQVWLWXFLRQHV
SOD]RHQGHXGDH[WHUQDDFRUWRSOD]R
S~EOLFDV¿QDQFLHUDV
&RQYHUVLyQ GH SUpVWDPRV LQWHUQRV D
3UpVWDPRVUHFLELGRVGHOVHFWRUH[WHUQR
largo plazo en préstamos internos a
'LVPLQXFLyQGHSUpVWDPRVDODUJRSOD]R
corto plazo
3UpVWDPRVUHFLELGRVGHOVHFWRUSULYDGR
&RQYHUVLyQ GH SUpVWDPRV H[WHUQRV D
3UpVWDPRVUHFLELGRVGHOVHFWRUS~EOLFR
ODUJR SOD]R HQ SUpVWDPRV H[WHUQRV D
nacional
corto plazo
3UpVWDPRVUHFLELGRVGHSURYLQFLDV
2WURVJDVWRVSRUGHXGDS~EOLFD
3UpVWDPRVUHFLELGRVGHPXQLFLSDOLGDGHV
2WURVJDVWRV
3UpVWDPRV UHFLELGRV GH HPSUHVDV S~,QWHUHVHVGHLQVWLWXFLRQHVS~EOLFDV¿QDQEOLFDVQR¿QDQFLHUDV
cieras
3UpVWDPRV UHFLELGRV GH LQVWLWXFLRQHV
,QWHUHVHV GH LQVWLWXFLRQHV S~EOLFDV ¿S~EOLFDV¿QDQFLHUDV
nancieras
3UpVWDPRVUHFLELGRVGHOVHFWRUH[WHUQR
'HSUHFLDFLyQ\DPRUWL]DFLyQ
7.6 Disminución de cuentas y documentos a
'HSUHFLDFLyQGHODFWLYR¿MR
SDJDU
$PRUWL]DFLyQGHODFWLYRLQWDQJLEOH
'LVPLQXFLyQ GH FXHQWDV D SDJDU FR'HVFXHQWRV\ERQL¿FDFLRQHV
merciales a corto plazo
'HVFXHQWRVSRUYHQWDV
'LVPLQXFLyQGHRWUDVFXHQWDVDSDJDU
%RQL¿FDFLRQHVSRUYHQWDV
a corto plazo
2WUDVSpUGLGDV
'LVPLQXFLyQ GH GRFXPHQWRV D SDJDU
&XHQWDVLQFREUDEOHV
comerciales a corto plazo
3pUGLGDGHLQYHQWDULRV
'LVPLQXFLyQ GH RWURV GRFXPHQWRV D
$XWRVHJXUR
pagar a corto plazo
3pUGLGDVHQRSHUDFLRQHVFDPELDULDV
'LVPLQXFLyQ GH FXHQWDV D SDJDU FR3pUGLGDVHQYHQWDGHDFWLYRV
merciales a largo plazo
2WUDVSpUGLGDVGHRSHUDFLyQ
'LVPLQXFLyQGHRWUDVFXHQWDVDSDJDU
2WUDVSpUGLGDVDMHQDVDODRSHUDFLyQ
a largo plazo
5HVHUYDVWpFQLFDV
'LVPLQXFLyQ GH GRFXPHQWRV D SDJDU
3ULPDVGHHPLVLyQGHYDORUHVS~EOLFRV
comerciales a largo plazo
8.5 Disminución del patrimonio
8 - ANEXO 2 - Clasificador por objeto del gasto / 203
'LVPLQXFLyQGHOFDSLWDO
las dotaciones permanentes de las distintas entidades de la administración del Gobierno de la
'LVPLQXFLyQGHODVUHVHUYDV
'LVPLQXFLyQGHORVUHVXOWDGRVDFXPX- Ciudad.
1.1.1 Retribución del cargo
lados
&UpGLWRDGLFLRQDO
$VLJQDFLyQGHODFDWHJRUtD\DGLFLRQDOHVTXH
&UpGLWRDGLFLRQDOSDUDHURJDFLRQHVFRcon carácter general corresponden al cargo
rrientes
X KRUDV FiWHGUD FRQ SUHVFLQGHQFLD GH ODV
&UpGLWRDGLFLRQDOSDUDHURJDFLRQHVGH
FDUDFWHUtVWLFDVLQGLYLGXDOHVGHODJHQWHRFLUcunstanciales del cargo o función.
capital
(VWDSDUWLGDSDUFLDOVHDEULUiHQODUHVSHFWL*DVWRV¿JXUDWLYRV
YDGLVWULEXFLyQGHFDUJRVSRUDJUXSDPLHQWR
*DVWRV ¿JXUDWLYRV GH OD DGPLQLVWUDHVFDODIRQDULRRFRQYHQFLRQDOFRQLQGLFDFLyQ
FLyQ JXEHUQDPHQWDO SDUD WUDQVDFFLRQHV FRrrientes
de los cargos y su remuneración.
&RQWULEXFLyQDODDGPLQLVWUDFLyQFHQWUDO
5HWULEXFLRQHVTXHQRKDFHQDOFDUJR
&RQWULEXFLyQ D LQVWLWXFLRQHV GHVFHQ &RUUHVSRQGHDDTXHOODVTXHGHDFXHUGRFRQ
tralizadas
ODV OH\HV YLJHQWHV \ ODV TXH VH LPSOHPHQWHQVHDVLJQDQDODJHQWHRDODIXQFLyQTXH
&RQWULEXFLyQDLQVWLWXFLRQHVGHVHJXridad social
GHVHPSHxD FRPR SRU HMHPSOR DQWLJHGDG
WtWXOR XELFDFLyQ JHRJUi¿FD ULHVJR SHUPD&RQWULEXFLyQDHQWHVDXWiUTXLFRV
QHQFLDHQODFDWHJRUtDHWF
*DVWRV¿JXUDWLYRVGHODDGPLQLVWUDFLyQ
1.1.4 Sueldo anual complementario
JXEHUQDPHQWDOSDUDWUDQVDFFLRQHVGHFDSLWDO
Corresponde a los suplementos salariales
&RQWULEXFLyQDODDGPLQLVWUDFLyQFHQWUDO
DQXDOHV OLTXLGDGRV GH FRQIRUPLGDG FRQ OD
&RQWULEXFLyQ D LQVWLWXFLRQHV GHVFHQWUDlizadas
OHJLVODFLyQYLJHQWH
&RQWULEXFLyQ D LQVWLWXFLRQHV GH VHJXUL1.1.5 Otros gastos en personal
dad social
5HWULEXFLRQHV D DJHQWHV TXH LQWHJUDQ ODV
&RQWULEXFLyQDHQWHVDXWiUTXLFRV
SODQWDVSHUPDQHQWHVTXHSRUODtQGROHGHORV
*DVWRV¿JXUDWLYRVGHODDGPLQLVWUDFLyQ
VHUYLFLRVTXHSUHVWDQQRSXHGDQGLVFULPLQDUVHRVHDFRQYHQLHQWHPDQWHQHUHQUHVHUYD
JXEHUQDPHQWDOSDUDDSOLFDFLRQHV¿QDQFLHUDV
1.1.6 Contribuciones patronales
&RQWULEXFLyQDODDGPLQLVWUDFLyQFHQWUDO
Contribuciones del Estado en su carácter de
&RQWULEXFLyQ D LQVWLWXFLRQHV GHVFHQWUDlizadas
HPSOHDGRUTXHGHDFXHUGRFRQQRUPDVOHJD &RQWULEXFLyQ D LQVWLWXFLRQHV GH VHJXULles se deban imputar a esta partida.
dad social
&RPSOHPHQWRV
&RQWULEXFLyQDHQWHVDXWiUTXLFRV
Corresponde a las sumas abonadas al perVRQDO SHUPDQHQWH HQ FRQFHSWR GH VHUYLFLRV
SHUVRQDOHV HQ UHODFLyQ GH GHSHQGHQFLD TXH
Descripción de cuentas
UHYLVWHQHOFDUiFWHUGHQRUHPXQHUDWLYDV\QR
ERQL¿FDEOHV
*DVWRVHQSHUVRQDO
1.2 Personal temporario
5HWULEXFLyQGHORVVHUYLFLRVSHUVRQDOHVSUHVWDRetribuciones y contribuciones patronales
GRVHQUHODFLyQGHGHSHQGHQFLD\DORVPLHPEURVGHGLUHFWRULRV\FRPLVLRQHV¿VFDOL]DGRUDV del personal de las plantas no permanentes del
GH HPSUHVDV S~EOLFDV \ ODV FRUUHVSRQGLHQWHV SHUVRQDOWUDQVLWRULR\FRQWUDWDGRFXDOTXLHUDTXH
contribuciones patronales. Abarca también fuese la modalidad de pago.
5HWULEXFLyQGHOFDUJR
las retribuciones en concepto de asignaciones
$VLJQDFLyQGHODFDWHJRUtD\DGLFLRQDOHVTXH
IDPLOLDUHV VHUYLFLRV H[WUDRUGLQDULRV \ SUHVWDciones sociales recibidas por los agentes del
FRQFDUiFWHUJHQHUDOFRUUHVSRQGHQDOFDUJR
Gobierno de la Ciudad Autónoma de Buenos
con prescindencia de las características inGLYLGXDOHV GHO DJHQWH R FLUFXQVWDQFLDOHV GHO
Aires.
cargo o función.
1.1 Personal permanente
(VWDSDUWLGDSDUFLDOVHDEULUiHQODGLVWULEXRetribuciones y contribuciones patronales
FLyQGHFDUJRVSRUODPRGDOLGDGGHOSHUVRGHO SHUVRQDO TXH VH GHVHPSHxD HQ FDUJRV R HV
QDOWHPSRUDULR FRQWUDWDGRMRUQDOL]DGRHWF titular de horas de cátedra correspondientes a
204 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
\FRQLQGLFDFLyQGHODUHPXQHUDFLyQLQGLYLdual correspondiente.
Incluye las horas de cátedra correspondientes
al personal temporario y el pago por similar
concepto al personal de planta permanente
TXHGHVDUUROOHDGLFLRQDOPHQWHWDUHDVGRFHQtes de capacitación.
5HWULEXFLRQHVTXHQRKDFHQDOFDUJR
&RUUHVSRQGHDDTXHOODVTXHGHDFXHUGRFRQ
ODOHJLVODFLyQYLJHQWH\ODTXHVHLPSOHPHQWH VH DVLJQDQ DO DJHQWH R D OD IXQFLyQ TXH
GHVHPSHxD FRPR SRU HMHPSOR DQWLJHGDG
WtWXOR XELFDFLyQ JHRJUi¿FD ULHVJR SHUPDQHQFLDHQODFDWHJRUtDHWF
6XHOGRDQXDOFRPSOHPHQWDULR
Corresponde a los suplementos salariales
DQXDOHVOLTXLGDGRVGHFRQIRUPLGDGFRQQRUPDVYLJHQWHV
2WURVJDVWRVHQSHUVRQDO
5HWULEXFLRQHV D DJHQWHV TXH LQWHJUDQ ODV
SODQWDVQRSHUPDQHQWHVTXHSRUODtQGROHGH
ORVVHUYLFLRVTXHSUHVWDQQRSXHGDQGLVFULPLQDUVH R VHD FRQYHQLHQWH PDQWHQHU HQ UHVHUYD
&RQWULEXFLRQHVSDWURQDOHV
Contribuciones del Estado en su carácter de
HPSOHDGRUTXHGHDFXHUGRFRQQRUPDVOHJDOHVVHGHEDQLPSXWDUDHVWDSDUWLGD
&RPSOHPHQWRV
Corresponde a las sumas abonadas al perVRQDO WUDQVLWRULR HQ FRQFHSWR GH VHUYLFLRV
SHUVRQDOHV HQ UHODFLyQ GH GHSHQGHQFLD TXH
UHYLVWHQHOFDUiFWHUGHQRUHPXQHUDWLYDV\QR
ERQL¿FDEOHV
&RQWUDWRVHVSHFLDOHV
Corresponde a los gastos por contratacioQHV GH SHUVRQDO TXH WHQJDQ SRU REMHWR OD
SUHVWDFLyQ GH VHUYLFLRV WpFQLFRV R SURIHVLRQDOHV HVSHFLDOL]DGRV D WtWXOR SHUVRQDO
\ GH FDUiFWHU LQGLYLGXDO WDQWR GH IRUWDOHcimiento institucional como de proyectos
HVSHFLDOHVGHHVWXGLRVHLQYHVWLJDFLyQTXH
FRPSOHPHQWHQ ODV DFWLYLGDGHV SURSLDV GH
cada jurisdicción. Incluye las contratacioQHVGHVHUYLFLRVSHUVRQDOHVYLQFXODGDVFRQ
la ejecución de proyectos financiados con
préstamos de organismos internacionales
de crédito.
1.3 Servicios extraordinarios
$VLJQDFLRQHVTXHUHWULEX\HQODSUHVWDFLyQGH
VHUYLFLRVDOPDUJHQGHORVKRUDULRVQRUPDOHVGH
labor y los importes adicionales correspondientes a este tipo de prestaciones.
Comprende también las sumas abonadas al
SHUVRQDO SHUPDQHQWH \ WUDQVLWRULR TXH UHYLVWHQ
HO FDUiFWHU GH QR UHPXQHUDWLYDV \ QR ERQL¿FDbles.
1.4 Asignaciones familiares
Asignaciones establecidas en función de las
FDUJDVGHIDPLOLDLQFOXLGRVVXEVLGLRVSRUFDVDPLHQWRQDFLPLHQWRHVFRODULGDGHWF
1.5 Asistencia social al personal
*DVWRV GHVWLQDGRV D EULQGDU HVSDUFLPLHQWR
atender indemnizaciones por accidentes de traEDMRXRWUDVFDXVDOHVOHJDOHVUHLQWHJURGHJDVWRV
de sepelios y subsidios por fallecimiento. Inclu\HDVLPLVPRODVFRQWULEXFLRQHVFRPSOHPHQWDULDVMXELODWRULDVODVDVLJQDFLRQHVSRUUHIULJHULR
\ HQ JHQHUDO DTXHOODV TXH WLHQGHQ D DVHJXUDU
prestaciones de asistencia social al personal.
%HQH¿FLRV\FRPSHQVDFLRQHV
*DVWRV SRU XQD VROD YH] RULJLQDGRV HQ OD
DWHQFLyQGHLQGHPQL]DFLRQHVSRUUHWLURYROXQWDULRRGHVSLGR\RWURVEHQH¿FLRV\FRPSHQVDFLRQHVTXHUHYLVWDQHOFDUiFWHUGHH[WUDRUGLQDULRV\
no tengan la característica de la habitualidad.
1.7 Gabinete de autoridades superiores
Gastos originados por la atención de los niYHOHVUHWULEXWLYRVDVLJQDGRVDO3HUVRQDOGH3ODQWDGH*DELQHWHFRUUHVSRQGLHQWHDODV6HFUHWDUtDV
Subsecretarías y Direcciones Generales del PoGHU (MHFXWLYR ,QFOX\H ORV SDJRV UHDOL]DGRV HQ
FRQFHSWR GH FRQWULEXFLRQHV SDWURQDOHV VXHOGR
DQXDOFRPSOHPHQWDULRDVLJQDFLRQHVIDPLOLDUHV
DVtFRPRWRGRRWURFRPSOHPHQWRDVLVWHQFLDVRFLDOEHQH¿FLRRFRPSHQVDFLyQTXHVHRWRUJXH
1.9 Personal sin discriminar
Asignación global de recursos para el refuerzo de los créditos destinados a atender gastos en
SHUVRQDOHQHOPDUFRGHODVDXWRUL]DFLRQHVFRQWHQLGDVHQHODUWtFXORGHOD/H\1ƒ
2. Bienes de consumo
Materiales y suministros consumibles para el
IXQFLRQDPLHQWRGHORVHQWHVHVWDWDOHVLQFOXLGRV
ORVTXHVHGHVWLQDQDFRQVHUYDFLyQ\UHSDUDFLyQ
GH ELHQHV GH FDSLWDO ,QFOX\H OD DGTXLVLFLyQ GH
ELHQHV SDUD VX WUDQVIRUPDFLyQ \R HQDMHQDFLyQ
XOWHULRU SRU DTXHOODV HQWLGDGHV TXH GHVDUUROODQ
DFWLYLGDGHVGHFDUiFWHUFRPHUFLDOLQGXVWULDO\R
VHUYLFLRVRSRUGHSHQGHQFLDVXRUJDQLVPRVTXH
YHQGDQRGLVWULEX\DQHOHPHQWRVDGTXLULGRVFRQ
¿QHV SURPRFLRQDOHV OXHJR GH VX H[KLELFLyQ HQ
H[SRVLFLRQHVIHULDVHWF
/DV SULQFLSDOHV FDUDFWHUtVWLFDV TXH GHEHQ
reunir los bienes comprendidos en este inciso
8 - ANEXO 2 - Clasificador por objeto del gasto / 205
VRQTXHSRUQDWXUDOH]DHVWpQGHVWLQDGRVDOFRQVXPR¿QDOLQWHUPHGLRSURSLRRGHWHUFHURV\
TXH VX WLHPSR GH XWLOL]DFLyQ VHD UHODWLYDPHQWH
FRUWRSRUORJHQHUDOGHQWURGHOHMHUFLFLR
2.1 Productos alimenticios agropecuarios y
forestales
%HELGDV \ SURGXFWRV DOLPHQWLFLRV PDQXIDFWXUDGRV R QR LQFOXLGRV ORV DQLPDOHV YLYRV
SDUDFRQVXPR\SDUDH[SHULPHQWDFLyQDFHLWHV\
JUDVDVDQLPDOHV\YHJHWDOHVIRUUDMHV\RWURVDOLPHQWRVSDUDDQLPDOHVSURGXFWRVDJUtFRODVJDQDGHURV\GHVLOYLFXOWXUDFD]D\SHVFD,QFOX\H
HOSDJRGHJDVWRVGHFRPLGDDOPXHU]RVRFHQDV
de trabajo y el reintegro de erogaciones en conFHSWRGHVXPLQLVWURVOLTXLGDGRGHDFXHUGRFRQ
ODVQRUPDVYLJHQWHV
$OLPHQWRVSDUDSHUVRQDV
3URGXFWRV DOLPHQWLFLRV PDQXIDFWXUDGRV R
QRDFHLWHV\JUDVDVDQLPDOHV\YHJHWDOHVEHELGDVHQVXVGLYHUVDVIRUPDV\WDEDFR,QFOX\HHOSDJRGHJDVWRVGHFRPLGDVDOPXHU]RV
o cenas de trabajo y el reintegro de erogaciones en concepto de suministros.
$OLPHQWRVSDUDDQLPDOHV
)RUUDMHV\WRGDRWUDFODVHGHDOLPHQWRVSDUD
animales.
3URGXFWRVSHFXDULRV
&RPSUHQGHHOJDQDGR\RWURVDQLPDOHVYLYRV
GHVWLQDGRVDOFRQVXPRRSDUDXVRFLHQWt¿FR
3URGXFWRVDJURIRUHVWDOHV
Productos agroforestales tales como goma
ODFDUHVLQDV\EiOVDPRVFpVSHGiUEROHV\DUbustos.
0DGHUDFRUFKR\VXVPDQXIDFWXUDV
0DGHUD\FRUFKRPDQXIDFWXUDGRVRQR H[FHSWRPXHEOHV LQFOXLGRFDUEyQYHJHWDO
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
2WURVSURGXFWRVDOLPHQWLFLRVDJURSHFXDULRV
\IRUHVWDOHVQRHVSHFL¿FDGRVHQODVSDUWLGDV
anteriores.
2.2 Textiles y vestuario
)LEUDV \ WHMLGRV DQLPDOHV YHJHWDOHV VLQWpWLFRV R DUWL¿FLDOHV \ FRQIHFFLRQHV GH GLYHUVD
índole.
+LODGRV\WHODV
)LEUDV\WHMLGRVDQLPDOHVYHJHWDOHV\VLQWpWLFRV\DUWL¿FLDOHV
3UHQGDVGHYHVWLU
7UDMHVXQLIRUPHVFDO]DGRVHQVXVGLVWLQWRV
WLSRV FDUWHUDV SDQWDORQHV FDPLVDV FRUEDWDVPHGLDVJXDUGDSROYRVGHODQWDOHVJRUUDV
\WRGDRWUDSUHQGDGHYHVWLUQRHVSHFL¿FDGD
precedentemente.
&RQIHFFLRQHVWH[WLOHV
6iEDQDV IXQGDV IUD]DGDV PDQWDV WDSLFHV
DOIRPEUDVFRUWLQDVWRDOODVURSDGHFDPDHQ
JHQHUDO LQFOX\HQGR FROFKRQHV FRPXQHV GH
ODQDGHHVSXPDGHSROLXUHWDQRRGHPDWHULDOHV VLPLODUHV \ GHPiV FRQIHFFLRQHV WH[WLOHV
no incluidas en el detalle precedente.
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
2WURV WH[WLOHV \ YHVWXDULRV QR HVSHFL¿FDGRV
precedentemente.
2.3 Productos de papel, cartón e impresos
3XOSDGHPDGHUDSDSHO\FDUWyQHQYDVHV\
FDMDV GH SDSHO \ FDUWyQ SURGXFWRV GH SDSHO \
FDUWyQ SDUD R¿FLQDV OLEURV UHYLVWDV \ SHULyGLFRVPDWHULDOGHHQVHxDQ]DSURGXFWRVGHSDSHO\
FDUWyQSDUDFRPSXWDFLyQLPSUHQWD\UHSURGXFFLyQ\RWURVSURGXFWRVGHSXOSDSDSHO\FDUWyQ
3DSHO\FDUWyQGHHVFULWRULR
3DSHO\FDUWyQHQVXVGLYHUVDVIRUPDV\PRGDOLGDGHVGHXVRFRP~QHQR¿FLQDV
3DSHO\FDUWyQSDUDFRPSXWDFLyQ
3DSHO\FDUWyQHQVXVGLYHUVDVIRUPDV\PRdalidades para uso en sistemas informáticos.
3URGXFWRVGHDUWHVJUi¿FDV
)RUPXODULRVSODQLOODVIROOHWRVGHFXDOTXLHU
tQGROHWDUMHWDVFDOHQGDULRVSDUWLWXUDV\GHPiVSURGXFWRVGHODVDUWHVJUi¿FDV
3URGXFWRVGHSDSHO\FDUWyQ
3DSHO \ FDUWyQ HQ ERELQDV HQ SODQFKDV \
SUHQVDGRSDSHOKLJLpQLFRSDxXHORVWRDOODV
\ VHUYLOOHWDV SDSHO \ FDUWyQ PROGHDGR SDUD
XVRGRPpVWLFR EDQGHMDVSODWRVYDVRVHWF FDUWyQ \ SDVWD GH SDSHO PROGHDGR FDQLOODV
GHERELQDVFDUUHWHV\WDSDV SDSHO\FDUWyQ
GH¿OWURSDSHOHQJRPDGR\DGKHVLYRHQVXV
GLYHUVDVIRUPDV\RWURVSURGXFWRVGHSDSHO\
cartón no enunciados precedentemente.
/LEURVUHYLVWDV\SHULyGLFRV
/LEURVSHULyGLFRVUHYLVWDVIROOHWRV\SXEOLFDFLRQHVSHULyGLFDVGHVWLQDGDVDOFRQVXPRHQR¿cinas públicas o para su distribución al público.
1RLQFOX\HORVOLEURVUHYLVWDV\RWUDVSXEOLFDciones destinadas a la dotación de bibliotecas
públicas o de uso de los organismos.
7H[WRVGHHQVHxDQ]D
Artículos y materiales elaborados básicamente de papel y cartón destinados a la ensexDQ]DWDOHVFRPROLEURVSDUDGLVWULEXFLyQR
YHQWDJXtDVGHHVWXGLRHWF
(VSHFLHVWLPEUDGDV\YDORUHV
0DWHULDOLPSUHVRTXHGHDFXHUGRFRQODOHJLVODFLyQYLJHQWHHVXWLOL]DGRFRPRHOHPHQWR GH UHFDXGDFLyQ GH LQJUHVRV ¿VFDOHV WDOHV
206 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
FRPREDQGDVGHJDUDQWtDHVWDPSLOODVSDSHO
VHOODGR\RWUDVHVSHFLHVSDUDHOPLVPR¿Q
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
3URGXFWRVGHSDSHOFDUWyQHLPSUHVRVQRLQcluidos en las partidas parciales anteriores.
2.4 Productos de cuero y caucho
&XHURVFUXGRV\FXHURVHQVXVGLVWLQWRVWLSRV
HODERUDGRVRVHPLHODERUDGRVKXOHV\VLPLODUHV
y caucho en sus distintas elaboraciones.
&XHURV\SLHOHV
&XHURVFUXGRVFXUWLGRV\DGREDGRVFXHURV
JDPX]DGRV \ DSHUJDPLQDGRV FKDURO \ FXHURVPHWDOL]DGRVSLHOHV¿QDVDGREDGDV\DGREDGDVVLQGHSLODUSLHOHVHQSODQFKDVWLUDV\
paños para pulimento industrial.
$UWtFXORVGHFXHUR
7LHQWRV FRUUHDV VXHODV DUQHVHV PDOHWDV
EROVRQHV FLQWRV JXDQWHV SRUWDIROLRV HVWXches y demás artículos elaborados con cuero
QRHVSHFL¿FDGRVSUHFHGHQWHPHQWH6HH[FOX\HFDO]DGRSUHQGDVGHYHVWLU\FDUWHUDVTXH
HVWiQFODVL¿FDGRVHQODSDUWLGD3UHQGDV
GHYHVWLU
$UWtFXORVGHFDXFKR
Artículos de caucho acabados y semiacabaGRV YXOFDQL]DGRV \ VLQ YXOFDQL]DU LQFOX\HQGR HQWUH RWURV OiPLQDV WLUDV YDULOODV
SHU¿OHVWXERVFDxRVPDQJXHUDVFRUUHDV\
FLQWDVWUDQVSRUWDGRUDVDUWtFXORVKLJLpQLFRV\
IDUPDFpXWLFRVUHYHVWLPLHQWRGHSLVRVÀRWDGRUHVHWF
&XELHUWDV\FiPDUDVGHDLUH
Cubiertas neumáticas sólidas y mullidas; cuELHUWDVSDUDYHKtFXORV\HTXLSRVGLVWLQWRVGH
ORVGHFLUFXODFLyQSRUFDUUHWHUDVFRPRDHURQDYHV\WRSDGRUDV\SDUDMXJXHWHVPXHEOHV
y otros usos. Cámaras para las cubiertas descritas anteriormente.
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
Otros productos de cuero y caucho no espeFL¿FDGRVSUHFHGHQWHPHQWH
2.5 Productos químicos, combustibles y lubricantes
'URJDV DERQRV IHUWLOL]DQWHV SODJXLFLGDV \
GHPiVSURGXFWRVTXtPLFRV\PHGLFLQDOHV\SURGXFWRVGHUDPDVLQGXVWULDOHVFRQH[DV SLQWXUDV
EDUQLFHVIyVIRURVHWF &RPEXVWLEOHVHQJHQHUDO H[FHSWRSHWUyOHRFUXGR\JDVQDWXUDO \DFHLtes y grasas lubricantes.
&RPSXHVWRVTXtPLFRV
*DVHVLQGXVWULDOHVDLUHOtTXLGR\FRPSULPLGR DFHWLOHQR \ JDVHV UHIULJHUDQWHV iFLGRV
LQRUJiQLFRViOFDOLV\RWURVFRPSXHVWRVLQRU-
JiQLFRV 6XVWDQFLDV TXtPLFDV RUJiQLFDV EiVLFDVDOFRKROHVDFtFOLFRVIHQROHVFHWRQDV\
TXLQRQDV 2WURV HOHPHQWRV TXtPLFRV LVyWRSRV\FRPSXHVWRVUDGLDFWLYRVSDUDFRPEXVWLble nuclear.
3URGXFWRVIDUPDFpXWLFRV\PHGLFLQDOHV
Preparados farmacéuticos para uso médico;
preparados genéricos y de marcas registraGDVDPSROODVFiSVXODVWDEOHWDVXQJHQWRV
SURGXFWRVERWiQLFRVSXOYHUL]DGRVRPROLGRV
R SUHSDUDGRV GH RWUD IRUPD DSyVLWRV TXLU~UJLFRV JXDWDV PHGLFLQDOHV YHQGDMHV SDUD
fracturas y productos para sutura. Sustancias
TXtPLFDVXWLOL]DGDVHQODSUHSDUDFLyQGHSURductos farmacéuticos; preparados para la higiene bucal y dental.
$ERQRV\IHUWLOL]DQWHV
$ERQRVQLWURJHQDGRVIRVIDWDGRV\SRWiVLFRV
SXURVPL[WRVFRPSXHVWRV\FRPSOHMRVHQWUH
RWURV XUHD iFLGR QtWULFR DPRQtDFR FORUXUR
de amonio comercial y nitrato de potasio.
,QVHFWLFLGDVIXPLJDQWHV\RWURV
,QVHFWLFLGDV UDWLFLGDV IXQJLFLGDV SODJXLFLGDV KHUELFLGDV SURGXFWRV DQWLJHUPLQDQWHV
GHVLQIHFWDQWHV\RWURVSURGXFWRVTXtPLFRVGH
similares características y usos.
7LQWDVSLQWXUDV\FRORUDQWHV
7LQWDVSDUDHVFULELUGLEXMDU\SDUDLPSUHQWD
3LQWXUDVEDUQLFHVHVPDOWHV\ODFDVSLJPHQtos preparados y colores preparados; masillas
\ SUHSDUDGRV VLPLODUHV QR UHIUDFWDULRV SDUD
UHOOHQR\HQOXFLGRGLVROYHQWHVGLOX\HQWHV\
UHPRYHGRUHVGHSLQWXUD
&RPEXVWLEOHV\OXEULFDQWHV
&RPEXVWLEOHV OtTXLGRV JDVHRVRV H[FHSWR
JDVQDWXUDO \QXFOHDUHVDFHLWHVGHDOXPEUDdo y aceites y grasas lubricantes.
(VSHFt¿FRVYHWHULQDULRV
Medicamentos y productos farmacéuticos y
GHPiVDUWtFXORVSDUDXVRYHWHULQDULR
3URGXFWRVGHPDWHULDOSOiVWLFR
$UWtFXORVGLYHUVRVGHPDWHULDOSOiVWLFRWDOHV
FRPROiPLQDVOLHQ]RVEROVDVWXERV\DFFHVRULRVGH39&HWF6HH[FOX\HQORVDUWtFXORV
GHPDWHULDOSOiVWLFRFODVL¿FDGRVHQRWURVELHnes de consumo.
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
([SORVLYRVSURGXFWRVGHSLURWHFQLDSyOYRUDV SURSXOVRUDV PHFKDV GHWRQDGRUDV \ GH
VHJXULGDG IXHJRV DUWL¿FLDOHV EHQJDODV HWF
3URGXFWRV IRWRTXtPLFRV FRPR SODFDV IRWRJUi¿FDVSHOtFXODVSDSHOVHQVLELOL]DGR\SUHSDUDGRVTXtPLFRVGHXVRIRWRJUi¿FR
8 - ANEXO 2 - Clasificador por objeto del gasto / 207
SLHGUDV GH DPRODU \ SURGXFWRV DEUDVLYRV \
Preparados aromáticos de uso personal como
otros artículos elaborados con sustancias miSHUIXPHVDJXDGHFRORQLD\GHWRFDGRUSUHnerales no metálicas no incluidas en las parSDUDGRVGHEHOOH]D\GHPDTXLOODMH3URGXFWRV
tidas parciales anteriores.
GLYHUVRVGHULYDGRVGHOSHWUyOHRH[FOXLGRVORV
2.7 Productos metálicos
combustibles y lubricantes. Demás productos
Productos metálicos sin elaborar y semielaTXtPLFRVQRFODVL¿FDGRVHQODVSDUWLGDVSDUborados y sus manufacturas.
ciales anteriores.
3URGXFWRVIHUURVRV
2.6 Productos de minerales no metálicos
$UWtFXORV GH FHUiPLFD GH YLGULR GH OR]D \ +LHUUR\DFHURHQOLQJRWHVWRFKRVEDUUDVSDODVWURV\RWUDVIRUPDVGHKLHUURDFHUR\DFHSRUFHODQD \ GH FHPHQWR FDO \HVR \ DVEHVWR \
URGHDOHDFLyQHQHVWDGRVHPLDFDEDGRKRMDV
demás productos elaborados con minerales no
SODQFKDV\UROORVEDUUDV\YDULOODVSHU¿OHV
metálicos.
DODPEUHWXERVFDxRV\GHPiVSURGXFWRVGH
3URGXFWRVGHDUFLOOD\FHUiPLFD
hierro y acero.
$UWtFXORVGHFHUiPLFDQRUHIUDFWDULDH[FHSWR
3URGXFWRVQRIHUURVRV
los de loza y porcelana. Artículos de cerámica
2UR SODWD SODWLQR FREUH SORPR FURPR
UHIUDFWDULDFRPRODGULOORVEORTXHVWHMDVORVHPDQJDQHVR ]LQF DOXPLQLR QtTXHO \ HVWDxR
tas y otros similares para la construcción y los
y otros metales comunes no ferrosos y sus
XWLOL]DGRVHQODLQGXVWULDTXtPLFD\ODLQGXVWULDHQJHQHUDODVtFRPRFHUiPLFDXWLOL]DGDHQ
DOHDFLRQHV VLQ HODERUDU VHPLHODERUDGRV \
la agricultura.
sus manufacturas.
3URGXFWRVGHYLGULR
0DWHULDOGHJXHUUD
9LGULR HQ EDUUDV HQ YDULOODV HQ ERODV \ WX 0XQLFLRQHVFDVFRVFDUWXFKRVKHUUDPLHQWDV
ERV FRODGR R ODPLQDGR HVWLUDGR R UROODGR
\D¿QHVHWF
YLGULRV\FULVWDOHVOXQDVRYLGULRVGHVHJXUL (VWUXFWXUDVPHWiOLFDVDFDEDGDV
GDGHVSHMRV\HQYROWXUDVWXEXODUHVGHYLGULR (VWUXFWXUDVPHWiOLFDV\VXVSDUWHVHVWUXFWXras elaboradas en acero y productos similaYLGULRVSDUDUHORMHVYLGULRVySWLFRV\SLH]DV
UHVWDOHVFRPRFROXPQDVYLJDVDUPDGXUDV
GH YLGULRV ySWLFRV VLQ ODEUDU \ GHPiV SURSXHUWDV YHQWDQDV \ VXV PDUFRV SRVWLJRV
GXFWRVGHYLGULRQRHVSHFL¿FDGRVSUHFHGHQcarpintería metálica utilizada en la constructemente.
FLyQUHMDVFHORVtDVHWF
3URGXFWRVGHOR]D\SRUFHODQD
$UWtFXORVGHOR]D\SRUFHODQDSDUDGLYHUVRV +HUUDPLHQWDVPHQRUHV
+HUUDPLHQWDVGHPDQRGHOWLSRTXHVHXWLOL]D
XVRVWDOHVFRPRLQRGRURVODYDPDQRVPLQHQ DJULFXOWXUD JDQDGHUtD KRUWLFXOWXUD VLOYLJLWRULRVHWF
FXOWXUD FDUSLQWHUtD FKDSLVWHUtD \ RWUDV LQ 3URGXFWRVGHFHPHQWRDVEHVWR\\HVR
GXVWULDVWDOHVFRPRVLHUUDV\KRMDVGHVLHUUD
$UWtFXORVGHKRUPLJyQFHPHQWR\\HVRSDUD
FXFKLOODV\FL]DOODVSDUDPiTXLQDV\DSDUDWRV
XVRHQODFRQVWUXFFLyQFRPRORVHWDVEDOGRVDV
PHWiOLFRVGHVWRUQLOODGRUHVSLFRVSDODVWHQDODGULOORVSODQFKDVOiPLQDVWDEOHURVWXERV\
]DVPDUWLOORVHWF
SRVWHV$UWtFXORVGHDVEHVWRFHPHQWR¿EURFH 2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
mento de celulosa y de materiales similares.
$UWtFXORV GH PHWDO SDUD XVR GRPpVWLFR H[ &HPHQWRFDO\\HVR
FHSWR XWHQVLOLRV GH FRFLQD \ FRPHGRU FH &HPHQWRVKLGUiXOLFRVLQFOXVRFHPHQWRGH
UUDGXUDVFDQGDGRVSDVDGRUHVOODYHV\RWURV
SRUWODQG FHPHQWR DOXPLQRVR \ FHPHQWR
DFFHVRULRVSDUDHGL¿FLRVPXHEOHVYHKtFXORV
hipersulfatado en forma clinca y en otras
y otros usos. Demás productos metálicos no
formas.
incluidos en las partidas parciales anteriores.
&DOYLYDFDODSDJDGD\FDOKLGUiXOLFD<HVRV
2.8 Minerales
producidos con yesos calcinados y con sulfato de calcio.
0LQHUDOHVVyOLGRVPLQHUDOHVPHWDOtIHURVSH 2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH WUyOHRFUXGR\JDVQDWXUDOSLHGUDV\DUHQD
0LQHUDOHVPHWDOtIHURV
Otros productos de minerales no metálicos
0LQHUDOHV GH KLHUUR KHPDWLWD PDJQHWLWD
FRPR VHU KLODGRV WHODV \ DUWtFXORV GH DVOLPRQLWDVLGHURVD\WRFDQLWD 0LQHUDOHVQR
besto; materiales aislantes de origen mineral
IHUURVRV EDX[LWDFREDOWRPROLEGHQRWiQWDODQDGHHVFRULDVYHUPLFXOLWDHWF SURGXFOR\YDQDGLR WRV GH ODQD GH YLGULR SDUD DLVODQWH WpUPLFR
208 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
3HWUyOHRFUXGR\JDVQDWXUDO
Petróleo crudo y gas natural
&DUEyQPLQHUDO
&DUEyQ GH SLHGUD DQWUDFLWD FDUERQHV ELtuminosos y otros tipos de carbón mineral.
Lignito y turba.
3LHGUDDUFLOOD\DUHQD
3LHGUDV DUFLOOD \ DUHQDV FRULQGyQ QDWXUDO
JUDQLWRPiUPROHV\GHPiVSLHGUDVFDOFiUHDV
FDQWRURGDGRSHGUHJXOOR\DUHQDVQDWXUDOHV
de todo tipo y clase.
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
8UDQLRWRULRWDOFRGRORPLWDD]XIUH\RWURV
minerales no incluidos en las partidas parciales anteriores.
2.9 Otros bienes de consumo
2WURV ELHQHV GH FRQVXPR XWLOL]DGRV HQ R¿FLQDVHVWDEOHFLPLHQWRVGHHQVHxDQ]DFRFLQDV\
FRPHGRUHVHVWDEOHFLPLHQWRVKRVSLWDODULRV\ODERUDWRULRVFRPRDVtWDPELpQPDWHULDOHVHOpFWULcos y de limpieza no incluidos en otras partidas.
(OHPHQWRVGHOLPSLH]D
-DERQHVGHWHUJHQWHV\DJXDVODYDQGLQDVHQWRGDVVXVIRUPDV%HWXQHVFHUDV\FUHPDVSDUD
FDO]DGRV SLVRV FDUURFHUtDV YLGULRV \ PHWDO
3UHSDUDGRV SDUD GHVRGRUL]DU DPELHQWHV HWF
Elementos o utensilios de limpieza como ceSLOORVWUDSRVHQVXVGLYHUVDVIRUPDVSOXPHURVVHFDGRUHVHVFREDVHVFRELOORQHVEDOGHV
SDODQJDQDVHWF'HPiVHOHPHQWRVGHOLPSLHza no incluidos en otras partidas.
ÒWLOHVGHHVFULWRULRR¿FLQD\HQVHxDQ]D
/iSLFHV ODSLFHUDV FDUSHWDV UHJODV SXQWHURV EURFKHV DO¿OHUHV DEURFKDGRUDV SHUIRUDGRUDVFLQWDVLPSUHJQDGDVGLVNHWWHVSHJDPHQWRVJRPDVGHERUUDUERUUDGRUHVVHOORV
ELEOLRUDWRV WL]DV PDUFDGRUHV HWF \ GHPiV
HOHPHQWRVGHXVRFRP~QHQR¿FLQDV\HVWDblecimientos de enseñanza no incluidos en
ninguna otra partida.
ÒWLOHV\PDWHULDOHVHOpFWULFRV
&DEOHV OODYHV LQWHUUXSWRUHV ¿FKDV WUDQVIRUPDGRUHV OiPSDUDV WXERV ÀXRUHVFHQWHV
]yFDORV DUUDQFDGRUHV SLODV DFXPXODGRUHV
eléctricos y demás útiles y materiales eléctricos no incluidos en otras partidas.
8WHQVLOLRVGHFRFLQD\FRPHGRU
6DUWHQHVFDFHURODVDUWtFXORVGHFXFKLOOHUtD
FXFKDUDV WHQHGRUHV FXFKDURQHV FHUQLGRUHV
\ WDPLFHV HVSXPDGHUDV SLQ]DV SDUD VHUYLU
VDOHURV\SLPHQWHURVWLMHUDGHWULQFKDUFRODGRUHVYDVRVWD]DVSRFLOORVSODWRV\GHPiV
utensilios de cocina y comedor.
ÒWLOHVPHQRUHVPpGLFRVTXLU~UJLFRV\
de laboratorio
Instrumental menor de uso práctico y cienWt¿FRHQPHGLFLQDFLUXJtDRGRQWRORJtDYHWHULQDULD \ ODERUDWRULR WDOHV FRPR MHULQJDV
DJXMDV JDVDV YHQGDMHV PDWHULDO GH VXWXUD
JXDQWHVSDUDFLUXJtDYDVRVGHSUHFLSLWDFLyQ
SLSHWDVDODPELTXHVFXUHWDVSLQ]DVHWF
5HSXHVWRV\DFFHVRULRV
Repuestos y accesorios menores considerados como instrumental complementario de
PiTXLQDV\HTXLSRV&RPSUHQGHUHSXHVWRV\
DFFHVRULRV SDUD PiTXLQDV GH R¿FLQD HQ JHQHUDOHTXLSRVGHWUDFFLyQWUDQVSRUWH\HOHYDFLyQPDTXLQDULD\HTXLSRGHSURGXFFLyQ
HTXLSRVGHFRPSXWDFLyQHWF
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
Otros bienes de consumo no incluidos en las
partidas anteriores.
3. Servicios no personales
6HUYLFLRVSDUDHOIXQFLRQDPLHQWRGHORVHQWHVHVWDWDOHVLQFOXLGRVORVTXHVHGHVWLQDQDFRQVHUYDFLyQ
y reparación de bienes de capital. Incluye asimismo
ORVVHUYLFLRVXWLOL]DGRVHQORVSURFHVRVSURGXFWLYRV
SRUODVHQWLGDGHVTXHGHVDUUROODQDFWLYLGDGHVGHFDUiFWHUFRPHUFLDOLQGXVWULDORVHUYLFLRV&RPSUHQGH VHUYLFLRV EiVLFRV DUUHQGDPLHQWR GH HGL¿FLRV
WHUUHQRV \ HTXLSRV VHUYLFLRV GH PDQWHQLPLHQWR
OLPSLH]D\UHSDUDFLyQVHUYLFLRVSURIHVLRQDOHVWpFQLFRV\RSHUDWLYRVSXEOLFLGDGHLPSUHVLyQVHUYLFLRVFRPHUFLDOHV\¿QDQFLHURVHWF
3.1 Servicios básicos
6HUYLFLRV GH SURYLVLyQ GH HOHFWULFLGDG JDV
DJXD LQFOXLGDODHYDFXDFLyQGHHÀXHQWHVFORDFDOHV VHUYLFLRVGHFRPXQLFDFLyQHQWUHRWURV,QFOXye los gastos inherentes a la habilitación o rehaELOLWDFLyQGHVHUYLFLRVLQVWDODFLyQRUHSRVLFLyQGH
PHGLGRUHVLQVWDODFLyQGHOtQHDVWHOHIyQLFDVHWF
3.2 Alquileres y Derechos
Arrendamiento de toda clase de bienes inPXHEOHV PXHEOHV \ VHPRYLHQWHV LQFOX\H HO
pago de las sumas pactadas por la suscripción de
contratos de leasingRGHFRQVWUXFFLyQDULHVJR
GHOFRQWUDWLVWDGHREUDVEDMRODPRGDOLGDGllave
en mano.
$EDUFDDVLPLVPRHOSDJRGHGHUHFKRVVREUH
ELHQHVLQWDQJLEOHVWDOHVFRPRORVTXHVHUHDOLzan en concepto de licencias por el uso de programas de computación.
3.3 Mantenimiento, reparación y limpieza
&RPSUHQGHORVVHUYLFLRVLQGLFDGRVHQODVSDUWLGDVSDUFLDOHVTXHVHGHVFULEHQDFRQWLQXDFLyQ
8 - ANEXO 2 - Clasificador por objeto del gasto / 209
0DQWHQLPLHQWR \ UHSDUDFLyQ GH HGL¿cios y locales
6HUYLFLRV GH FRQVHUYDFLyQ \ UHSDUDFLyQ GH
LQPXHEOHVTXHWLHQGHDPDQWHQHUORVHQFRQGLFLRQHVDGHFXDGDVGHIXQFLRQDPLHQWRWDOHV
FRPR SLQWXUD GHVPRQWH \ PDQWHQLPLHQWRV
PHQRUHV,QFOX\HHOSDJRGHH[SHQVDVFRPXQHVHQHGL¿FLRVRORFDOHVHQSURSLHGDGKRULzontal.
0DQWHQLPLHQWR\UHSDUDFLyQGHYHKtFXORV
6HUYLFLRGHFRQVHUYDFLyQ\UHSDUDFLyQGHYHhículos en general.
0DQWHQLPLHQWR\UHSDUDFLyQGHPDTXLQDULD\HTXLSR
6HUYLFLRV GH PDQWHQLPLHQWR \ UHSDUDFLRQHV
PHQRUHVGHHTXLSRV\PDTXLQDULDVDHIHFWRV
de su normal funcionamiento. En el caso de
ORV VHUYLFLRV FRPSXWDFLRQDOHV LQFOX\H WDPELpQODVDGHFXDFLRQHVTXHUHTXLHUHQORVVLVtemas de propiedad institucional para manteQHUVXYLJHQFLD\XWLOLGDG
0DQWHQLPLHQWR\UHSDUDFLyQGHYtDVGH
comunicación
Gastos destinados al mantenimiento y conVHUYDFLyQ GH FDPLQRV FDUUHWHUDV DXWRSLVWDV
SXHQWHV\YtDVIpUUHDVÀXYLDOHVDHUyGURPRV
y otros.
/LPSLH]DDVHR\IXPLJDFLyQ
*DVWRV SRU H[WUDFFLyQ GH EDVXUD OLPSLH]D
\IXPLJDFLyQJHQHUDOGHHGL¿FLRV\R¿FLQDV
públicas.
0DQWHQLPLHQWRGHHVSDFLRVYHUGHV
*DVWRVGHSUHVHUYDFLyQUHFXSHUDFLyQ\PDQWHQLPLHQWRGHHVSDFLRVYHUGHViUHDVIRUHVWDGDV\SDUTXL]DGDVSDUTXHVQDWXUDOHV\]RQDV
GHUHVHUYDHFROyJLFD
+LJLHQHXUEDQD
6HUYLFLRVGHUHFROHFFLyQGHUHVLGXRVEDUULGR
\ OLPSLH]D GHO HMLGR XUEDQR LQFOX\HQGR HO
mantenimiento y limpieza de los sumideros
\GHVDJHVSOXYLDOHV&RPSUHQGHDVLPLVPR
HOWUDWDPLHQWR\GLVSRVLFLyQ¿QDOGHUHVLGXRV
SHOLJURVRV UHVLGXRV SDWROyJLFRV KRVSLWDODULRV VXVWDQFLDV \ GHVHFKRV Wy[LFRV R LQÀDPDEOHVHWF 2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
2WURVJDVWRVGHPDQWHQLPLHQWRUHSDUDFLyQ\
OLPSLH]DQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
3.4 Servicios profesionales, técnicos y operativos
6HUYLFLRV SUHVWDGRV SRU SHUVRQDV ItVLFDV
comprenden el pago de honorarios legales o
FRQYHQFLRQDOHV D SHULWRV SURIHVLRQDOHV XQLYHU-
VLWDULRV HVSHFLDOLVWDV WpFQLFRV \ RSHUDULRV VLQ
UHODFLyQ GH GHSHQGHQFLD ,QFOX\H ORV VHUYLFLRV
GHFRQVXOWRUtD\DVHVRUtDSUHVWDGRVSRUWHUFHURV
UHODFLRQDGRVFRQHVWXGLRVLQYHVWLJDFLRQHVDQiOLVLV DXGLWRUtDV VLVWHPDV FRPSXWDUL]DGRV HWF
OD FRQWUDWDFLyQ GH VHUYLFLRV SDUD OD UHDOL]DFLyQ
GH XQ SURGXFWR GHWHUPLQDGR HWF &RPSUHQGH
DVLPLVPR ODV FRQWUDWDFLRQHV GH FDUiFWHU FXOWXUDORUHFUHDWLYR
3.5 Servicios empresariales comerciales y
¿QDQFLHURV
&RPSUHQGH ORV VHUYLFLRV LQGLFDGRV HQ ODV
SDUWLGDV SDUFLDOHV TXH VH GHWDOODQ D FRQWLQXDción:
7UDQVSRUWH
)OHWHVWHUUHVWUHVPDUtWLPRV\DpUHRVDVtFRPR
HOJDVWRGHULYDGRGHOHPEDODMHGHPHUFDQFtDV
,QFOX\H DVLPLVPR HO VHUYLFLR GH PXGDQ]DV
Comprende las erogaciones originadas en el
transporte de efectos personales de agentes
GHO(VWDGRGHVGH\KDFLDHOH[WHULRUGHDFXHUGRFRQODVQRUPDVOHJDOHVYLJHQWHV
$OPDFHQDPLHQWR
6HUYLFLRVGHDOPDFHQDMHGHLQVXPRVELHQHV
muebles y otros materiales.
,PSUHQWDSXEOLFDFLRQHV\UHSURGXFFLRQHV
6HUYLFLRVGHLPSUHVLyQFRSLD\HQFXDGHUQDción prestados por terceros. Publicaciones de
FDUiFWHU LQIRUPDWLYR R GLYXOJDFLRQHV GH WLSR
FXOWXUDO FLHQWt¿FR \ WpFQLFR 6H H[FOX\HQ OD
LPSUHVLyQGHIRUPXODULRVOLEURV\GHPiVLPSUHVRVGHVWLQDGRVDOXVRGHODVR¿FLQDVTXHVH
LPSXWDUiQDODSDUWLGD³3URGXFWRVGHDUWHV
JUi¿FDV´
3ULPDV\JDVWRVGHVHJXURV
Primas y gastos de seguros de personas o de
cosas. Incluye el pago de las contribuciones
a cargo del Estado a las Aseguradoras de
5LHVJRGH7UDEDMR
&RPLVLRQHV\JDVWRVEDQFDULRV
*DVWRVSDUDDWHQGHUORVVHUYLFLRVTXHSUHVWDQ
ORVEDQFRVWDOHVFRPRFREURGHLPSXHVWRV
DSHUWXUD GH FDUWD GH FUpGLWR WUDQVIHUHQFLDV
EDQFDULDVHWF
6LVWHPDVLQIRUPiWLFRV\GHUHJLVWUR
6HUYLFLRVGHVLVWHPDVGHUHJLVWURHLQIRUPDción prestados por terceros.
&RUUHRV\WHOHFRPXQLFDFLRQHV
Gastos destinados al pago de contratos con
HPSUHVDVSUHVWDGRUDVGHVHUYLFLRVSRVWDOHV
6HUYLFLRGHYLJLODQFLD
*DVWRVGHVWLQDGRVDOSDJRGHVHUYLFLRVGHVHJXULGDG\YLJLODQFLD
210 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
2WURVVHUYLFLRVFRPHUFLDOHV\¿QDQFLHURVQR
HVSHFL¿FDGRVSUHFHGHQWHPHQWH
3.6 Publicidad y propaganda
Gastos en concepto de publicidad y propaJDQGD SRU PHGLR GH UDGLRGLIXVRUDV WHOHYLVLyQ
FLQHVWHDWURVSHULyGLFRVUHYLVWDVIROOHWRVFDUWHOHVHWF,QFOX\HORVFRQWUDWRVFRQODVDJHQFLDV
SXEOLFLWDULDV \ SURGXFWRUDV FLQHPDWRJUi¿FDV \
WHOHYLVLYDV
3.7 Pasajes, viáticos y movilidad
&RPSUHQGHORVVHUYLFLRV\FRQFHSWRVLQGLFDdos en las partidas parciales detalladas a continuación:
3DVDMHV
Comprende los pasajes pagados a empresas
de transporte por el traslado del personal de
ODVLQVWLWXFLRQHV([FOX\HORVLPSRUWHVDERnados al personal en concepto de gastos de
PRYLOLGDG
9LiWLFRV
$VLJQDFLRQHVTXHVHRWRUJDQDOSHUVRQDOFRQ
PRWLYRGHODSUHVWDFLyQGHVHUYLFLRVIXHUDGHO
OXJDUKDELWXDOGHWUDEDMRHQORVWpUPLQRVGH
ODOHJLVODFLyQYLJHQWH
0RYLOLGDG
,PSRUWHVTXHVHDERQDQDOSHUVRQDOTXHSUHVWDVHUYLFLRVHQODYtDS~EOLFDHQFRQFHSWRGH
JDVWRV GH PRYLOLGDG HQ ORV WpUPLQRV GH OD
UHJODPHQWDFLyQYLJHQWH
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
3.8 Impuestos, derechos y tasas
Comprende los conceptos indicados en las
partidas parciales detalladas a continuación:
,PSXHVWRVLQGLUHFWRV
Gastos destinados al pago de impuestos indirectos.
,PSXHVWRVGLUHFWRV
Gastos destinados al pago de impuestos directos.
'HUHFKRV\WDVDV
Gastos destinados al pago de derechos y
tasas.
0XOWDVUHFDUJRV\VHQWHQFLDVMXGLFLDOHV
*DVWRV HQ FRQFHSWR GH PXOWDV \ UHFDUJRV
FXDOTXLHUD TXH IXHVH HO RULJHQ GHO SDJR D
realizar. Comprende los gastos originados en
VHQWHQFLDVMXGLFLDOHV¿UPHVFRQWUDHO*RELHUno de la Ciudad Autónoma de Buenos Aires
y en acuerdos de partes resultantes de procesos de mediación en donde éste deba hacerse
FDUJRLQFOX\HQGRODVFRVWDV\GHPiVJDVWRV
generados en el proceso judicial.
5HJDOtDV
*DVWRVSRUODWUDQVIHUHQFLDGHOGRPLQLRXVR
o goce de cosas o la de cesión de derechos a
IDYRUGHODHQWLGDGFX\RPRQWRVHGHWHUPLQH
HQUHODFLyQFRQXQDXQLGDGGHSURGXFFLyQGH
YHQWDGHH[SORWDFLyQHWFFXDOTXLHUDTXHVHD
ODGHQRPLQDFLyQDVLJQDGDDVXEHQH¿FLDULR
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
2WURVLPSXHVWRVGHUHFKRV\WDVDVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
3.9 Otros servicios
&RPSUHQGHORVVHUYLFLRV\FRQFHSWRVLQGLFDdos en las partidas parciales detalladas a continuación:
6HUYLFLRVGHFHUHPRQLDO
Gastos en concepto de recepción y atención
GH KXpVSHGHV R¿FLDOHV \ SHUVRQDOLGDGHV
Comprende los gastos destinados a homenaMHVDFWRVSDWULyWLFRVDJDVDMRVHWF
6HUYLFLRVGHFRPLGDVYLDQGDV\UHIULJHULRV
*DVWRVHQFRQFHSWRGHVHUYLFLRVLQWHJUDOHVGH
DOLPHQWDFLyQHQHVFXHODVKRVSLWDOHVHWF
3UHPLRV\UHFRQRFLPLHQWRV
Gastos originados en la concesión de prePLRV\UHFRQRFLPLHQWRVSRUDFWLYLGDGHVGHVWDFDGDVHQHOFDPSRGHODHGXFDFLyQODFXOWXUDHOGHSRUWHHWF&RPSUHQGHDVLPLVPR
los reconocimientos al mérito.
2WURVQRHVSHFL¿FDGRVSUHFHGHQWHPHQWH
2WURVVHUYLFLRVYDULRVQRHVSHFL¿FDGRVSUHcedentemente.
4. Bienes de uso
*DVWRVTXHVHJHQHUDQSRUODDGTXLVLFLyQRFRQVWUXFFLyQGHELHQHVGHFDSLWDOTXHDXPHQWDQHODFWLYRGHODVHQWLGDGHVGHO6HFWRU3~EOLFRHQXQSHUtRGRGDGRVLHQGRpVWRVORVELHQHVItVLFRVFRQVWUXFFLRQHV\RHTXLSRVTXHVLUYHQSDUDSURGXFLURWURV
ELHQHVRVHUYLFLRVQRVHDJRWDQHQHOSULPHUXVR
TXHGHHOORVVHKDFHWLHQHQXQDGXUDFLyQVXSHULRUD
XQDxR\HVWiQVXMHWRVDGHSUHFLDFLyQ,QFOX\HDVLPLVPRORVDFWLYRVLQWDQJLEOHV'HEHUiQLQFOXLUVH
ORVJDVWRVJHQHUDGRVSRUODDGTXLVLFLyQ\FRQVWUXFFLyQGHELHQHVGHXVRSURSLR\DTXpOORVDGTXLULGRV
o construidos para ser transferidos a terceros.
4.1 Bienes preexistentes
&RPSUHQGHODDGTXLVLFLyQGHELHQHVItVLFRV
\DH[LVWHQWHVTXHSRUVXVFDUDFWHUtVWLFDVQRSXHden ser considerados dentro de las restantes partidas principales de este inciso.
7LHUUDV\WHUUHQRV
3UHGLRV XUEDQRV EDOGtRV FDPSRV FRQ R VLQ
mejoras.
8 - ANEXO 2 - Clasificador por objeto del gasto / 211
(GL¿FLRVHLQVWDODFLRQHV
(GL¿FLRV HQ JHQHUDO LQFOXLGR HO WHUUHQR HQ
TXHVHDVLHQWDQIiEULFDVUHSUHVDVSXHQWHV
PXHOOHV FDQDOL]DFLRQHV UHGHV GH VHUYLFLR
S~EOLFR R SULYDGR \ RWURV ELHQHV GH FDSLWDO
DGKHULGRVDOWHUUHQRLQFOXLGRpVWH\ORVGHUHFKRVGHVHUYLGXPEUH
2WURVELHQHVSUHH[LVWHQWHV
2WURV ELHQHV GH FDSLWDO SUHH[LVWHQWHV QR LQcluidos en algunas de las partidas parciales
precedentes.
4.2 Construcciones
&RPSUHQGH OD UHDOL]DFLyQ GH REUDV TXH SHUPDQHFHQ FRQ FDUiFWHU GH DGKHUHQFLD DO VXHOR
IRUPDQGRSDUWHGHXQWRGRLQGLYLVLEOHDVtFRPR
ODVDPSOLDFLRQHV PHMRUDV GHFRQVWUXFFLRQHV\D
H[LVWHQWHV\ODUHFXSHUDFLyQGHWLHUUDVEDMDV\DQHJDGL]DV1RLQFOX\HHOYDORUGHODWLHUUDHOTXHVH
SUHYHUiHQODSDUWLGDSDUFLDO7LHUUDV\7HUUHQRV
&RPSUHQGHORVUHOHYDPLHQWRVFDUWRJUi¿FRV
JHROyJLFRV PLQHURV HWF QHFHVDULRV SDUD OD
construcción de un proyecto preconcebido en un
iUHD\FRQREMHWLYRVGHWHUPLQDGRV
&RQVWUXFFLRQHV HQ ELHQHV GH GRPLQLR
SULYDGR
Gastos destinados a la construcción de obras
GHO GRPLQLR SULYDGR WDOHV FRPR HGL¿FLRV
SDUDR¿FLQDVS~EOLFDVSDUDVDOXGVHJXULGDG
HGXFDFLyQFXOWXUDSDUDYLYLHQGDVSDUDDFWLYLGDGHVFRPHUFLDOHVLQGXVWULDOHV\RGHVHUYLFLRV
&RQVWUXFFLRQHV HQ ELHQHV GH GRPLQLR
público
Gastos destinados a la construcción de obras
GHOGRPLQLRS~EOLFRWDOHVFRPRFDOOHVFDPLQRV\FDUUHWHUDVSOD]DVFDQDOHVSXHQWHVGLTXHV\FXDOTXLHURWUDREUDS~EOLFDFRQVWUXLGD
para utilidad o comodidad común.
5HOOHQRVDQLWDULR
Gastos originados en el proceso de ingeniería
DPELHQWDOSRUHOTXHVHUHFXSHUDQH[WHQVLRQHV
PDUJLQDOHV WHUUHQRVEDMRV\DQHJDGL]RV PHdiante la utilización de basura compactada.
4.3 Maquinaria y equipo
&RPSUHQGHORVVHUYLFLRV\FRQFHSWRVLQGLFDdos en las partidas parciales detalladas a continuación:
0DTXLQDULD\HTXLSRGHSURGXFFLyQ
0DTXLQDULD \ HTXLSR XWLOL]DGRV SULPRUGLDOPHQWHHQODLQGXVWULDGHODFRQVWUXFFLyQHQ
ODSURGXFFLyQDJURSHFXDULDHQODVLQGXVWULDV
PDQXIDFWXUHUDV HQ OD SURGXFFLyQ GH VHUYLFLRV HQHUJtDJDVDJXDSRWDEOH HWF
(TXLSRGHWUDQVSRUWHWUDFFLyQ\HOHYDción
(TXLSRVGHWUDQVSRUWHSRUYtDWHUUHVWUHÀXYLDO
PDUtWLPDODFXVWUH\DpUHD,QFOX\HDVLPLVPR
HTXLSRVGHWUDFFLyQ\HOHYDFLyQFRPRWUDFWRUHVDXWRJXtDVPRQWDFDUJDVPRWRQLYHODGRUDV
HOHYDGRUHVDVFHQVRUHVWUDLOHUHVHWF
(TXLSRVDQLWDULR\GHODERUDWRULR
(TXLSRV PpGLFRV RGRQWROyJLFRV VDQLWDULRV
\GHLQYHVWLJDFLyQ&RPSUHQGHQHQWUHRWURV
PHVDVGHRSHUDFLyQERPEDVGHFREDOWRDSDUDWRV GH UD\RV ; WRPyJUDIRV LQVWUXPHQWDO
PpGLFR TXLU~UJLFR PLFURVFRSLRV DXWRFODYHV UHIULJHUDGRUHV HVSHFLDOHV HVWHULOL]DGRUHV EDODQ]DV GH SUHFLVLyQ FDPDV RUWRSpGLFDVFROFKRQHVGHXVRWHUDSpXWLFRHWF
(TXLSRGHFRPXQLFDFLyQ\VHxDODPLHQWR
3ODQWDV WUDQVPLVRUDV UHFHSWRUHV GH UDGLR
HTXLSR GH WHOHYLVLyQ DSDUDWRV WHOHJUi¿FRV
WHOHWLSRVWRUUHVGHWUDQVPLVLyQHTXLSRVXWLOL]DGRVHQQDYHJDFLyQPDUtWLPD\DpUHDFHQWUDOHV\DSDUDWRVWHOHIyQLFRV\GHPiVHTXLSRV
GH FRPXQLFDFLyQ (TXLSRV GH VHxDOL]DFLyQ
GHUXWDVGHFDOOHVER\DVEDOL]DVHWF
(TXLSRHGXFDFLRQDOFXOWXUDO\UHFUHDWLYR
$SDUDWRV DXGLRYLVXDOHV SUR\HFWRUHV PLFUyIRQRV JUDEDGRUHV WHOHYLVRUHV HWF LQVWUXPHQWRV SDUD GLEXMR SLQWXUD HVFXOWXUD
P~VLFD PHVDV GH GLEXMR FDEDOOHWHV FLQFHOHV LQVWUXPHQWRV PXVLFDOHV HWF PXHEOHV
HVSHFLDOL]DGRV SDUD XVR HVFRODU SXSLWUHV
SL]DUURQHV HWF HTXLSRV UHFUHDWLYRV \ GHSRUWLYRV DSDUDWRV SDUD SDUTXHV LQIDQWLOHV
HTXLSRV SDUD SUiFWLFDV GHSRUWLYDV \ JLPQDVLDPHVDVHVSHFLDOHVGHMXHJRVHWF \RWURV
HOHPHQWRVGHVWLQDGRVDDFWLYLGDGHVHGXFDWLYDVFXOWXUDOHVGHSRUWLYDVRUHFUHDWLYDV
(TXLSRSDUDFRPSXWDFLyQ
8QLGDGHV FHQWUDOHV GH SURFHVDPLHQWR SDQWDOODV WHFODGRV LPSUHVRUDV FRPSXWDGRUDV
XQLGDGHV GH FLQWD XQLGDGHV GH GLVFR HOHPHQWRVDFFHVRULRVD¿QHVHWF4XHGDQFRPSUHQGLGDV H[FOXVLYDPHQWH ODV SDUWHV ItVLFDV
KDUGZDUH (TXLSRGHR¿FLQD\PREODMH
(TXLSDPLHQWR\PRELOLDULRGHGLVWLQWDtQGROH
SDUD R¿FLQDV WDOHV FRPR HVWDQWHUtDV HVFULWRULRV¿FKHURVSHUFKHURVPHVDVSDUDFRPSXWDFLyQPHVDVSDUDGLEXMRSDUDWHOpIRQRHWF
PiTXLQDVGHHVFULELUGHVXPDUGHFDOFXODUGH
UHSURGXFFLyQ GH FRSLDV HWF 0RELOLDULR SDUD
acondicionamiento de ambientes tales como
PHVDVVLOODVVLOORQHVDUPDULRVYLWULQDVPH-
212 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
VDGDVERWLTXLQHVHWF\DUWHIDFWRVGHFRQIRUW
KHODGHUDV FRFLQDV HTXLSRV GH DLUH DFRQGLFLRQDGRWHUPRWDQTXHVHWF
+HUUDPLHQWDV\UHSXHVWRVPD\RUHV
5HSXHVWRV PD\RUHV TXH WLHQGHQ D DXPHQWDU VXVWDQFLDOPHQWH HO YDORU GHO HTXLSR R D
SURORQJDU VX YLGD ~WLO WDOHV FRPR PRWRUHV
FDUURFHUtDVFKDVLVHWF\PiTXLQDV\KHUUDPLHQWDVSDUDWRUQHDUSHUIRUDUIUHVDUFHSLOODU
WDODGUDUUHFWL¿FDUHVWDPSDUSUHQVDUFODYDU
HQJUDSDU\HQFRODU0iTXLQDVHOpFWULFDV\GH
JDVSDUDVROGDGXUDDXWyJHQDGXUD\EODQGD
Herramientas con motor y de funcionamiento con aire comprimido. Partes y accesorios
de las herramientas enunciadas.
(TXLSRVYDULRV
2WURWLSRGHPDTXLQDULD\HTXLSRQRLQFOXLGR
en las partidas parciales anteriores.
4.4 Equipo de seguridad
(TXLSDPLHQWR GHVWLQDGR DO PDQWHQLPLHQWR
del orden público y a la seguridad en general.
4.5 Libros, revistas y otros elementos coleccionables
/D DGTXLVLFLyQ GH OLEURV UHYLVWDV PDSDV
SHOtFXODVFLQHPDWRJUi¿FDVLPSUHVDVYLGHRFDVVHWWHVLPSUHVRVGLVFRVIRQRHOpFWULFRVFDVVHWWHV
FRPSDFWGLVNV&'URPV\RWURVHOHPHQWRVGHVtinados a la formación de colecciones.
4.6 Obras de arte
&ROHFFLRQHV DUWtVWLFDV \ RUQDPHQWDOHV WDOHV
FRPRSLQWXUDVHVWDWXDVWDOODVDQWLJHGDGHVHWF
4.7 Semovientes
Ganado de diferentes especies y todo tipo de
DQLPDOHVDGTXLULGRVFRQ¿QHVGHUHSURGXFFLyQ
trabajo u ornamento.
4.8 Activos intangibles
$GTXLVLFLyQGHGHUHFKRVSRUHOXVRGHDFWLYRVGH
ODSURSLHGDGLQGXVWULDOFRPHUFLDOLQWHOHFWXDO\RWURV
3URJUDPDVGHFRPSXWDFLyQ
*DVWRV SRU SURJUDPDV UXWLQDV \ VX GRFXPHQWDFLyQ FRPSOHWD DVRFLDGD TXH SXHGHQ
ser implementados en un sistema computaFLRQDO VRIWZDUH 2WURVDFWLYRVLQWDQJLEOHV
2WURVDFWLYRVLQWDQJLEOHVQRLQFOXLGRVHQOD
partida parcial anterior.
4.9 Otros bienes de uso
2WURVELHQHVGHXVRQRHVSHFL¿FDGRVHQODV
partidas precedentes.
cios y cuyos importes no son reintegrados por
ORVEHQH¿FLDULRV
7UDQVIHUHQFLDVDOVHFWRUSULYDGRSDUD¿nanciar gastos corrientes
Subsidios para atender gastos corrientes a
IDYRUGHHQWLGDGHVVLQ¿QHVGHOXFURVRFLHGDGHV
\FRRSHUDWLYDV,QFOX\HEHFDVGHHVWXGLR\GHLQYHVWLJDFLyQJDVWRVQHFHVDULRVSDUDHOGHVDUUROOR
GHDFWLYLGDGHVSURIHVLRQDOHV\GHLQYHVWLJDFLyQ
y ayuda a personas de escasos recursos.
-XELODFLRQHV\RUHWLURV
Gastos destinados a la atención del pago de
MXELODFLRQHV\RUHWLURV
3HQVLRQHV
Gastos destinados a la atención del pago de
pensiones.
%HFDV\RWURVVXEVLGLRV
%HFDVDFRUGDGDVDHVWXGLDQWHV\RLQYHVWLJDGRUHV ,QFOX\H DVLPLVPR RWUDV WUDQVIHUHQFLDV D SHUVRQDV GH FDUiFWHU SHUPDQHQWH WDOHV FRPR ORV VXEVLGLRV YLWDOLFLRV RWRUJDGRV
GHDFXHUGRFRQODOHJLVODFLyQYLJHQWHDORV
JDQDGRUHVGHSUHPLRVDODODERUWHDWUDODOD
SURGXFFLyQOLWHUDULDSOiVWLFDPXVLFDOHWF
5.1.4 Ayudas sociales a personas
$X[LOLRVRD\XGDVHVSHFLDOHVTXHQRUHYLVWHQ
FDUiFWHU SHUPDQHQWH DFRUGDGRV D SHUVRQDV
,QFOX\HHOSDJRDEHQH¿FLDULRVGHSURJUDPDV
de promoción del empleo y capacitación laboral implementados por el Gobierno de la
Ciudad Autónoma de Buenos Aires.
7UDQVIHUHQFLDVDLQVWLWXFLRQHVGHHQVHñanza
Subsidios otorgados para la atención de gastos
corrientes de establecimientos de enseñanza.
7UDQVIHUHQFLDVSDUDDFWLYLGDGHVFLHQWt¿FDVRDFDGpPLFDV
*DVWRV GHVWLQDGRV DO GHVDUUROOR GH DFWLYLGDGHV FLHQWt¿FDV R DFDGpPLFDV ,QFOX\H ODV
WUDQVIHUHQFLDV GHVWLQDGDV D ¿QDQFLDU HURJD
FLRQHVFRUULHQWHVGHORVLQYHVWLJDGRUHV
7UDQVIHUHQFLDVDRWUDVLQVWLWXFLRQHVVLQ
¿QHVGHOXFUR
6XEVLGLRVGHVWLQDGRVDODX[LOLR\HVWtPXORGH
acciones de índole cultural y social realizadas
SRULQVWLWXFLRQHVGHFDUiFWHUSULYDGRVLQ¿QHV
de lucro. Comprende subsidios otorgados a
instituciones intermedias tales como asociaFLRQHV FRRSHUDGRUDV HVFRODUHV PXWXDOHV RUJDQLVPRVGHFRODERUDFLyQYHFLQDOHWF
7UDQVIHUHQFLDVDFRRSHUDWLYDV
5. Transferencias
Gastos destinados a la promoción del coopera*DVWRVTXHFRUUHVSRQGHQDWUDQVDFFLRQHVTXHQR
VXSRQHQ OD FRQWUDSUHVWDFLyQ GH ELHQHV R VHUYLWLYLVPR\DODX[LOLRGHHQWLGDGHVFRRSHUDWLYDV
8 - ANEXO 2 - Clasificador por objeto del gasto / 213
$LQVWLWXFLRQHVGHVHJXULGDGVRFLDOQD 7UDQVIHUHQFLDVDHPSUHVDVSULYDGDV
cionales
*DVWRVGHVWLQDGRVD¿QDQFLDUJDVWRVFRUULHQ 7UDQVIHUHQFLDV D LQVWLWXFLRQHV GH VHJXULGDG
WHVGHHPSUHVDVGHOVHFWRUSULYDGR
social nacionales otorgadas por organismos
7UDQVIHUHQFLDVDOVHFWRUSULYDGRSDUD¿del Gobierno de la Ciudad Autónoma de
nanciar gastos de capital
Buenos Aires.
Subsidios para atender erogaciones de capi $RWUDVLQVWLWXFLRQHVS~EOLFDVQDFLRQDOHV
WDO D IDYRU GH HQWLGDGHV VLQ ¿QHV GH OXFUR VRFLHGDGHV \ FRRSHUDWLYDV ,QFOX\H VXEYHQFLRQHV 7UDQVIHUHQFLDV D RWUDV LQVWLWXFLRQHV S~EOLcas nacionales otorgadas por organismos del
SDUD HTXLSDPLHQWR GH LQYHVWLJDFLyQ \ D\XGD D
Gobierno de la Ciudad Autónoma de Buenos
SHUVRQDVGHHVFDVRVUHFXUVRVSDUDODDGTXLVLFLyQ
Aires.
de bienes en general.
5.4 Transferencias al Sector Público Nacio 7UDQVIHUHQFLDVDSHUVRQDV
6XEVLGLRVDSHUVRQDVTXHWHQJDQSRUGHVWLQR QDOSDUD¿QDQFLDUJDVWRVGHFDSLWDO
Comprende las siguientes parciales:
¿QDQFLDUDGTXLVLFLRQHVGHHTXLSRVFRQVWUXF5.4.1 A la administración central nacional
ciones u otros bienes de capital.
7UDQVIHUHQFLDVDODDGPLQLVWUDFLyQFHQWUDOQD 7UDQVIHUHQFLDVDLQVWLWXFLRQHVGHHQVHcional otorgadas por organismos del Gobierno
ñanza
de la Ciudad Autónoma de Buenos Aires.
Subsidios a instituciones de enseñanza desWLQDGDV D VX LQVWDODFLyQ \ DO HTXLSDPLHQWR $LQVWLWXFLRQHVGHVFHQWUDOL]DGDVQDFLRnales
docente.
7UDQVIHUHQFLDVDLQVWLWXFLRQHVGHVFHQWUDOL]D 7UDQVIHUHQFLDVSDUDDFWLYLGDGHVFLHQWtdas nacionales otorgadas por organismos del
¿FDVRDFDGpPLFDV
Gobierno de la Ciudad Autónoma de Buenos
*DVWRVSDUDDWHQGHUHOHTXLSDPLHQWRQHFHVDAires.
ULRHQHOGHVDUUROORGHDFWLYLGDGHVSURIHVLR $LQVWLWXFLRQHVGHVHJXULGDGVRFLDOQDnales o académicas.
cionales
7UDQVIHUHQFLDVDRWUDVLQVWLWXFLRQHVVLQ
7UDQVIHUHQFLDV D LQVWLWXFLRQHV GH VHJXULGDG
¿QHVGHOXFUR
social nacionales otorgadas por organismos
6XEVLGLRV D RWUDV LQVWLWXFLRQHV VLQ ¿QHV GH
del Gobierno de la Ciudad Autónoma de
OXFUR GHVWLQDGRV D ¿QDQFLDU HURJDFLRQHV GH
Buenos Aires.
capital.
5.4.4 A otras instituciones públicas nacionales
7UDQVIHUHQFLDVDFRRSHUDWLYDV
6XEVLGLRV D FRRSHUDWLYDV TXH WHQJDQ SRU 7UDQVIHUHQFLDV D RWUDV LQVWLWXFLRQHV S~EOLcas nacionales otorgadas por organismos del
GHVWLQR ¿QDQFLDU OD DGTXLVLFLyQ GH HTXLSRV
Gobierno de la Ciudad Autónoma de Buenos
FRQVWUXFFLRQHV DX[LOLR SDUD LQYHUVLRQHV ¿Aires.
nancieras u otros gastos de capital.
5.5 Transferencias al Sector Público empre 7UDQVIHUHQFLDVDHPSUHVDVSULYDGDV
6XEVLGLRVDHPSUHVDVTXHWHQJDQSRUGHVWLQR sarial
7UDQVIHUHQFLDV D HPSUHVDV \ VRFLHGDGHV HV¿QDQFLDUODDGTXLVLFLyQGHHTXLSRVFRQVWUXFFLRQHVDX[LOLRSDUDLQYHUVLRQHV¿QDQFLHUDVX tatales
7UDQVIHUHQFLDVDLQVWLWXFLRQHVS~EOLFDV
otros gastos de capital de empresas del sector
¿QDQFLHUDVSDUD¿QDQFLDUJDVWRVFRUULHQWHV
SULYDGR
7UDQVIHUHQFLDV D LQVWLWXFLRQHV S~EOLFDV ¿5.3 Transferencias al Sector Público NacioQDOSDUD¿QDQFLDUJDVWRVFRUULHQWHV
nancieras nacionales para atender gastos coComprende las siguientes partidas parciales:
rrientes.
$ODDGPLQLVWUDFLyQFHQWUDOQDFLRQDO
7UDQVIHUHQFLDVDHPSUHVDVS~EOLFDVQR
7UDQVIHUHQFLDVDODDGPLQLVWUDFLyQFHQWUDOQD¿QDQFLHUDVSDUD¿QDQFLDUJDVWRVFRUULHQWHV
cional otorgadas por organismos del Gobierno
7UDQVIHUHQFLDVDHPSUHVDVS~EOLFDVQR¿QDQde la Ciudad Autónoma de Buenos Aires.
FLHUDVSDUDJDVWRVGHH[SORWDFLyQ
$LQVWLWXFLRQHVGHVFHQWUDOL]DGDVQDFLR 7UDQVIHUHQFLDV D HPSUHVDV S~EOLFDV
nales
PXOWLQDFLRQDOHV SDUD ¿QDQFLDU JDVWRV FR 7UDQVIHUHQFLDV D LQVWLWXFLRQHV GHVFHQWUDOL]DGDV
rrientes
nacionales otorgadas por organismos del Gobier 7UDQVIHUHQFLDVDHPSUHVDVS~EOLFDVPXOWLQDno de la Ciudad Autónoma de Buenos Aires.
FLRQDOHVSDUDJDVWRVGHH[SORWDFLyQ
214 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
Subsidios otorgados a otras instituciones pú 7UDQVIHUHQFLDVDLQVWLWXFLRQHVS~EOLFDV
EOLFDV SURYLQFLDOHV SDUD DWHQGHU VXV HURJD¿QDQFLHUDVSDUD¿QDQFLDUJDVWRVGHFDSLWDO
ciones corrientes.
7UDQVIHUHQFLDV D LQVWLWXFLRQHV S~EOLFDV ¿ 7UDQVIHUHQFLDVDJRELHUQRVPXQLFLSDOHV
nancieras nacionales para atender gastos de
Subsidios otorgados a las municipalidades
capital.
para atender sus erogaciones corrientes.
7UDQVIHUHQFLDV D HPSUHVDV S~EOLFDV
7UDQVIHUHQFLDVDLQVWLWXFLRQHVS~EOLFDV
no financieras para financiar gastos de ca¿QDQFLHUDVPXQLFLSDOHV
pital
6XEVLGLRVRWRUJDGRVDLQVWLWXFLRQHV¿QDQFLH 7UDQVIHUHQFLDVDHPSUHVDVS~EOLFDVQR¿QDQras municipales para atender sus erogaciones
cieras para atender gastos de capital.
corrientes.
7UDQVIHUHQFLDV D HPSUHVDV S~EOLFDV
7UDQVIHUHQFLDVDHPSUHVDVS~EOLFDVQR
PXOWLQDFLRQDOHVSDUD¿QDQFLDUJDVWRVGHFD¿QDQFLHUDVPXQLFLSDOHV
pital
Subsidios otorgados a empresas públicas no
7UDQVIHUHQFLDVDHPSUHVDVS~EOLFDVPXOWLQD¿QDQFLHUDVPXQLFLSDOHVSDUDDWHQGHUVXVHURcionales para atender gastos de capital.
gaciones corrientes.
5.6 Transferencias a universidades nacionales
7UDQVIHUHQFLDV D XQLYHUVLGDGHV QDFLRQDOHV 7UDQVIHUHQFLDVDRWUDVLQVWLWXFLRQHVS~blicas municipales
otorgadas por organismos del Gobierno de la
Subsidios otorgados a otras instituciones
Ciudad Autónoma de Buenos Aires. Incluye los
públicas municipales para atender sus erogaFRQYHQLRVGHSDVDQWtDV
ciones corrientes.
7UDQVIHUHQFLDV D XQLYHUVLGDGHV QDFLR5.8 Transferencias a instituciones provinciaQDOHVSDUD¿QDQFLDUJDVWRVFRUULHQWHV
7UDQVIHUHQFLDV RWRUJDGDV D XQLYHUVLGDGHV OHV \ PXQLFLSDOHV SDUD ¿QDQFLDU JDVWRV GH FDnacionales para atender sus erogaciones co- pital
Comprende las siguientes parciales:
rrientes.
7UDQVIHUHQFLDV D JRELHUQRV SURYLQ 7UDQVIHUHQFLDV D XQLYHUVLGDGHV QDFLRciales
QDOHVSDUD¿QDQFLDUJDVWRVGHFDSLWDO
7UDQVIHUHQFLDV RWRUJDGDV D XQLYHUVLGDGHV 6XEVLGLRV RWRUJDGRV D ODV SURYLQFLDV SDUD
atender sus erogaciones de capital.
nacionales para atender sus erogaciones de
7UDQVIHUHQFLDVDLQVWLWXFLRQHVS~EOLFDV
capital.
¿QDQFLHUDVSURYLQFLDOHV
5.7 Transferencias a instituciones provinciales
Subsidios otorgados a instituciones públicas
\PXQLFLSDOHVSDUD¿QDQFLDUJDVWRVFRUULHQWHV
¿QDQFLHUDVSURYLQFLDOHVSDUDDWHQGHUVXVHUR6XEVLGLRV GHVWLQDGRV D ORV HVWDGRV SURYLQgaciones de capital.
FLDOHV\PXQLFLSDOLGDGHVTXHWHQJDQSRUREMHWR
7UDQVIHUHQFLDVDHPSUHVDVS~EOLFDVQR
H[SUHVR¿QDQFLDUVXVHURJDFLRQHVFRUULHQWHV
¿QDQFLHUDVSURYLQFLDOHV
7UDQVIHUHQFLDVDJRELHUQRVSURYLQFLDOHV
Subsidios otorgados a empresas públicas no
6XEVLGLRV RWRUJDGRV D ODV SURYLQFLDV SDUD
¿QDQFLHUDVSURYLQFLDOHVSDUDDWHQGHUVXVHURatender sus erogaciones corrientes.
gaciones de capital.
7UDQVIHUHQFLDVDLQVWLWXFLRQHVS~EOLFDV
7UDQVIHUHQFLDVDHQWHVWULSDUWLWRV
¿QDQFLHUDVSURYLQFLDOHV
Subsidios otorgados a entes tripartitos para
Subsidios otorgados a instituciones públicas
atender sus erogaciones de capital.
¿QDQFLHUDVSURYLQFLDOHVSDUDDWHQGHUVXVHUR 7UDQVIHUHQFLDVDRWUDVLQVWLWXFLRQHVS~gaciones corrientes.
7UDQVIHUHQFLDVDHPSUHVDVS~EOLFDVQR
EOLFDVSURYLQFLDOHV
¿QDQFLHUDVSURYLQFLDOHV
Subsidios otorgados a otras instituciones púSubsidios otorgados a empresas públicas no
EOLFDV SURYLQFLDOHV SDUD DWHQGHU VXV HURJD¿QDQFLHUDVSURYLQFLDOHVSDUDDWHQGHUVXVHURciones de capital.
gaciones corrientes.
7UDQVIHUHQFLDV D JRELHUQRV PXQLFL 7UDQVIHUHQFLDVDHQWHVWULSDUWLWRV
pales
Subsidios otorgados a entes tripartitos para
Subsidios otorgados a las municipalidades
atender sus erogaciones corrientes.
para atender sus erogaciones de capital.
7UDQVIHUHQFLDVDRWUDVLQVWLWXFLRQHVS~ 7UDQVIHUHQFLDVDLQVWLWXFLRQHVS~EOLFDV
EOLFDVSURYLQFLDOHV
¿QDQFLHUDVPXQLFLSDOHV
8 - ANEXO 2 - Clasificador por objeto del gasto / 215
$SRUWHVGHFDSLWDODHPSUHVDVS~EOLFDVQR
Subsidios otorgados a instituciones públicas
¿QDQFLHUDV
¿QDQFLHUDVPXQLFLSDOHVSDUDDWHQGHUVXVHUR $GTXLVLFLyQGHDFFLRQHV\SDUWLFLSDFLRQHVGH
gaciones de capital.
FDSLWDOHQHPSUHVDVS~EOLFDVQR¿QDQFLHUDV
7UDQVIHUHQFLDVDHPSUHVDVS~EOLFDVQR
$SRUWHVGHFDSLWDODLQVWLWXFLRQHVS~EOL¿QDQFLHUDVPXQLFLSDOHV
FDV¿QDQFLHUDV
Subsidios otorgados a empresas públicas no
$GTXLVLFLyQGHDFFLRQHV\SDUWLFLSDFLRQHVGH
¿QDQFLHUDVPXQLFLSDOHVSDUDDWHQGHUVXVHURFDSLWDOHQLQVWLWXFLRQHVS~EOLFDV¿QDQFLHUDV
gaciones de capital.
6.1.4 Aportes de capital a organismos interna 7UDQVIHUHQFLDVDRWUDVLQVWLWXFLRQHVS~cionales
blicas municipales
Aportes de capital de carácter no reintegraSubsidios otorgados a otras instituciones
EOHTXHVHHIHFW~DQDRUJDQLVPRVLQWHUQDFLRpúblicas municipales para atender sus eroganales.
ciones de capital.
6.1.6 Aportes de capital a otras organizaciones
5.9 Transferencias al exterior
GHOVHFWRUH[WHUQR
*DVWRVTXHVHUHDOL]DQDIDYRUGHRUJDQLVPRV
Aportes de capital de carácter no reintegrainternacionales por concepto de cuotas regulares
EOH TXH VH HIHFW~DQ D RWUDV RUJDQL]DFLRQHV
\H[WUDRUGLQDULDVDWHQWRHOFDUiFWHUGHPLHPEUR
GHOVHFWRUH[WHUQR
Incluye erogaciones por becas de capacitación e
6.2 Préstamos a corto plazo
LQYHVWLJDFLyQ\D\XGDDSHUVRQDVHQHOH[WHULRU
Préstamos directos a corto plazo concedidos
7UDQVIHUHQFLDVDJRELHUQRVH[WUDQMHURV
DOVHFWRUS~EOLFR\DOVHFWRUSULYDGR\H[WHUQR
SDUD¿QDQFLDUJDVWRVFRUULHQWHV
7UDQVIHUHQFLDV TXH VH UHDOL]DQ D JRELHUQRV 3UpVWDPRVDFRUWRSOD]RDOVHFWRUSULYDGR
3UpVWDPRV GLUHFWRV D FRUWR SOD]R TXH VH OH
H[WUDQMHURV\TXHVHWUDGXFHQHQFHVLyQJUDFRQFHGHDOVHFWRUSULYDGR
WXLWD GH IRQGRV TXH WHQJDQ SRU GHVWLQR OD
3UpVWDPRVDFRUWRSOD]RDOVHFWRUS~EOLatención de gastos corrientes.
co nacional
7UDQVIHUHQFLDV D RUJDQLVPRV LQWHUQDPréstamos directos a corto plazo concedidos
FLRQDOHVSDUD¿QDQFLDUJDVWRVFRUULHQWHV
al sector público nacional: administración
*DVWRVTXHVHUHDOL]DQDIDYRUGHRUJDQLVPRV
FHQWUDOLQVWLWXFLRQHVGHVFHQWUDOL]DGDVLQVWLinternacionales por concepto de cuotas regutuciones de seguridad social y otras instituODUHV \ H[WUDRUGLQDULDV DWHQWR HO FDUiFWHU GH
ciones públicas nacionales.
miembro.
7UDQVIHUHQFLDVDJRELHUQRVH[WUDQMHURV 3UpVWDPRVDFRUWRSOD]RDSURYLQFLDV
Préstamos directos a corto plazo otorgados
SDUD¿QDQFLDUJDVWRVGHFDSLWDO
DSURYLQFLDVDGPLQLVWUDFLyQFHQWUDOSURYLQ 7UDQVIHUHQFLDV TXH VH UHDOL]DQ D JRELHUQRV
FLDO LQVWLWXFLRQHV GHVFHQWUDOL]DGDV LQVWLWXH[WUDQMHURV\TXHVHWUDGXFHQHQFHVLyQJUDciones de seguridad social y otras institucioWXLWD GH IRQGRV TXH WHQJDQ SRU GHVWLQR OD
QHVS~EOLFDVSURYLQFLDOHV
atención de gastos de capital.
3UpVWDPRVDFRUWRSOD]RDPXQLFLSDOL 7UDQVIHUHQFLDV D RUJDQLVPRV LQWHUQDdades
FLRQDOHVSDUD¿QDQFLDUJDVWRVGHFDSLWDO
Préstamos directos a corto plazo otorgados
*DVWRVTXHVHUHDOL]DQDIDYRUGHRUJDQLVPRV
D PXQLFLSDOLGDGHV DGPLQLVWUDFLyQ FHQWUDO
internacionales para atender sus gastos de
LQVWLWXFLRQHV GHVFHQWUDOL]DGDV LQVWLWXFLRQHV
capital.
de seguridad social y otras instituciones públicas municipales.
$FWLYRV¿QDQFLHURV
&RPSUHQGHORVVHUYLFLRVLQGLFDGRVHQODVSDUWL 3UpVWDPRVDFRUWRSOD]RDLQVWLWXFLRQHV
GDVSDUFLDOHVTXHVHGHWDOODQDFRQWLQXDFLyQ
S~EOLFDV¿QDQFLHUDV
6.1 Compra de acciones y participaciones de
Préstamos directos a corto plazo otorgados a
capital
LQVWLWXFLRQHVS~EOLFDV¿QDQFLHUDV
Comprende las siguientes parciales:
3UpVWDPRVDFRUWRSOD]RDHPSUHVDVS~$SRUWHV GH FDSLWDO D HPSUHVDV SULYDGDV
EOLFDVQR¿QDQFLHUDV
nacionales
Préstamos directos a corto plazo otorgados a
$GTXLVLFLyQ GH DFFLRQHV \ SDUWLFLSDFLRQHV GH
HPSUHVDV \ VRFLHGDGHV GHO HVWDGR QR ¿QDQFDSLWDOHQHPSUHVDVSULYDGDVQDFLRQDOHV
cieras.
216 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
3UpVWDPRVDFRUWRSOD]RDOVHFWRUH[WHUQR
Préstamos directos a corto plazo otorgados a
LQVWLWXFLRQHVGHOVHFWRUH[WHUQR
6.3 Préstamos a largo plazo
Préstamos directos a largo plazo concedidos
DOVHFWRUS~EOLFR\DORVVHFWRUHVSULYDGR\H[terno.
3UpVWDPRVDODUJRSOD]RDOVHFWRUSULYDGR
3UpVWDPRV GLUHFWRV D ODUJR SOD]R TXH VH OH
FRQFHGHQDOVHFWRUSULYDGR
3UpVWDPRVDODUJRSOD]RDOVHFWRUS~EOLco nacional
3UpVWDPRV GLUHFWRV D ODUJR SOD]R TXH VH OH
conceden al sector público nacional: admiQLVWUDFLyQ FHQWUDO LQVWLWXFLRQHV GHVFHQWUDOL]DGDV LQVWLWXFLRQHV GH VHJXULGDG VRFLDO \
otras instituciones públicas nacionales.
3UpVWDPRVDODUJRSOD]RDSURYLQFLDV
DGPLQLVWUDFLyQ FHQWUDO LQVWLWXFLRQHV GHVFHQWUDOL]DGDV LQVWLWXFLRQHV GH VHJXULGDG
VRFLDO\RWUDVLQVWLWXFLRQHVS~EOLFDVSURYLQciales.
3UpVWDPRVDODUJRSOD]RDPXQLFLSDOLdades
Préstamos directos a largo plazo concedidos
a las municipalidades: administración cenWUDO LQVWLWXFLRQHV GHVFHQWUDOL]DGDV LQVWLWXciones de seguridad social y otras instituciones públicas municipales.
3UpVWDPRVDODUJRSOD]RDLQVWLWXFLRQHV
S~EOLFDV¿QDQFLHUDV
Préstamos directos a largo plazo concedidos
DLQVWLWXFLRQHVS~EOLFDV¿QDQFLHUDV
3UpVWDPRVDODUJRSOD]RDHPSUHVDVS~EOLFDVQR¿QDQFLHUDV
Préstamos directos a largo plazo concedidos
DHPSUHVDV\VRFLHGDGHVGHOHVWDGRQR¿QDQcieras.
3UpVWDPRVDODUJRSOD]RDOVHFWRUH[WHUQR
Préstamos directos a largo plazo concedidos
DLQVWLWXFLRQHVGHOVHFWRUH[WHUQR
6.4 Títulos y valores
$GTXLVLFLyQGHWtWXORV\YDORUHVUHSUHVHQWDWLYRVGHGHXGDV
7tWXORV\YDORUHVDFRUWRSOD]R
$GTXLVLFLyQGHWtWXORV\YDORUHVDFRUWRSOD]R
7tWXORV\YDORUHVDODUJRSOD]R
$GTXLVLFLyQGHWtWXORV\YDORUHVDODUJRSOD]R
,QFUHPHQWRGHGLVSRQLELOLGDGHVVDOGR¿QDO
$VLJQDFLyQGHUHFXUVRVTXHLQFUHPHQWDQORV
VDOGRVGHFDMDEDQFRV\RWURVDFWLYRV¿QDQFLHURV
WHPSRUDULRVDO¿QDOGHOHMHUFLFLRFRQUHODFLyQDO
saldo inicial.
2WUDVLQYHUVLRQHV¿QDQFLHUDV
$VLJQDFLyQGHUHFXUVRVTXHLQFUHPHQWDQODV
LQYHUVLRQHV ¿QDQFLHUDV HQ WtWXORV GHSyVLWRV D
SOD]R¿MRGRFXPHQWRV¿QDQFLHURVHWFGXUDQWH
el ejercicio.
6.7 Incremento de cuentas a cobrar
$VLJQDFLyQ GH UHFXUVRV TXH SHUPLWHQ HO
incremento del saldo deudores durante el
HMHUFLFLR SRU DSOLFDFLyQ GH XQD SROtWLFD GHliberada.
,QFUHPHQWRGHFXHQWDVDFREUDUFRPHUciales a corto plazo
$VLJQDFLyQ GH UHFXUVRV TXH SHUPLWHQ HO LQcremento del saldo de las cuentas a cobrar
comerciales a corto plazo.
,QFUHPHQWRGHRWUDVFXHQWDVDFREUDUD
corto plazo
$VLJQDFLyQ GH UHFXUVRV TXH SHUPLWHQ HO LQcremento de otras cuentas a cobrar a corto
plazo.
,QFUHPHQWRGHFXHQWDVDFREUDUFRPHUciales a largo plazo
$VLJQDFLyQ GH UHFXUVRV TXH SHUPLWHQ HO LQcremento de las cuentas a cobrar comerciales
a largo plazo.
,QFUHPHQWRGHRWUDVFXHQWDVDFREUDUD
largo plazo
$VLJQDFLyQ GH UHFXUVRV TXH SHUPLWHQ HO LQcremento de otras cuentas a cobrar a largo
plazo. Incluye los gastos originados en la
FRQVWLWXFLyQ GH )RQGRV )LGXFLDULRV GH SURpiedad de Jurisdicciones y Entidades correspondientes a la Administración del Gobierno
de la Ciudad Autónoma.
6.8 Incremento de documentos a cobrar
$VLJQDFLyQGHUHFXUVRVTXHSHUPLWHQGXUDQWHHOHMHUFLFLRLQFUHPHQWDUHOVDOGRGHODFXHQWD
documentos a cobrar.
,QFUHPHQWR GH GRFXPHQWRV FRPHUFLDles a cobrar a corto plazo
$VLJQDFLyQGHUHFXUVRVTXHKDFHQSRVLEOHHO
incremento de la cuenta documentos a cobrar
comerciales a corto plazo.
,QFUHPHQWRGHRWURVGRFXPHQWRVDFRbrar a corto plazo
$VLJQDFLyQGHUHFXUVRVTXHKDFHQSRVLEOHHO
incremento de la cuenta de otros documentos
a cobrar a corto plazo en el ejercicio.
,QFUHPHQWR GH GRFXPHQWRV FRPHUFLDles a cobrar a largo plazo
$VLJQDFLyQGHUHFXUVRVTXHKDFHQSRVLEOHHO
incremento de la cuenta documentos a cobrar
comerciales a largo plazo.
8 - ANEXO 2 - Clasificador por objeto del gasto / 217
,QFUHPHQWRGHRWURVGRFXPHQWRVDFRbrar a largo plazo
$VLJQDFLyQ GH UHFXUVRV TXH LQFUHPHQWDQ OD
cuenta de otros documentos a cobrar a largo
plazo en el ejercicio.
6.9 Incremento de activos diferidos y adelantos a proveedores y contratistas
*DVWRVHQFRQFHSWRGHDQWLFLSRV¿QDQFLHURV
\DFWLYRVGLIHULGRVTXHVHRWRUJDQDORVSURYHHdores y contratistas del sector público.
,QFUHPHQWRGHDFWLYRVGLIHULGRVDFRUWR
plazo
*DVWRVHQFRQFHSWRGHDFWLYRVGLIHULGRVRWRUJDGRVSDUD¿QDQFLDURSHUDFLRQHVLPSXWDEOHV
HQHOFRUWRSOD]R JDVWRVSDJDGRVSRUDGHODQWDGR $GHODQWRVDSURYHHGRUHV\FRQWUDWLVWDV
a corto plazo
Gastos destinados a la atención de adelantos
D SURYHHGRUHV \ FRQWUDWLVWDV GHULYDGRV GH
compromisos asumidos por el Estado en el
corto plazo.
,QFUHPHQWRVGHDFWLYRVGLIHULGRVDODUgo plazo
*DVWRV HQ FRQFHSWR GH DFWLYRV GLIHULGRV
RWRUJDGRV SDUD ¿QDQFLDU RSHUDFLRQHV FRQ
SURYHHGRUHV\FRQWUDWLVWDVHQHOODUJRSOD]R
$GHODQWRVDSURYHHGRUHV\FRQWUDWLVWDV
a largo plazo
Gastos destinados a la atención de adelantos
D SURYHHGRUHV \ FRQWUDWLVWDV GHULYDGRV GH
compromisos asumidos por el Estado en el
largo plazo.
Gastos destinados a atender la amortización
del capital de la deuda pública interna a corto
plazo de los organismos públicos.
&RPLVLRQHV\RWURVJDVWRVGHODGHXGD
interna a corto plazo
Gastos destinados a atender el pago de las
comisiones y otros gastos originados en la
deuda pública interna a corto plazo.
,QWHUHVHV GH OD GHXGD LQWHUQD D ODUJR
plazo
Gastos destinados a atender los intereses de
la deuda pública interna a largo plazo de los
organismos públicos.
$PRUWL]DFLyQGHODGHXGDLQWHUQDDODUgo plazo
Gastos destinados a atender la amortización
del capital de la deuda pública interna a largo
plazo de los organismos públicos.
&RPLVLRQHV\RWURVJDVWRVGHODGHXGD
interna a largo plazo
Gastos destinados a atender el pago de las
comisiones y otros gastos originados en la
deuda interna a largo plazo.
7.2 Servicio de la deuda externa
Gastos destinados a atender el pago por inteUHVHVDPRUWL]DFLRQHV\RWURVJDVWRVGHODGHXGD
H[WHUQD GH RUJDQLVPRV GHO VHFWRU S~EOLFR UHSUHVHQWDGDSRUHPSUpVWLWRVWtWXORVERQRVHWF
emitidos de acuerdo con normas emanadas del
3RGHU/HJLVODWLYR
,QWHUHVHV GH OD GHXGD H[WHUQD D FRUWR
plazo
Gastos destinados a atender el pago de los
LQWHUHVHVGHODGHXGDS~EOLFDH[WHUQDDFRUWR
plazo de los organismos públicos.
7. Servicio de la deuda y disminución de otros
$PRUWL]DFLyQ GH OD GHXGD H[WHUQD D
pasivos
corto plazo
*DVWRVGHVWLQDGRVDFXEULUHOVHUYLFLRGHODGHXGastos destinados a atender la amortización
GDS~EOLFD\GLVPLQXFLyQGHRWURVSDVLYRVFRQGHOFDSLWDOGHODGHXGDS~EOLFDH[WHUQDDFRUtraídos por el sector público.
to plazo de los organismos públicos.
7.1 Servicio de la deuda interna
&RPLVLRQHV\RWURVJDVWRVGHODGHXGD
Gastos destinados a atender el pago por inteH[WHUQDDFRUWRSOD]R
UHVHVDPRUWL]DFLRQHV\RWURVJDVWRVGHODGHXGD
Gastos destinados a atender el pago de las
LQWHUQD GH RUJDQLVPRV GHO VHFWRU S~EOLFR UHcomisiones y otros gastos originados en la
SUHVHQWDGDSRUHPSUpVWLWRVWtWXORVERQRVHWF
GHXGD S~EOLFD H[WHUQD D FRUWR SOD]R GH ORV
emitidos de acuerdo con normas emanadas del
organismos públicos.
3RGHU/HJLVODWLYR
,QWHUHVHV GH OD GHXGD LQWHUQD D FRUWR ,QWHUHVHV GH OD GHXGD H[WHUQD D ODUJR
plazo
plazo
Gastos destinados a atender el pago de los
Gastos destinados a atender los intereses de
LQWHUHVHVGHODGHXGDS~EOLFDH[WHUQDDODUJR
la deuda pública interna a corto plazo de los
plazo de los organismos públicos.
organismos públicos.
$PRUWL]DFLyQGHODGHXGDH[WHUQDDODU $PRUWL]DFLyQGHODGHXGDLQWHUQDDFRUgo plazo
to plazo
218 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
7.4 Disminución de préstamos a corto plazo
Gastos destinados a atender la amortización
*DVWRV GHVWLQDGRV D DWHQGHU OD FDQFHODFLyQ
GHOFDSLWDOGHODGHXGDS~EOLFDH[WHUQDDODUWRWDORSDUFLDOGHORVSUpVWDPRVDFRUWRSOD]R
go plazo de los organismos públicos.
&RPLVLRQHV\RWURVJDVWRVGHODGHXGD 3UpVWDPRVUHFLELGRVGHOVHFWRUSULYDGR
Gastos destinados a atender el pago de la
H[WHUQDDODUJRSOD]R
amortización de los préstamos del sector priGastos destinados a atender el pago de las
YDGR
comisiones y otros gastos originados en la
GHXGD S~EOLFD H[WHUQD D ODUJR SOD]R GH ORV 3UpVWDPRVUHFLELGRVGHOVHFWRUS~EOLFR
nacional
organismos públicos.
Gastos destinados a atender el pago de la
7.3 Intereses por préstamos recibidos
amortización de los préstamos del sector púGastos destinados a atender el pago de los inEOLFRQDFLRQDOGHODDGPLQLVWUDFLyQFHQWUDO
tereses de los préstamos de corto y largo plazo.
GHLQVWLWXFLRQHVGHVFHQWUDOL]DGDVGHLQVWLWX ,QWHUHVHVSRUSUpVWDPRVGHOVHFWRUSULciones de seguridad social y de otras instituYDGR
ciones públicas nacionales.
Gastos destinados a atender el pago de los
3UpVWDPRVUHFLELGRVGHSURYLQFLDV
intereses por préstamos recibidos del sector
Gastos destinados a atender el pago de la
SULYDGR
amortización de los préstamos de las pro ,QWHUHVHVSRUSUpVWDPRVGHOVHFWRUS~YLQFLDVGHODDGPLQLVWUDFLyQFHQWUDOGHLQVblico nacional
WLWXFLRQHV GHVFHQWUDOL]DGDV GH LQVWLWXFLRQHV
Gastos destinados a atender el pago de los
de seguridad social y de otras instituciones
intereses por préstamos recibidos del sector
S~EOLFDVSURYLQFLDOHV
S~EOLFR QDFLRQDO DGPLQLVWUDFLyQ FHQWUDO
LQVWLWXFLRQHV GHVFHQWUDOL]DGDV LQVWLWXFLRQHV 3UpVWDPRVUHFLELGRVGHPXQLFLSDOLGDGHV
Gastos destinados a atender el pago de la
de seguridad social y otras instituciones púamortización de los préstamos de las muniblicas nacionales.
FLSDOLGDGHVGHODDGPLQLVWUDFLyQFHQWUDOGH
,QWHUHVHVGHSUpVWDPRVGHSURYLQFLDV
LQVWLWXFLRQHVGHVFHQWUDOL]DGDVGHLQVWLWXFLRGastos destinados a atender el pago de los innes de seguridad social y de otras institucioWHUHVHVSRUSUpVWDPRVUHFLELGRVGHODVSURYLQnes públicas municipales.
FLDVDGPLQLVWUDFLyQFHQWUDOLQVWLWXFLRQHVGHVFHQWUDOL]DGDVLQVWLWXFLRQHVGHVHJXULGDGVRFLDO 3UpVWDPRV UHFLELGRV GH HPSUHVDV S~EOLFDVQR¿QDQFLHUDV
\RWUDVLQVWLWXFLRQHVS~EOLFDVSURYLQFLDOHV
Gastos destinados a atender el pago de la
,QWHUHVHVGHSUpVWDPRVGHPXQLFLSDOLamortización de préstamos de empresas púdades
EOLFDVQR¿QDQFLHUDV
Gastos destinados a atender el pago de los
3UpVWDPRV UHFLELGRV GH LQVWLWXFLRQHV
intereses por préstamos recibidos de las muS~EOLFDV¿QDQFLHUDV
QLFLSDOLGDGHV GH OD DGPLQLVWUDFLyQ FHQWUDO
Gastos destinados a atender el pago de la
GHLQVWLWXFLRQHVGHVFHQWUDOL]DGDVGHLQVWLWXamortización de préstamos de instituciones
ciones de seguridad social y de otras instituS~EOLFDV¿QDQFLHUDV
ciones públicas municipales.
3UpVWDPRVUHFLELGRVGHOVHFWRUH[WHUQR
,QWHUHVHVGHSUpVWDPRVGHHPSUHVDVS~Gastos destinados a atender el pago de la
EOLFDVQR¿QDQFLHUDV
amortización de los préstamos otorgados por
Gastos destinados a atender el pago de los
HOVHFWRUH[WHUQR
intereses por préstamos recibidos de las em7.5 Disminución de préstamos a largo plazo
SUHVDVS~EOLFDVQR¿QDQFLHUDV
Gastos destinados a atender la cancela ,QWHUHVHVGHSUpVWDPRVGHLQVWLWXFLRQHV
FLyQWRWDORSDUFLDOGHORVSUpVWDPRVDODUJR
S~EOLFDV¿QDQFLHUDV
Gastos destinados a atender el pago de los plazo.
3UpVWDPRVUHFLELGRVGHOVHFWRUSULYDGR
intereses por préstamos recibidos de instituGastos destinados a atender el pago de la
FLRQHVS~EOLFDV¿QDQFLHUDV
amortización de los préstamos del sector pri ,QWHUHVHVGHSUpVWDPRVGHOVHFWRUH[WHUQR
YDGR
Gastos destinados a atender el pago de los
3UpVWDPRVUHFLELGRVGHOVHFWRUS~EOLFR
intereses por préstamos recibidos del sector
nacional
H[WHUQR
8 - ANEXO 2 - Clasificador por objeto del gasto / 219
Gastos destinados a atender el pago de la
amortización de los préstamos del sector púEOLFRQDFLRQDOGHODDGPLQLVWUDFLyQFHQWUDO
GHLQVWLWXFLRQHVGHVFHQWUDOL]DGDVGHLQVWLWXciones de seguridad social y de otras instituciones públicas nacionales.
3UpVWDPRVUHFLELGRVGHSURYLQFLDV
Gastos destinados a atender el pago de la
amortización de los préstamos de las proYLQFLDVGHODDGPLQLVWUDFLyQFHQWUDOGHLQVWLWXFLRQHV GHVFHQWUDOL]DGDV GH LQVWLWXFLRQHV
de seguridad social y de otras instituciones
S~EOLFDVSURYLQFLDOHV
3UpVWDPRVUHFLELGRVGHPXQLFLSDOLGDGHV
Gastos destinados a atender el pago de la
amortización de los préstamos de las muniFLSDOLGDGHVGHODDGPLQLVWUDFLyQFHQWUDOGH
LQVWLWXFLRQHVGHVFHQWUDOL]DGDVGHLQVWLWXFLRnes de seguridad social y de otras instituciones públicas municipales.
3UpVWDPRV UHFLELGRV GH HPSUHVDV S~EOLFDVQR¿QDQFLHUDV
Gastos destinados a atender el pago de la
amortización de préstamos de empresas púEOLFDVQR¿QDQFLHUDV
3UpVWDPRV UHFLELGRV GH LQVWLWXFLRQHV
S~EOLFDV¿QDQFLHUDV
Gastos destinados a atender el pago de la
amortización de préstamos recibidos de insWLWXFLRQHVS~EOLFDV¿QDQFLHUDV
3UpVWDPRVUHFLELGRVGHOVHFWRUH[WHUQR
Gastos destinados a atender el pago de la
amortización de préstamos otorgados por el
VHFWRUH[WHUQR
7.6 Disminución de cuentas y documentos a pagar
$VLJQDFLyQGHUHFXUVRVTXHSHUPLWHQGLVPLnuir las cuentas y documentos a pagar de los organismos públicos durante el ejercicio.
'LVPLQXFLyQGHFXHQWDVDSDJDUFRPHUciales a corto plazo
$VLJQDFLyQGHUHFXUVRVTXHSHUPLWHQGLVPLnuir las cuentas a pagar a corto plazo originadas por deudas comerciales.
'LVPLQXFLyQGHRWUDVFXHQWDVDSDJDUD
corto plazo
$VLJQDFLyQGHUHFXUVRVTXHSHUPLWHQGLVPLQXLU ODV FXHQWDV D SDJDU QR FRPHUFLDOHV D
corto plazo.
'LVPLQXFLyQ GH GRFXPHQWRV D SDJDU
comerciales a corto plazo
$VLJQDFLyQGHUHFXUVRVTXHSHUPLWHQGLVPLnuir los documentos a pagar a corto plazo
originados en operaciones comerciales.
'LVPLQXFLyQ GH RWURV GRFXPHQWRV D
pagar a corto plazo
$VLJQDFLyQGHUHFXUVRVTXHSHUPLWHQGLVPLQXLUORVGRFXPHQWRVDSDJDUQRFRPHUFLDOHV
a corto plazo.
'LVPLQXFLyQGHFXHQWDVDSDJDUFRPHUciales a largo plazo
$VLJQDFLyQGHUHFXUVRVTXHSHUPLWHQGLVPLnuir las cuentas a pagar a largo plazo originadas por deudas comerciales.
'LVPLQXFLyQGHRWUDVFXHQWDVDSDJDUD
largo plazo
$VLJQDFLyQGHUHFXUVRVTXHSHUPLWHQGLVPLQXLU ODV FXHQWDV D SDJDU QR FRPHUFLDOHV D
largo plazo.
'LVPLQXFLyQ GH GRFXPHQWRV D SDJDU
comerciales a largo plazo
$VLJQDFLyQGHUHFXUVRVTXHSHUPLWHQGLVPLnuir los documentos a pagar a largo plazo
originados por deudas comerciales.
'LVPLQXFLyQ GH RWURV GRFXPHQWRV D
pagar a largo plazo
$VLJQDFLyQGHUHFXUVRVTXHSHUPLWHQGLVPLQXLUORVGRFXPHQWRVDSDJDUQRFRPHUFLDOHV
a largo plazo.
7.7 Disminución de depósitos en institucioQHVS~EOLFDV¿QDQFLHUDV
&RPSUHQGH ORV VHUYLFLRV LQGLFDGRV HQ ODV
SDUWLGDV SDUFLDOHV TXH VH GHWDOODQ D FRQWLQXDción:
'LVPLQXFLyQGHGHSyVLWRVDODYLVWD
$VLJQDFLyQGHUHFXUVRVTXHSHUPLWHQODGLVPLQXFLyQGHODFXHQWDGHSyVLWRVDODYLVWDGH
ODVLQVWLWXFLRQHVS~EOLFDV¿QDQFLHUDVGXUDQte el ejercicio.
'LVPLQXFLyQGHGHSyVLWRVHQDKRUUR\D
SOD]R¿MR
$VLJQDFLyQ GH UHFXUVRV TXH SHUPLWHQ OD
disminución de las cuentas de depósitos en
caja de ahorros y a plazo fijo de las insWLWXFLRQHV S~EOLFDV ILQDQFLHUDV GXUDQWH HO
ejercicio.
7.8 Disminución de otros pasivos
$VLJQDFLyQGHUHFXUVRVTXHSHUPLWHQODGLVPLQXFLyQ GH SDVLYRV GLIHULGRV D FRUWR \ ODUJR
SOD]R GH ORV RUJDQLVPRV S~EOLFRV GXUDQWH HO
HMHUFLFLR SRU HMHPSOR UHFXUVRV UHFLELGRV SRU
DGHODQWDGR 'LVPLQXFLyQ GH SDVLYRV GLIHULGRV D
corto plazo
$VLJQDFLyQGHUHFXUVRVTXHSHUPLWHQODGLVPLQXFLyQGHODVFXHQWDVSDVLYRVGLIHULGRVD
FRUWRSOD]RGXUDQWHHOHMHUFLFLR
220 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
'LVPLQXFLyQGHSUHYLVLRQHVSDUDFXHQtas incobrables
$VLJQDFLyQGHUHFXUVRVTXHSHUPLWHQODGLVPLQXFLyQGHODVSUHYLVLRQHVSDUDFXHQWDVLQFREUDEOHVGXUDQWHHOHMHUFLFLR
'LVPLQXFLyQGHSUHYLVLRQHVSDUDDXWRseguro.
$VLJQDFLyQGHUHFXUVRVTXHSHUPLWHQODGLVPLQXFLyQGHODVSUHYLVLRQHVSDUDDXWRVHJXUR
durante el ejercicio.
'LVPLQXFLyQGHSURYLVLRQHV
$VLJQDFLyQGHUHFXUVRVTXHSHUPLWHQODGLVPLQXFLyQGHSURYLVLRQHV
'LVPLQXFLyQGHUHVHUYDVWpFQLFDV
$VLJQDFLyQGHUHFXUVRVTXHSHUPLWHQODGLVPLQXFLyQGHUHVHUYDVWpFQLFDV
'LVPLQXFLyQGHSDVLYRVGLIHULGRVDODUgo plazo
$VLJQDFLyQGHUHFXUVRVTXHSHUPLWHQODGLVPLQXFLyQGHODFXHQWDSDVLYRVGLIHULGRVDODUJRSOD]RGXUDQWHHOHMHUFLFLR
7.9 Conversión de la deuda y otros gastos
por deuda pública
5HFXUVRVTXHVHDFXHUGDQDORVRUJDQLVPRV
S~EOLFRVTXHSHUPLWHQODFRQYHUVLyQGHODGHXGD
GHODUJRSOD]RHQFRUWRSOD]R,QFOX\HDVLPLVPR
otros gastos por deuda pública no contemplados
en las demás partidas principales de este inciso.
&RQYHUVLyQGHODGHXGDLQWHUQDDODUJR
plazo en deuda interna a corto plazo
5HFXUVRVTXHVHDFXHUGDQDORVRUJDQLVPRV
S~EOLFRV TXH SHUPLWHQ OD FRQYHUVLyQ GH OD
deuda interna de largo plazo en corto plazo.
&RQYHUVLyQGHODGHXGDH[WHUQDDODUJR
SOD]RHQGHXGDH[WHUQDDFRUWRSOD]R
5HFXUVRVTXHVHDFXHUGDQDORVRUJDQLVPRV
S~EOLFRV TXH SHUPLWHQ OD FRQYHUVLyQ GH OD
GHXGDH[WHUQDGHODUJRSOD]RHQFRUWRSOD]R
&RQYHUVLyQGHSUpVWDPRVLQWHUQRVDODUgo plazo en préstamos internos a corto plazo
5HFXUVRVTXHVHDFXHUGDQDORVRUJDQLVPRV
S~EOLFRVTXHSHUPLWHQGLVPLQXLUORVSUpVWDPRV LQWHUQRV D ODUJR SOD]R FRQYLUWLpQGRORV
en préstamos internos a corto plazo.
&RQYHUVLyQGHSUpVWDPRVH[WHUQRVDODUJRSOD]RHQSUpVWDPRVH[WHUQRVDFRUWRSOD]R
5HFXUVRVTXHVHDFXHUGDQDORVRUJDQLVPRV
S~EOLFRVTXHSHUPLWHQGLVPLQXLUORVSUpVWDPRV H[WHUQRV D ODUJR SOD]R FRQYLUWLpQGRORV
HQSUpVWDPRVH[WHUQRVDFRUWRSOD]R
2WURVJDVWRVSRUGHXGDS~EOLFD
Otros gastos por deuda pública no incluidos
HQRWUDVSDUWLGDVSDUFLDOHVGHOLQFLVR³6HU-
YLFLRGHODGHXGD\GLVPLQXFLyQGHRWURVSDVLYRV´
2WURVJDVWRV
Partidas de gastos para el Sector Público no incluiGDVHQODVSDUWLGDVDQWHULRUHV/RVFRQFHSWRVTXH
se incluyen no necesariamente originan egresos
¿QDQFLHURV SHUR HQ WRGRV ORV FDVRV UHSUHVHQWDQ
JDVWRV R FRVWRV GH ODV MXULVGLFFLRQHV HQWLGDGHV
HPSUHVDVRLQVWLWXFLRQHVS~EOLFDV¿QDQFLHUDV
,QWHUHVHVGHLQVWLWXFLRQHVS~EOLFDV¿QDQcieras
Comprende el pago de intereses por parte de
ODVLQVWLWXFLRQHVS~EOLFDV¿QDQFLHUDV
8.2 Depreciación y amortización
Cuotas de depreciación anual de los bienes del
DFWLYR¿MRDVtFRPRORVFDUJRVSRUDPRUWL]DFLyQ
GHORVDFWLYRVLQWDQJLEOHVTXHFRUUHVSRQGDQ
'HSUHFLDFLyQGHODFWLYR¿MR
&XRWDVGHGHSUHFLDFLyQDQXDOTXHFRUUHVSRQGHQSRUHOXVRGHORVELHQHVGHODFWLYR¿MR
$PRUWL]DFLyQGHODFWLYRLQWDQJLEOH
$PRUWL]DFLyQ DQXDO TXH FRUUHVSRQGH SRU HO
DFWLYRLQWDQJLEOHGHODHQWLGDG
'HVFXHQWRV\ERQL¿FDFLRQHV
Representan apropiaciones para atender las
WUDQVDFFLRQHV TXH UHDOL]DQ ODV LQVWLWXFLRQHV HQ
FRQFHSWR GH GHVFXHQWRV \ ERQL¿FDFLRQHV TXH
VHHIHFW~DQSRUODYHQWDGHELHQHV\RVHUYLFLRV
producidos.
'HVFXHQWRVSRUYHQWDV
$SURSLDFLRQHVTXHDQXDOPHQWHUHDOL]DQODVLQVWLWXFLRQHVSDUDDWHQGHUORVGHVFXHQWRVSRUYHQWDV
DOFRQWDGRRFUpGLWRTXHRFXUUHQHQHOHMHUFLFLR
%RQL¿FDFLRQHVSRUYHQWDV
$SURSLDFLRQHV HQ FRQFHSWR GH ERQL¿FDFLRQHV HQ YHQWDV TXH UHDOL]DQ ODV HQWLGDGHV HQ
sus operaciones comerciales.
8.4 Otras pérdidas
5HSUHVHQWDQ SpUGLGDV DQXDOHV HQ TXH SXHGHQ
incurrir los organismos del Sector Público de la
&LXGDG$XWyQRPDGH%XHQRV$LUHVHQWUHRWUDVSpUGLGDVSRURSHUDFLRQHVFDPELDULDVSRULQYHQWDULRV
DXWRVHJXURUHVHUYDVWpFQLFDVSULPDVGHHPLVLyQ
&XHQWDVLQFREUDEOHV
&XRWDV¿MDVGHWHUPLQDGDVDQXDOPHQWHVREUH
ORVVDOGRVGHORVGHXGRUHVFRQHO¿QGHFRQVWLWXLU XQD SUHYLVLyQ TXH SHUPLWD FRPSHQVDU
ODVSpUGLGDVSRUODVFXHQWDVTXHVHFRQVLGHUDQ
LUUHFXSHUDEOHVHQHOPRPHQWRTXHVHSUHVHQten. Pueden usarse también sin constitución
GHODSUHYLVLyQ\GHELWDUVHGLUHFWDPHQWHFRQ
cargo a deudores.
8 - ANEXO 2 - Clasificador por objeto del gasto / 221
3pUGLGDGHLQYHQWDULRV
Gastos ocasionados por la baja de bienes inYHQWDULDGRV FRQ PRWLYR GH VX SpUGLGD GHVWUXFFLyQURERHWF
$XWRVHJXUR
&XRWD ¿MD DQXDO TXH DSURSLDQ ODV HQWLGDGHV
para hacer frente a contingencias de carácter
económico.
3pUGLGDHQRSHUDFLRQHVFDPELDULDV
&RQVWLWX\HQ ORV PRQWRV DQXDOHV TXH ORV RUganismos apropian por concepto de pérdida
HQ RSHUDFLRQHV TXH UHDOL]DQ HQ PRQHGD H[tranjera.
3pUGLGDHQYHQWDGHDFWLYRV
Comprende los montos anuales por pérdidas
HQODYHQWDGHDFWLYRV¿MRVLQWDQJLEOHVYDORUHVTXHQRRWRUJDQSURSLHGDGWtWXORVDFFLRQHV
etc. La pérdida corresponde a la diferencia enWUH HO SUHFLR GH YHQWD \ HO YDORU FRQWDEOH GHO
DFWLYR6HH[FHSW~DQORVSURGXFWRVWHUPLQDGRV
\ODVPDWHULDVSULPDVYLQFXODGDVFRQODVRSHUDciones industriales o comerciales del ente.
2WUDVSpUGLGDVGHRSHUDFLyQ
5HFXUVRVTXHVHDSURSLDQSDUDDWHQGHUSpUGLdas de operación de las entidades.
2WUDVSpUGLGDVDMHQDVDODRSHUDFLyQ
5HFXUVRVTXHVHDSURSLDQSDUDDWHQGHURWUDV
pérdidas de los organismos del Sector PúbliFRGHOD&LXGDG$XWyQRPDGH%XHQRV$LUHV
FRQH[FOXVLyQGHODVGHRSHUDFLyQ
5HVHUYDVWpFQLFDV
5HFXUVRV TXH VH DSURSLDQ SDUD OD FRQVWLWXFLyQGHUHVHUYDVWpFQLFDVHVWLPDGDVVREUHOD
base de cálculos actuariales.
3ULPDVGHHPLVLyQGHYDORUHVS~EOLFRV
Apropiaciones en concepto de primas de emiVLyQHQODFRORFDFLyQGHYDORUHVS~EOLFRV
8.5 Disminución del patrimonio
&RPSUHQGH ORV LPSRUWHV TXH UHVXOWHQ GH
RSHUDFLRQHV TXH VLJQL¿TXHQ UHGXFFLRQHV HQ HO
FDSLWDO ODV UHVHUYDV R ORV UHVXOWDGRV GH HMHUFLcios anteriores.
'LVPLQXFLyQGHOFDSLWDO
$SURSLDFLyQDQXDOTXHVHUHDOL]DSDUDDWHQGHU OD GLVPLQXFLyQ TXH SXHGD RFXUULU HQ HO
capital de la entidad.
'LVPLQXFLyQGHODVUHVHUYDV
*DVWRVTXHVHUHDOL]DQSDUDDWHQGHUODGLVPLQXFLyQGHODVUHVHUYDVTXHVHSURGXFHQHQXQ
ejercicio determinado.
'LVPLQXFLyQGHORVUHVXOWDGRVDFXPXODGRV
$VLJQDFLRQHVSUHYLVWDVSDUDDWHQGHUODGLVPL-
QXFLyQGHOUHVXOWDGRGHOHMHUFLFLRFRPRFRQsecuencia de la distribución del mismo por el
yUJDQRGHGLUHFFLyQPi[LPDGHODLQVWLWXFLyQ
8.6 Crédito adicional
Asignación de recursos para el refuerzo de créditos destinados a atender erogaciones corrientes o
GHFDSLWDOGHQWURGHOPDUFRGHODVDXWRUL]DFLRQHV
FRQWHQLGDVHQHODUWtFXORGHOD/H\1ƒ
&UpGLWRDGLFLRQDOSDUDHURJDFLRQHVFRrrientes
&UpGLWRJOREDOGHUHIXHU]RSDUD¿QDQFLDUHURgaciones corrientes.
&UpGLWRDGLFLRQDOSDUDHURJDFLRQHVGH
capital
&UpGLWRJOREDOGHUHIXHU]RSDUD¿QDQFLDUHURgaciones de capital.
*DVWRV¿JXUDWLYRV
&RQWULEXFLRQHVGHODDGPLQLVWUDFLyQFHQWUDOGH
organismos descentralizados y de entidades de
VHJXULGDG VRFLDO GHVWLQDGDV D LQWHJUDU HO ¿QDQFLDPLHQWRGHODDGPLQLVWUDFLyQFHQWUDORUJDQLVPRV GHVFHQWUDOL]DGRV LQVWLWXFLRQHV GH VHJXULGDG VRFLDO \ HQWHV DXWiUTXLFRV FX\DV HURJDFLRQHV ¿JXUDQ WDPELpQ HQ HO 3UHVXSXHVWR *HQHUDO
de la Administración del Gobierno de la Ciudad
Autónoma de Buenos Aires. No incluye las conWULEXFLRQHVDRUJDQLVPRVHPSUHVDVRHQWLGDGHV
cuyos presupuestos no son parte integrante de
dicho Presupuesto.
*DVWRV¿JXUDWLYRVGHODDGPLQLVWUDFLyQ
gubernamental para transacciones corrientes
Contribuciones destinadas a integrar el
ILQDQFLDPLHQWR GH OD DGPLQLVWUDFLyQ FHQWUDO
RUJDQLVPRV GHVFHQWUDOL]DGRV LQVWLWXFLRQHV
GH VHJXULGDG VRFLDO \ HQWHV DXWiUTXLFRV TXH
se afectarán a la atención de erogaciones corrientes.
*DVWRV¿JXUDWLYRVGHODDGPLQLVWUDFLyQ
gubernamental para transacciones de capital
&RQWULEXFLRQHV GHVWLQDGDV D LQWHJUDU HO ¿QDQFLDPLHQWRGHODDGPLQLVWUDFLyQFHQWUDORUJDQLVPRVGHVFHQWUDOL]DGRVLQVWLWXFLRQHVGHVHJXULGDGVRFLDO\HQWHVDXWiUTXLFRVTXHVHDIHFWDUiQ
a la atención de erogaciones de capital.
*DVWRV¿JXUDWLYRVGHODDGPLQLVWUDFLyQ
JXEHUQDPHQWDOSDUDDSOLFDFLRQHV¿QDQFLHUDV
&RQWULEXFLRQHV GHVWLQDGDV D LQWHJUDU HO ¿QDQFLDPLHQWR GH OD DGPLQLVWUDFLyQ FHQWUDO RUganismos descentralizados e instituciones de
VHJXULGDG VRFLDO TXH VH DIHFWDUiQ D OD DWHQFLyQ
GHDSOLFDFLRQHV¿QDQFLHUDV
9
GESTIÓN JURÍDICO LEGAL EN
ORGANIZACIONES DE ATENCIÓN DE LA SALUD
Jaime A. de la Parra
Médico Neurocirujano. Médico Legista
Gabriela Talone
Médica Clínica. Medica Neuróloga Universitaria
INTRODUCCIÓN. GENERALIDADES DE LOS ASPECTOS
LEGALES EN INSTITUCIONES DE SALUD. LOS
IMPERATIVOS ÉTICOS
Encarar el tema de la responsabilidad jurídica
de las instituciones de salud implica incursionar
GHQWUR GHO YDVWR WHUUHQR GHO HMHUFLFLR SURIHVLRQDOVXVPDUFRVQRUPDWLYRVHOHQFXDGUHMXUtGLFRVHDGHODVDFFLRQHVLQGLYLGXDOHVFRPRGHODV
LQVWLWXFLRQHVGRQGHORSURIHVLRQDOVHGHVHQYXHOYH\ORVPDUFRVpWLFRVTXHHQJOREDQDWRGRHO
sistema de salud.
El auge de la responsabilidad médica se halla
IXQGDPHQWDGR HQ YDULRV IDFWRUHV FRQFXUUHQWHV
TXHVHKDQFRQVROLGDGRDWUDYpVGHORV~OWLPRV
años. Es constante el progreso de la ciencia y su
FRUUHODWLYRDXPHQWRGHPpWRGRVGHGLDJQyVWLFR
\ WUDWDPLHQWR GHVFRQRFLGRV KDVWD KDFH SRFR
FRQ VXV EHQH¿FLRV \ ULHVJR$JUpJXHVH OD YXOgarización de la pseudo-información médica a
QLYHOHVQXQFDYLVWRVDWUDYpVGHORVmass media
TXHSHUPLWHQDOSURIDQRVHQWLUVHSRVHHGRUGHOD
VX¿FLHQWHVDSLHQFLDPpGLFDFRPRSDUDGLVFXWLU\
pretender co-diagnosticar con el médico.
2SHUDDGHPiVSHUQLFLRVDPHQWHODHQJDxRVD
SURSDJDQGDGHLQVWLWXFLRQHVSULYDGDV\GHSHUVRnajes políticos acerca del derecho a la salud con
HOVXEOLPLQDOPHQVDMHGHTXHORVSURIHVLRQDOHV\
VLVWHPDVPpGLFRVVRQUHVSRQVDEOHVGHTXHHVHGHUHFKROOHJXHDODJHQWH\VHKDJDUHDOLGDG±LQFXOFDGRFRQVHVJDGRV¿QHVDODPDQHUDGHGHPDJyJLFRDIRULVPR\FX\DOHFWXUDHLQWHUSUHWDFLyQSRU
HOFRP~QHVFUHHUUHDOPHQWHTXHODVDOXGHVDOJR
TXHSXHGHREWHQHUVHVLQPiVQLPiVSDJDQGR\
VLQTXHQDGLHVHPROHVWHHQH[SOLFDUFRQFODULGDG
TXHDOR~QLFRDORTXHVtSXHGHDVSLUDUHOLQGLYLGXRHVDWRGDVDTXHOODVPHGLGDV\FXLGDGRVTXH
WLHQGDQDPHMRUDU\RPDQWHQHU\RLQWHQWDUUHFXSHUDUODVDOXG \HVRHQIRUPDEDVWDQWHDOHDWRULD FRVD PX\ GLIHUHQWH D SHQVDU TXH OD salud YLHQH
HQYDVDGDHQFyPRGRVblistersTXHHOPpGLFRGHEHUi SUHVFULELU PpGLFDPHQWH \ TXH SRU VX VROR
HIHFWRODIXHQWHGH-XYHQFLDSDVDDVHUXQDUHDOLGDGTXHHOPpGLFRHVWiREOLJDGRDEULQGDU
/RUHDOHVTXHFRQPD\RUIUHFXHQFLDSDFLHQWHV \ IDPLOLDUHV QR TXLHUHQ TXHGDUVH H[FOXLGRV
como EHQH¿FLDULRVGHWRGDVHVDVPDUDYLOODVELROyJLFDVTXHODVUHYLVWDVRGLDULRVFXHQWDQ\PXHVWUDQ&DVLQDGLHGHVHDUHVLJQDUVHDODYHUGDGGHOD
¿QLWXG\IUDJLOLGDGGHODH[LVWHQFLDDODLPSRVLELOLGDGGHFXUDGHWDQWDV\WDQWDVHQIHUPHGDGHV
DOLQHOXFWDEOHSDVRGHOWLHPSRDORVGHWHULRURVD
ODVHQLOLGDG&XiQWDVYHFHVDQWHHOGLDJQyVWLFR
SRUPiVTXHpVWHDSDUH]FDHQYXHOWRRGLVLPXODGR
FRQ DOJXQD SLDGRVD HVSHUDQ]D VH UHDFFLRQD FRQ
IUDVHVWtSLFDV³¢&yPRFRQWRGDVODVFRVDVTXHOD
PHGLFLQDWLHQHDKRUDQRHVSRVLEOHVDEHURFXUDU
WDORFXDOSDWRORJtD"´R³SHURVL\ROHt RHVFXFKH
SRUUDGLRRYLSRU79 TXHDKRUDH[LVWHXQDGURJD
RWUDWDPLHQWRRPpWRGR TXHHV±RSDUHFH±LQIDOLEOH´<KD\VyORXQSDVRGHOGHVHQFDQWRDEXVcar un responsable de la no concreción de tantas
PDUDYLOODVGHSURORQJDUODYLGDODMXYHQWXGRGH
la eterna salud. Reconozcamos también –con honestidad– cuánto hacemos los médicos para asegurar tan utópicos como irreales resultados…
/DGHVSHUVRQDOL]DFLyQGHODPHGLFLQDDFWXDO
las malas o precarias condiciones –por no decir
absurdamente precarias– de la gran parte de los
KRVSLWDOHV GHQWUR GHO WHUULWRULR QDFLRQDO OD H[-
224 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
SORWDFLyQGHOPpGLFRSRUORVVLVWHPDVGHVDOXG
la falta de estabilidad médica en la mayoría de
ORV OXJDUHV GH WUDEDMR OD FDUHQFLD GH WRGR WLSR
GHJDUDQWtDSDUDHOSURIHVLRQDOGHOVLVWHPD WDQWRODERUDOHVFRPRMXUtGLFDV VDOYRTXHODSDJXH
SRU VX FXHQWD 3RU RWUD SDUWH OD DQRPLD LPSHUDQWHHQODVRUJDQL]DFLRQHVGHVDOXGODSpUGLGD
GHODVUHODFLRQHVRWURUDFDUJDGDVGHDIHFWLYLGDG
PpGLFRSDFLHQWHODUHLWHUDFLyQGHTXHHOSDFLHQWHHVXQFOLHQWHUHGXFLpQGRORDODFDWHJRUtDGH
FRQVXPLGRU VRQ RWURV FRQVWLWX\HQWHV TXH LQWHJUDQ OD H[SORVLYD VLWXDFLyQ DFWXDO GHO WHPRU D
ODVGHPDQGDV3RUTXH¢FXiQWRVPpGLFRVGLVSRnen –en las condiciones laborales actuales– del
tiempo y empatía para sentarse a “escuchar al
HQIHUPR´"$O SULQFLSLR GHO VLJOR ;; :LOOLDP
2VOHUFLWDQGRD+LSyFUDWHVGHFtD³(VFXFKDGDO
HQIHUPRpORVGDUiHOGLDJQyVWLFR´
Queda por analizar otro de los orígenes de la
WHQGHQFLDDH[LJLUDOPpGLFRPiVUHVXOWDGRV\HQGLOJDUOHFDGDYH]PiVUHVSRQVDELOLGDGHQWHQGLGD
FRPRREOLJDFLyQGHDIURQWDUORVGDxRVTXHSRUVX
DFFLRQDUSXHGDQGHYHQLURSRUQRREWHQHUORTXH
HOSDFLHQWHRVXVIDPLOLDUHVTXLHUHQ(QIUDVHGH
Louis Josserand1³DFWXDOPHQWHODUHVSRQVDELOLGDGFLYLOHVODJUDQYHGHWWHGHOGHUHFKRFLYLOWDPELpQFDEUtDD¿UPDUTXHODUHVSRQVDELOLGDGPpGLFD
–o cuando menos la responsabilidad profesional–
VHKDHULJLGRHQODJUDQYHGHWWHGHOGHUHFKRGHGDxRV´(QWLpQGDVHTXHHQWRQFHVWRGRXQYDVWtVLPR
campo de doctrina jurídica entra en juego y está
pronto a entrar en acción. Esto no es intrínsicaPHQWHPDORSHURKD\TXHVDEHUOR\HVWDUDWHQWRV
1L SDUDQRLFRV QL SHUVHJXLGRV SHUR FXLGDGRVRV
de la conducta médica para con el enfermo. Por
HOORHOPHMRUUHVJXDUGRHVWiGDGRSRUODOHFWXUD\
puesta en práctica el Código de Ética Médica propuesto por la Asociación Médica Argentina. Se
insiste por ser el targetTXHGHEHPRVSODQWHDUHQ
HVWDWHPiWLFD$QWHFXDOTXLHUGHPDQGDHOSXQWRD
juzgar es la conducta del profesional o ente juríGLFRTXHGHEHVHUODDSURSLDGDDFRUGHDOWLHPSR
OXJDU\SRVLELOLGDGHVH[LVWHQWHVDOPRPHQWRGHO
KHFKRGDxRVR3HURKD\TXHDVXPLUFRPRSULRULdad sine qua non\~QLFRVHJXURUHDOTXHODPHMRU
GHIHQVDFRQWUDHVWDVLWXDFLyQQXHYD\DQJXVWLDQWHHVODH[LJHQFLDGHUHYDORUL]DUODWDUHDPpGLFD
FRPRWDO5HYDORUL]DFLyQde los médicos y por los
PpGLFRV 'LJQL¿FDFLyQ GH VX WUDEDMR GH ORV UH
FXUVRVFRQTXHGHEHQFRQWDU2HOPpGLFRDVXPH
TXHQRWUDEDMDGHPpGLFRVLQRTXHes PpGLFRH
impone las condiciones necesarias para dedicar
HOWLHPSRQHFHVDULRDODDWHQFLyQGHOSDFLHQWHR
se resigna a ser la pieza más frágil del sistema
PpGLFRDFWXDO&RPRRWUDYHUWLHQWHHQDOWHFHGRUD
SHURFRQDPHQD]DVDYDQ]DOD%LRpWLFD)LiQGRVH
GHVXHWLPRORJtDSRGUtDPRVGHFLUTXHHVla moral de la vida2TXHUiSLGDPHQWHDPSOLyVXFDPSR
de acción y hoy cubre campos no sospechados
HQ VX QDFLPLHQWR FRPR OD SURFUHDFLyQ DVLVWLGD
HQWRGDVVXVYDULDQWHV±LQFOX\HQGRDEVXUGRVpWLFRVYLHQWUHVDOTXLODGRVYLHQWUHVVXVWLWXWRVHWF±
ORV HQVD\RV PHGLFDPHQWRVRV OD PDQLSXODFLyQ
HLQJHQLHUtDJHQpWLFDODFLUXJtDGHDYDQ]DGDOD
GRQDFLyQ GH yUJDQRV HO DFRPSDxDPLHQWR \ OD
PHGLFLQDSDOLDWLYDGHORVPRULEXQGRVODHXWDQDVLDHWF4XHGDUDOPDUJHQGHHVWDUHYROXFLyQ¿ORVy¿FDLPSOLFDHVWHULOL]DUQRVFRPRPpGLFRVVLQ
SRGHUHQWHQGHUQLXELFDUQRVHQHOQXHYRXQLYHUVR
HQTXHHVWDPRVLQPHUVRV\GRQGHVHQRVSLGHQQR
VRODPHQWH UHVSXHVWDV VLQR GHEHUHV \ REOLJDFLRQHVDULHVJRGHSDJDU±SRUYLYLUIXHUDGHODUHDOLGDG±SHVDGRWULEXWRSRUQXHVWUDVFDUHQFLDV<OR
TXHHVSHRUMXGLFLDOL]DUODVGHFLVLRQHVPpGLFDV
3RUTXH¢TXpSXHGHVHUPiVSDWpWLFRTXHDQWHXQ
FDVRFX\DFRQGXFWDVHDUHVRUWHHVSHFt¿FR\pWLFR
GHOPpGLFRpVWHSLGDDXQ-XH]TXHGLFWDPLQHOD
FRQGXFWDPpGLFDDVHJXLU"%DVWDPLUDUYDULRVFDsos resonantes conocidos en los últimos tiempos.
1RQRVTXHMHPRVGHVSXpVGHODMXGLFLDOL]DFLyQGH
la medicina cuando son los propios médicos los
TXHSRUFREDUGtDLJQRUDQFLDRGHVLGLDGHOHJDQ
en un profano una obligación puramente médica.
&UHHPRVTXHODEDVHSDUDXQDFRUUHFWDPHGLFLQDTXHSUHWHQGDVHJXLUORVIXQGDPHQWRVTXH
DQWHSRQHOD0RUDODO'HUHFKRVHHGL¿FDVREUHHO
mantenimiento de una postura ética ante el paFLHQWHSRVWXUDTXHVHUiDO¿Q\DOFDERODPHMRU
GHPRVWUDFLyQGHTXHHOSURIHVLRQDOREUyFRUUHFWDSUXGHQWH\GLOLJHQWHPHQWH
El modelo patriarcal debe ceder ante un heFKROHJDO\FXOWXUDODFWXDOODYLGD\ODVDOXGVRQ
bienes jurídicamente protegidos LPSOLFDQGR
GRVGHORVSLODUHVGHOD%LRpWLFDHOGHUHFKRDOD
información adecuada del paciente y el respeto
a su autonomía (O FRQÀLFWR SXHGH SODQWHDUVH
HQ FXDOTXLHU PRPHQWR SRU HMHPSOR QHJDWLYD
al tratamiento en relación a las consecuencias
7KHYHQRW;La bioetique'HEXWHW¿QGHYLH/D&URL[3DUtV4XHULQLDQD%UHVFLD Lorenzetti: Responsabilidad Civil de los Médicos5XELQ]DO&XO]RQL%XHQRV$LUHV
9 - Gestión jurídico legal en organizaciones de atención de la salud / 225
TXH SDUD OD FDOLGDG GH YLGD GHO SDFLHQWH SXHGH
RFDVLRQDUORTXHSXHGHHTXLSDUDUVHDOGHUHFKRD
morir dignamente.
<DFiDSDUHFHQORVSUREOHPDVGHULYDGRVGH
ODH[SUHVLyQ±RGHIDOWD±GHODYROXQWDG(VGHFLUVLQRPHGLDHOFRQVHQWLPLHQWRGHOSDFLHQWH
¢TXLpQ OR SXHGH KDFHU SRU pO" ¢< VL ORV IDPLliares legítimos discrepan entre sí? ¿Y si es un
PHQRU"¢&XiOHVODUHDOSRVLELOLGDGGHTXHSRU
el no hacerVHKDOOHHQMXHJRODYLGD"<DVtVXFHVLYDPHQWH (V GHFLU VH SODQWHD XQ FRQÀLFWR
de neta raigambre jurídica y moral entre los dos
YDORUHV YLGD \ OLEHUWDG R HO GHUHFKR D YLYLU \
PRULU FRQ GLJQLGDG (Q %DKDPRQGH] 0DUFHOR
//'HOYRWRGHORV'UHV%DUUD\)DLW
VHxDODTXHHORUGHQFRQVWLWXFLRQDODUJHQWLQRKD
SUHVHUYDGR HO GHUHFKR D HVWDU D VRODV HQ HO DUW
GHOD&RQVWLWXFLyQ1DFLRQDO³KDRUGHQDGROD
FRQYLYHQFLDKXPDQDVREUHODEDVHGHDWULEXLUDO
LQGLYLGXRXQDHVIHUDGHVHxRUtRVXMHWDDVXYROXQWDG´ )HUQiQGH] &DUORV ³/RV PpGLFRV \
HO ULJWK WR OHW EH DORQH´ HQ // GHO FRQVLGHUDTXHHOGHUHFKRDPRULUHVXQDJDUDQWtD
LPSOtFLWD HQ HO WH[WR FRQVWLWXFLRQDO (Q OD REUD
del Dr. Lorenzetti el autor indica a las claras
TXH ³OD pWLFD PpGLFD YD SHU¿OiQGRVH KDFLD
OD DGPLVLyQ GH DOJXQDV SDXWDV IDYRUDEOHV D OD
HXWDQDVLDSDVLYDEDVDGRVHQORVLJXLHQWH6LHO
SDFLHQWHH[SUHVDOLEUHPHQWHTXHQRTXLHUHHPSH]DURGHWHQHUXQWUDWDPLHQWRHOPpGLFRGHEH
hacerle caso. Debe empezarse un tratamiento
SDUDDOLYLDUHOGRORUGHXQHQIHUPRDXQFXDQGR
HVWRDFHOHUHVXPXHUWH´
El Código de Ética de la Confederación
Médica Argentina no es un compendio de norPDVPHUDPHQWHGHFODUDWLYDV\VLQYDORUOHJDOR
jurídico obligatorio. Además de la opinión de
,]TXLHUGR 7ROVDGD4: “Respetar las reglas de la
moral será el mejor antídoto contra toda reclaPDFLyQ GH UHVSRQVDELOLGDG FLYLO SHQDO DGPLQLVWUDWLYD R GLVFLSOLQDULD´ H[LVWH HO VX¿FLHQWH
VXVWHQWR MXULVSUXGHQFLDO FRPR SDUD D¿UPDU VLQ
WHPRUDHTXLYRFDUQRVTXHODeWLFDPpGLFDRORV
códigos deontológicos tienen profundas implicancias en la caracterización y juzgamiento de
las conductas médicas por nuestros tribunales.
Baste citar –y entre muchos otros– un fallo de la Suprema Corte Nacional condenando
DXQPpGLFRSRUQRDWHQGHUDXQSDFLHQWHTXH
IDOOHFLyDGXFLHQGRODIDOWDGHFUHGHQFLDOTXHOR
KDELOLWDEDFRPRD¿OLDGR³SHVDEDVREUHpVWH
HO PpGLFR HO GHEHU MXUtGLFR GH REUDU QR VRlamente en función de la obligación de actuar
con prudencia y pleno conocimiento impuesWRSRUODVQRUPDVGHO&yGLJR&LYLOVLQRFRPR
FRQVHFXHQFLDGHODH[LJLELOLGDGMXUtGLFDGHOGHEHUGHDVLVWHQFLDDOHQIHUPRTXHSUHVFULEHQODV
normas contenidas en el Código Internacional
de Ética Médica HO Código de Ética de la
Confederación Argentina \ OD GHFODUDFLyQ GH
*LQHEUD(VSUHFLVDPHQWHUHVSHFWRGHGLFKRV
RUGHQDPLHQWRV SDUWLFXODUHV TXH DWDxHQ D ORV
SURIHVLRQDOHVGHODUWHGHFXUDUTXHHVWD&RUWH
KDVHxDODGRTXHQRFDEHUHVWULQJLUVXDOFDQFHQL
SULYDUORVGHWRGDUHOHYDQFLDMXUtGLFDVLQRTXH
se impone garantizarles un respeto sustancial
SDUDHYLWDUODGHVKXPDQL]DFLyQGHODUWHGHFXUDU´ &6-1DXWRV³$PDQWH/HRQRU
\ RWURV F $VRFLDFLyQ 0XWXDO 7UDQVSRUWH
$XWRPRWRU´-$,, <HQRWUDVHQWHQFLDpVWDGH&iPDUDVHGLFH
“...La importancia del Código de Ética TXHULJH
HODUWHGHFXUDUQRFDEHUHVWULQJLUODHQVXDOFDQFHQLSULYDUODGHUHOHYDQFLDMXUtGLFDVLQRTXHVH
impone garantizarle un respeto sustancial para
HYLWDU OD GHVKXPDQL]DFLyQ GH GLFKD FLHQFLD
particularmente cuando la confrontación de los
KHFKRV\GHODVH[LJHQFLDVGHODFRQGXFWDDVtUHJODGDSRGUtDHYHQWXDOPHQWHVXUJLUXQMXLFLRGH
reproche con entidad para comprometer la resSRQVDELOLGDGGHORVLQWHUHVDGRV´ &1&LY6DOD
,//HM 3RGUtDSDVDUSRUXQH[FHVRGHLQWHOHFWXDOLVmo insertar dentro de los aspectos jurídicos de
las instituciones médicas elementos éticos y biopWLFRV1RSXHGHGHPRUDUVHPiVUHFRQRFHUTXH
OD IRUPDFLyQ pWLFD SUHVHQWD VHULDV GH¿FLHQFLDV
&RPRVHKDGLFKRHOPpGLFRGHEHVHUXQKRPEUH
TXHVLHQWDDORWURFRPRVHPHMDQWH\QRFRPRXQ
VLPSOHQ~PHURRFDVRHVWDDSUR[LPDFLyQEXVFD
SURPRYHUHQPLVFROHJDVXQPRGHVWRLQWHUpVHQ
HOWHPDGHODELRpWLFDFRQODHVSHUDQ]DGHTXH
OHVVLUYDSDUDEXVFDUHOVHQWLGRGHWUDVFHQGHQFLD
en la relación con el paciente y desembarazarse
GHODDOLHQDFLyQ\EXURFUDWL]DFLyQTXHHVWDPHGLFLQDJOREDOL]DGRUDQRVREOLJDDYLYLU
/DV LQVWLWXFLRQHV GH VDOXG YDQ PiV DOOi GHO
PDQHMRDGPLQLVWUDWLYRGHORSXUDPHQWHDVLVWHQ-
Lorenzetti: Responsabilidad Civil de los Médicos5XELQ]DO&XO]RQL%XHQRV$LUHV
,]TXLHUGR7ROVDGDop. cit.SiJ
4
226 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
FLDO6XSDSHOVHH[WLHQGHHQIRUPDOHJDO\VROLGDULDFRPRFRUHVSRQVDEOHGHODJDUDQWtDGHOD
FDOLGDG PpGLFD TXH HO VLVWHPD VHD FXDO IXHVH
GHEH RIUHFHU /D MXULVSUXGHQFLD WLHQH SRU FLHUWR TXH ORV VLVWHPDV GH VDOXG GHEHQ JDUDQWL]DU
\DVHJXUDU /RUHQ]HWWL ±HQWUHRWUDV±GRV
obligaciones básicas en relación a la aceptación
GHOULHVJRTXHGHEHDVXPLUHOVLVWHPDGHVDOXG
DPEDVGHULYDGDVGHODHOHFFLyQSRUHOSDFLHQWH
de un profesional incluido en una lista o cartilla
acotada en sus opciones:
‡ %ULQGDU XQ VHUYLFLR DGHFXDGR PHGLDQWH OD
elección de buenos médicos
‡/DHPSUHVDHVresponsable por los perjuicios
que sufre el paciente derivados de la mala
elección por parte de ésta de médicos y/o
sanatorios TXH RIUHFHUi D SRVWHULRUL HQ OD
cartilla de prestadores.
<HOORHVDVtSRUHOKHFKRGHTXHlimitar el
XQLYHUVRGHSUHVWDGRUHVDORVGHWDOODGRVHQGLFKR
OLVWDGRLPSOLFDHQUHDOLGDGHOOtPLWHDODOLEUH
HOHFFLyQ GHO D¿OLDGR D GLFKR VLVWHPD < FRPR
bien lo dice el autor antes mencionado: No se
puede absorber la libertad de elección sin asumir también los riesgos que ella acarrea.
Podemos agregar una conclusión:
‡ /D UHVSRQVDELOLGDG VH H[WLHQGH D OD IDOWD GH
prestaciones consideradas necesarias y de
elecciónHQORVFDVRVHVSHFt¿FRVTXHVLUYDQ
SDUDGDUXQDRSRUWXQLGDGDODFXUDPHMRUtDR
DOLYLRTXHHOSDFLHQWHQHFHVLWH
¿Qué entendemos por mejor calidad de atenFLyQPpGLFD"¢4XLpQODGH¿QH\FyPRVHPLGH"
/D OH\ H[SUHVD TXH ODV SUHVWDFLRQHV GHEHQ VHU
LJXDOLWDULDVLQWHJUDOHV\KXPDQLWDULDVTXHUHVSRQGDQ DO PHMRU QLYHO GH FDOLGDG GLVSRQLEOH \
JDUDQWLFHQ D ORV EHQH¿FLDULRV OD REWHQFLyQ GHO
PLVPRWLSR\QLYHOGHSUHVWDFLRQHVGHOLPLWDQGR
toda forma de discriminación en base a un criteULRGHMXVWLFLDGLVWULEXWLYD $UWž/H\ &RPR ELHQ GLFH HO DXWRU D TXLHQ VHJXLPRV
como referencia en esta introducción: “En realiGDGXQPRGHORGHVDWLVIDFFLyQSOHQDGHFDOLGDG
no puede ser soportado por las obras sociales y
HVHQFLHUWRPRGRLQFRPSDWLEOHFRQVXH[LVWHQFLD/DPi[LPDVDWLVIDFFLyQHQODVSUHVWDFLRQHV
médicas sólo es posible mediante una difusión
GHO FRVWR HQ WRGD OD FRPXQLGDG \ D WUDYpV GH
ODPHGLFLQDS~EOLFD3HUROOHJDGRVDHVWHSXQWR
YHUHPRV TXH OD VRFLHGDG SXHGH HQIUHQWDU RWURV
SUREOHPDV GH HOHFFLyQ \ GHFLGLU TXH HV PHMRU
GHVWLQDUHVRVIRQGRVDOHPSOHRODHGXFDFLyQR
ELHQHTXLOLEUDUHQWUHWRGRVHOORV\DTXHQRWLHQHQ
UHFXUVRVSDUDGDUXQDPi[LPDVDWLVIDFFLyQHQWRdos los planos al mismo tiempo. Por este camino
se llega a una conclusión más limitada: no es
SRVLEOH XWLOL]DU HO PRGHOR GH Pi[LPD VDWLVIDFFLyQ´(VGHFLUVHWUDWDGHMXVWLFLDGLVWULEXWLYDR
GHODDVLJQDFLyQUDFLRQDOGHORVUHFXUVRVWHPD
HVSLQRVRVLORVKD\
< QR TXHGDQ DIXHUD GHO SUREOHPD ORV VLVWHPDVSULYDGRVPXFKRPiVFRPSHOLGRVDGDUFDOLGDGDOPi[LPR\SRUHQGHDWDGRVDGLFKDREOLJDFLyQGDGRTXHRIUHFHQFDOLGDGFRPRVHxXHOR
\JDUDQWtDSDUDODFDSWDFLyQGHFOLHQWHV\SRUTXH
pVWRVDVXYH]DOSDJDUGHVXEROVLOORHQWLHQGHQ
TXHORDERQDGRRLQYHUWLGRUHSUHVHQWDHOSUHFLR
GHOYDORUDJUHJDGRGHORTXHKDQFRPSUDGRPHdicina con garantía de calidad.
¿Pasaremos de la consigna de los años sesenta
“un hijo cuando\RTXLHUD\VL\RORTXLHUR´D³XQ
hijo como\RTXLHUD"-DFTXHV0RQRUGORKDH[plicitado en forma lapidaria: “Para hacer un niño
KDFtDQIDOWDWUHVFRVDVXQDPXMHUXQKRPEUH\
HOD]DU+R\HVVX¿FLHQWHFRQXQDPXMHUHVSHUPD\XQPpGLFR´¢4XpVRQPHGLRVDSURSLDGRV
\FXiOHVORVGHVSURSRUFLRQDGRV"3DUDTXLHQWLHQH
XQUHVSHWRUHYHUHQFLDODQWHORELROyJLFRUHVSHWR
TXH QDFH GH ODV OH\HV LQPXWDEOHV TXH UHJXODURQ
WDOHV DVSHFWRV D OR ODUJR GH OD HYROXFLyQ KXPDQD\TXHGLHURQSRUUHVXOWDGRODELRGLYHUVLGDG\
HOHTXLOLEULRDFWXDOHVWDOHVPDQHMRVTXHLQWHQWDQ
FUHDU\RPRGL¿FDUODYLGDDVXPHQODQRULHVJRVD
SRVLELOLGDGGHIXWXUDVHLJQRUDGDVUHSHUFXVLRQHV
DWUDYpVGHODVLQWHUHVDGDVPDQLSXODFLRQHVGHORV
QXHYRVDSUHQGLFHVGHEUXMRV
3RU RWUR ODGR QR HV UDUR YHU TXH GHWUiV GH
WRGR LQYHVWLJDGRU \ PiV DOOi GH VXV H[SOtFLWDV
LQWHQFLRQHV ODWH HO GHVHR FRQVFLHQWH R QR GH
pasar a la posteridad por algún descubrimiento o
SURFHGLPLHQWR DVRPEURVR &XDQGR VH REVHUYD
DPHQXGRH[LVWHVLPSOHPHQWHXQLQWHUpVHVSHFt¿FRSRUVXVLPSOLFDQFLDV\SUR\HFFLRQHVHFRnómicas.
(QHORWURH[WUHPR¢TXpGHEHPRVUHVSRQGHU
ante una demanda de eutanasia en el caso patético
donde la dignidad humana parece perdida entre
ORVWUHPHQGRVGHWHULRURV¿QDOHVGHFLHUWRVHQIHUPRV"2GHFLHUWDVSDWRORJtDVLQFXUDEOHVFUyQLFDV\GH¿QDOLQFLHUWR FXDGULSOHMLDVSRUOHVLRQHV
PHGXODUHVDOWDVVtQGURPHGHHQFODXVWUDPLHQWR
(32&DYDQ]DGDVFRQLQVRPQLRUHIUDFWDULRHWF ¿Qué ante recién nacidos bajo asistencia respiUDWRULDFRQJUDYtVLPDVPDOIRUPDFLRQHVTXHHQ
HOKLSRWpWLFRFDVRGHVREUHYLYLUVHUiQPHUDVFDricaturas sufrientes? ¿Y ante el encarnizamiento
9 - Gestión jurídico legal en organizaciones de atención de la salud / 227
WHUDSpXWLFR"\DQWHWDQWRVHWF$FWXDOPHQWHQRV
encontramos desbordados en nuestros campos
del deber y el hacer. Debemos curar las enferPHGDGHVDOLYLDUDORVVXIULHQWHVKDFHUQRVFDUJR
GHODVGHPDQGDVVRFLDOHVGHH[LJHQFLDVQDFLGDV
GHQXHYDVUHTXLVLWRULDV D PRUDOHVGHXQDFXOWXUDTXHHQWUHHOSRVPRGHUQLVPR\HOVXUUHDOLVPR
KD FRORFDGR DO FXHUSR D OD VDWLVIDFFLyQ GH EDQDOLGDGHV\DSDULHQFLDV\DODVXSHU¿FLDOLGDGGH
ODH[LVWHQFLDFRPRHMHGHVXVGHPDQGDVIXQGDPHQWDOHV2WURVDQVLRVRVSRUUHFXEULUWRGRHOOR
con un barniz legal apelan a intentar legislar una
SHUPLVLYLGDGQDFLGDGHXQDIDOVDLQWHUSUHWDFLyQ
GH ORV GHUHFKRV KXPDQRV HQDUERODQGR D GLHVtra y siniestra su derecho a no ser discriminados
±QXHYRWyWHPVRFLDO±HQVXVWRUFLGDVLQWHUSUHWDFLRQHVQDFLGDVHQXQDUHODWLYLGDGpWLFD\PRUDO
FDUHQWHGHWRGDUD]yQ¿ORVy¿FD6LQFRQWDUDTXHllos FLHQWt¿FRVTXHQRVHSODQWHDQQLVHSODQWHDrán jamás que no todo lo técnicamente posible
es éticamente realizable.
7DPELpQ GHEHPRV DOHMDUQRV GH OD WHQWDFLyQ
FLHQWL¿FLVWD D XOWUDQ]D 1R FXDOTXLHU SURJUHVR
en este campo es necesariamente progreso de
OD FRQGLFLyQ KXPDQD /D FLHQFLD QR UHVROYHUi
WRGRV ORV SUREOHPDV \ GHEHPRV UHÀH[LRQDU R
SODQWHDUQRV DGyQGH QRV FRQGXFH OD LQYHVWLJDción carente de un claro marco ético. Si el penVDPLHQWRVRVWLHQHRFUHDODFLHQFLDFDGDSURJUHVRGHpVWDREOLJDDUHSODQWHDURUHD¿UPDUQXHVWUR
pensamiento en forma armoniosa con nuestros
YDORUHV\MX]JDUORVKDOOD]JRV
3HURPiVDOOiGHWRGRVHVWRVSODQWHRV¿ORVy¿FRVPRUDOHVYROYDPRVDOPpGLFR3UHYLRDOD
LQYHVWLJDFLyQDOGHUHFKRDOD¿ORVRItD\DODOH\
HVWiHOKRPEUHIUHQWHDVXLUUHGXFWLEOH¿QLWXG\
soledad. Solo el enfermo ante el médico. ¿Está
SUHSDUDGR pVWH SDUD SHQVDU SDUD VHQWLU DO RWUR
SDUDFRQRFHUDTXpLQWHUHVHVUHVSRQGHQPXFKDV
GHODVQXHYDVVR¿VWLFDGDVWpFQLFDVRORVQXHYRV
IiUPDFRV" ¢'yQGH SXHGH KDOODU ODV UHVSXHVWDV
FXiOHV VHUiQ ORV LQVWUXPHQWRV FRQ TXH VH PDQHMDUiSDUDGH¿QLUODVVLWXDFLRQHVYLWDOHVKDVWD
dónde pueden transferirse o aprenderse la capaFLGDGGHFRPSUHQVLyQSDUDHVWDVUHÀH[LRQHVTXH
KDFHQDODYLGD\DODPXHUWHHVGHFLUDOQDFLPLHQWR\DO¿QGHODYLGDKXPDQD"
$FiWHUPLQDQODVGLVHUWDFLRQHVDSHODFLRQHV\
ORV GLVFXUVRV (QKRUDEXHQD VL H[LVWH XQ UHWRUQR
9i]TXH])HUUHLUD5op. cit.
=DYDODGH*RQ]iOH]0op. cit
5
6
a un mayor humanismo e intentos de una comprensión ética y moral del hombre. Pero también
HVWHPRVDOHUWDSDUDTXHHOGHEDWHQRVHDPDQHMDdo o dirigido por ciertos expertos en ética. Todos
estamos comprometidos y nos toca de cerca
±PX\GHFHUFD±HOSUREOHPD1LOD¿ORVRItDQLOD
PRUDO HQORTXHWRFDDORVSUREOHPDVELRpWLFRV deben ser monopolio de círculos restringidos o
FHQiFXORV SULYLOHJLDGRV /DV FLHQFLDV GH OD YLGD
QRVFRQFLHUQHQDWRGRV7RGDODKXPDQLGDGHVOD
implicada y todos debemos asumir una posición
en estos temas.
RESPONSABILIDAD MÉDICA
La responsabilidad del hombre:
ser racional y responsable
'HQWUR GHO GHUHFKR IXQGDPHQWDOPHQWH HQ OR
UHJODGR SRU HO &yGLJR &LYLO \ VX &yGLJR GH
3URFHGLPLHQWRVHOWHPDIRUPDSDUWHGHOD7HRUtD
*HQHUDO GH OD 5HSDUDFLyQ R 'HUHFKR GH 'DxRV
GH¿QLGR FRPR ³HO VHFWRU GH OD &LHQFLD -XUtGLFD
TXHWLHQHSRUREMHWRHOHVWXGLRGHWRGRORUHIHULGR
DODUHSDUDFLyQGHXQGDxRLQMXVWR´5 Para la menFLRQDGDUHSDUDFLyQVHUHTXLHUHQORVFXDWURSUHVXSXHVWRVTXHHQXPHUDGLFKRDXWRU\TXHVRQ
D HOGDxR
E ODDQWLMXULFLGDG
F HOIDFWRUGHDWULEXFLyQ\
G ODUHODFLyQGHFDXVDOLGDG
3HUR FRPR PpGLFRV GHELpUDPRV VDEHU TXp
se entiende por DAÑO desde lo jurídico para
HYLWDUPDOHQWHQGLGRV3RGUtDGHFLUVH±\HQVHQWLGRDPSOLR±TXHHV³ODSpUGLGDRPHQRVFDERGH
XQELHQRLQWHUpVMXUtGLFDPHQWHSURWHJLGR´6 La
DQWLMXULFLGDGVHFRQ¿JXUDHQODIDOWDSRUacción
u omisiónGHOFXPSOLPLHQWRGHXQDREOLJDFLyQ
GHWHUPLQDGDVHDSRUFRQWUDWRSRUUHJODPHQWRV
RSRUFyGLJRVROH\HVTXHUHJOHQHVSHFt¿FDPHQte el accionar. El factor de atribución representa
ODQHFHVLGDGGHIXQGDPHQWDUHOSRUTXpGHEHUHVSRQGHUSRUODDFFLyQXRPLVLyQHVGHFLUODEDVH
GHGLFKDREOLJDFLyQ'LJDPRVGHVGH\DTXHHQ
HVWH WHUUHQR \ GHQWUR GH ODV UHVSRQVDELOLGDGHV
el fundamento para reparar es la responsabilidad
228 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
VXEMHWLYD GHO LQGLYLGXR HQ HVWH FDVR GH OD HVpecie médico y basado en la culpa profesional.
<¢TXpHVODFXOSD"/DRPLVLyQGHORTXHGHEtD
hacerse acorde al tiempo y lugar.
/DUHVSRQVDELOLGDGRFDOLGDGGHresponsable
LPSOLFDODREOLJDFLyQGHUHVSRQGHURUHSDUDUSRU
VtRSRUWHUFHURVORVGDxRVFRPHWLGRV±SRUDFFLyQ
u omisión– sobre personas o cosas. Ello implica
“aceptar las consecuencias de un acto realizado
FRQFDSDFLGDGFRQYROXQWDG\GHQWURGHXQPDUFRGHOLEHUWDG´(QUHDOLGDGEXFHDQGRHQODVUDtces profundas del concepto de daño y reparación
VXE\DFHHOSULQFLSLR¿ORVy¿FRTXHQRVLQGLFDQR
KDFHUDRWURVDTXHOODVFRVDVTXHQRTXLVLpUDPRV
TXHQRVKLFLHVHQDQRVRWURVRHOSUHFHSWRPRUDO
PiVVLPSOH\DQWLJXR³QRFDXVDUHOPDO´DOTXH
.$17 ±\ GH RWUD PDQHUD± H[SUHVy GLFLHQGR
³2EUD GH WDO PRGR TXH HO SULQFLSLR TXH JXtD WX
DFFLyQVHDDFHSWDEOHFRPROH\XQLYHUVDO´
Aspectos históricos de la
responsabilidad médica
Estudiando la historia de la Medicina y el
'HUHFKR YHPRV TXH \D HQ FLYLOL]DFLRQHV DQWLJXDVH[LVWtDHOFRQFHSWRGHTXHHOPpGLFRSRU
su accionar y por la particular naturaleza de la
PDWHULD TXH WUDEDMDED ±HO VHU KXPDQR± GHEtD
UHVSRQGHUSRUDTXHOORVHYHQWRVTXHVHSXGLHVHQ
FRQVLGHUDUQDFLGRVGHVXFXOSDRLQH[SHULHQFLD
HVWRWHQLHQGRHQFXHQWDODVSDUWLFXODULGDGHV¿ORVy¿FDVFRQTXHVHFRQVLGHUDEDQODVHQIHUPHGDGHVVHJ~QODpSRFDRSHUtRGRHQFRQFUHWR
(QODHUDSUHWpFQLFDGHODPHGLFLQD DVLULR
EDELOyQLFD(JLSWRH,UiQDQWLJXRV&KLQD,QGLD
H ,VUDHO HQ VXV FRPLHQ]RV HWF WDQWR VHPLWDV
FRPR LQGRHXURSHRV IXHUWHPHQWH LPEXLGRV GH
UHOLJLRVLGDG±VREUHWRGRORVSULPHURV±YHtDQDO
PXQGR FRPR XQD UHSUHVHQWDFLyQ GH OD GLYLQLGDGFRQVLGHUDQGRORVSDGHFLPLHQWRVGHOFXHUSR
FRPRHQYLDGRVSRUDTXHOODSRUORTXHHOUROIXQdamental de su cuidado y tratamiento estaba en
manos de religiosos y teólogos. Pero dentro de
ORVLQGRHXURSHRVFRQXQDFRQFHSFLyQPiVQDWXUDOLVWDFRPLHQ]DDVXUJLUODPHGLFLQDWpFQLFD
JULHJDFRQODYLVLyQGHODHQIHUPHGDGQRFRPR
una culpaPRUDOSULPDULDVLQRFRPRUHSUHVHQtación de la desarmonía del cuerpo.
En la medicina helenística también comien]DDKDEODUVHGHXQDpWLFDPpGLFD FODURTXHFRQ
<XQJDQRop.cit.
IXHUWHDFHQWRSDWHUQDOLVWD\H[FOX\HQGRDORVilotas \ GH ODV FRUUHVSRQGLHQWHV REOLJDFLRQHV GH
ORV JDOHQRV KDFLD ORV SDFLHQWHV FRQFHSWRV TXH
IXHURQGH¿QLGRVUHFLpQHQOD*UHFLDFOiVLFD\HQ
la Roma imperial.
(Q OD (GDG 0HGLD HO PpGLFR YLYLHQGR \
HMHUFLHQGR VX R¿FLR HQ XQD VRFLHGDG GH OD TXH
HUDSDUWHGHEtDDMXVWDUVHHQVXDUWH\WpFQLFDD
XQD FRPSOHMD UHG GH GHEHUHV FLYLOHV \ UHOLJLRVRV D WDO SXQWR LPEULFDGRV TXH OD SULQFLSDO
REOLJDFLyQHUDORJUDUTXHHOSDFLHQWHSHQVDUDHQ
VXDOPD\VHFRQIHVDVH3RUHMHPSORXQDRUGHnanza de los Reyes Católicos imponía una multa
GLQHUDULDSRUQRFXPSOLUFRQHVWHSUHFHSWR$Vt
OD FRQIXVLyQ HQWUH OR UHOLJLRVR OR SROtWLFR \ OR
WpFQLFRVHWRUQDLQGLVWLQJXLEOHFRQSUHGRPLQLR
de lo primero. Pero no sólo de estas cuestiones
religiosas debieron cuidarse los médicos. El
SRGHUUHDOIXHGLFWDQGRQRUPDVTXHKDFtDQDOD
KLJLHQHDODUHVSRQVDELOLGDGPpGLFDDORVKRQRUDULRVGLFWiPHQHVOHJDOHVHWF
'H ORV VLJORV ;9, DO ;9,,, FRPR FRQVHcuencia del importante desarrollo del poder
FLYLO FRPLHQ]D D GHVHQYROYHUVH OD 0HGLFLQD
/HJDO6HLQFUHPHQWDODLQWHUYHQFLyQGHO(VWDGR
HQ ODV REOLJDFLRQHV PRUDOHV GH ORV PpGLFRV \
HQWUHODVGRVYHUWLHQWHVGHODVGHFLVLRQHVPRUDOHV
\ODVRFLDOL]DFLyQ\HVWDWL]DFLyQYDQVXUJLHQGR
la estructura y contenido de la deontología.
(QHOVLJOR;,;HOPpGLFRVHYHHQIUHQWDGR
a una serie de hechos: la actitud ante la enferPHGDGORVFDPELRVHQVXSURSLDIRUPDFLyQ\VX
estatus social ponen el fundamento y dan lugar
D ORV YLJRURVRV GHVDUUROORV GH OD pWLFD PpGLFD
ODPHGLFLQDOHJDO\ODUHVSRQVDELOLGDGTXHSRU
DFFLRQHVXRPLVLRQHVSXHGHLPSXWiUVHOHDOSURfesional.
Dos procesos jurídicos contra sendos médiFRVUHDOL]DGRVHQ)UDQFLDSRUKHFKRVFRQVLGHUDdos como de conducta imprudente o de imperiFLDFRQWUDORV'UHV+HOLHHQ DPSXWDFLyQ
GHDPERVEUD]RVGHXQIHWRTXHHVWDEDQDFLHQGRHQXQDSUHVHQWDFLyQGHKRPEUR \1RUR\HQ
JDQJUHQD \ SRVWHULRU DPSXWDFLyQ GH XQ
EUD]RVREUHHOTXHKDEtDUHDOL]DGRXQDVDQJUtD
OHVLRQDQGRODDUWHULDEUDTXLDO HQFLHUWDPDQHUDVHQWDURQODVEDVHVGHFDOL¿FDFLyQGHDTXHOODV
FRQGXFWDVTXHSXGLHVHQFRQVLGHUDUVHFRPRSXQLEOHVHQHOGHVHPSHxRGHODSURIHVLyQWDOHVFRPR
ODVGHLPSUXGHQFLDLPSHULFLDRQHJOLJHQFLD
9 - Gestión jurídico legal en organizaciones de atención de la salud / 229
La responsabilidad profesional
<DVHKDKHFKRKLQFDSLpHQTXHODUHVSRQVDELOLGDG
SURIHVLRQDO GH ORV PpGLFRV HV XQD YDULHGDG GH OD
VLPSOHUHVSRQVDELOLGDGKXPDQDDODTXHGHEHQDMXVWDUVH6HJ~QGLFH%XHUHV ³ODGRFWULQDWUDGLFLRQDOHQWHQGtDTXHODFXOSDPpGLFDGHVGHHOSXQWR
GHYLVWDFLHQWt¿FRHUDGLIHUHQWHGHODFXOSDFRUULHQWH
HQ OD TXH SRGtD LQFXUULU FXDOTXLHU SHUVRQD DO FDXVDUXQGDxR6HDGXFtDTXHOD0HGLFLQDQRHUDXQD
FLHQFLDH[DFWD\TXHHOORGHMDEDHQOLEHUWDGDOIDFXOWDWLYRSDUDREUDUFRQXQDGRVLVGHSHUVRQDOLVPRQR
susceptible de ser captado. De tal forma se separaba la culpa médica –o culpa profesional– y la culpa
PDWHULDO´(VWDWHVLVHQJHQHUDO\GHVGHHOSXQWRGH
YLVWD MXULVSUXGHQFLDO PRGHUQR HVWi SRU FRPSOHWR
abandonada y es reemplazada en la actualidad por
HOFULWHULRTXHHOPpGLFRGHEHUiUHVSRQGHU³FXDQGR
FRPHWDXQHUURUFLHQWt¿FRREMHWLYDPHQWHLQMXVWL¿FDEOHSDUDXQSURIHVLRQDOGHVXFDWHJRUtDRFODVH´
(VWR\SDUDODPD\RUSDUWHGHODMXULVSUXGHQFLD DFWXDO GH QXHVWUR SDtV WHUPLQD FRQ ORV SULYLOHJLRV TXH SRGUtD RWRUJDU XQD SUHVXQWD culpa
profesionalQRSDVLEOHGHVHUMX]JDGDSRUORVMXHFHV\HQWRGRFDVRFRQWHPSODGDSRUORV&ROHJLRV
0pGLFRV(QFLHUWDPDQHUDVLJQL¿FDODGHVDSDULción –según las concepciones predominantes de
la Justicia– de los fueros personales o gremiales.
Quede perfectamente en claro: el médico tiene
la obligación de responder±ORTXHDFiVLJQL¿FD
reparar dinerariamente± WRGRV DTXHOORV DFWRV
HQ TXH SRU DFFLyQ X RPLVLyQ VH Gp RULJHQ D XQ
daño y cuando los mismos sean producto de acFLRQHVFDOL¿FDGDVFRPRLPSHULFLDLPSUXGHQFLDR
QHJOLJHQFLD'HEHGHVWDFDUVHDGHPiVTXHHO$UW
GHO&yGLJR&LYLO\ODDPSOLDMXULVSUXGHQFLD
TXHORFRQYDOLGDD¿UPDTXH³&XDQWRPD\RUVHD
el deber de obrar con prudencia y pleno conociPLHQWRGHODVFRVDVPD\RUVHUiODREOLJDFLyQTXH
resulte de las consecuencias posibles de los heFKRV´'HDKtODPD\RUJUDYHGDGGHIDOWDVDWULEXLbles a especialistas o médicos de renombre.
La llamada responsabilidad médica.
Concepto de culpa. Formas
'HWDOODGRHQHOSULPHUSiUUDIRHOSULQFLSLRUHFWRU
GHELpUDPRVSUHJXQWDUQRVVLH[LVWHXQDYHUGDGH0RVVHW,WXUUDVSH-Op. cit
%XHUHV$Op. cit.
9i]TXH])HUUH\UD5Op. cit.
ra responsabilidad médicaRpVWDHVXQDYDULDQWH
genérica del deber de responder por los daños a
TXHWRGRVHUKXPDQRHVWiREOLJDGR(VFULWHULR
MXUtGLFRTXHQRH[LVWHper se una responsabilidad
PpGLFDDLVODGD±FRPRHQWHDXWyQRPR±VLQRTXH
nuestro accionar está genéricamente implícito
HQODVDFFLRQHVSURSLDVGHOKRPEUH\TXHSRUOR
WDQWRQRVDOFDQ]DODGH¿QLFLyQJHQHUDOGDGDDO
SULQFLSLRSXGLHQGRFRQVWLWXLUVyORXQDYDULDFLyQ
GHFRQGXFWDGHWLSRHVSHFt¿FRSHURVLQGHMDUGH
SHUWHQHFHUDODHVSHFLHTXHFRPRVHUHVKXPDQRV
formamos.
La responsabilidad médica puede asumir diYHUVDVIRUPDVGHDFXHUGRQRVyORDOFRQWHQLGR
VXEMHWLYRXREMHWLYRGHODVDFFLRQHVUHDOL]DGDV
VLQRWDPELpQVLH[LVWLyRQRODintención de coPHWHU GROR 7HQGUHPRV FXDQGR pVWH H[LVWD OD
¿JXUDGHdelitoHQHO&yGLJR&LYLORUHVSRQVDELOLGDGFULPLQDOTXHVHUiPDWHULDGHO&yGLJR3HQDO
\ TXH SRGUi FRQOOHYDU ODV SHQDV GH UHFOXVLyQ
SULVLyQPXOWD\RLQKDELOLWDFLyQSXGLHQGRFDUJDU FRQ PiV OD UHVSHFWLYD UHSDUDFLyQ GLQHUDULD
HQHOIXHURFLYLO
Entiéndase por culpa al elemento básico soEUH HO TXH VH DVLHQWD OD UHVSRQVDELOLGDG \ TXH
GLFKR SRU *KHUVL HV OD ³UHSURFKDELOLGDG GH OD
FRQGXFWDIUHQWHDQRUPDVGHOGHUHFKRTXHSUHVFULEHQXQDIRUPDGHREUDU´2HQRWURVWpUPLQRV
³ODRPLVLyQGHDTXHOODVGLOLJHQFLDVTXHH[LJLHUH
ODQDWXUDOH]DGHODREOLJDFLyQ\TXHFRUUHVSRQGLHVHQDODVFLUFXQVWDQFLDVGHODVSHUVRQDVGHO
WLHPSR\GHOOXJDU´ $UW&& No puede omitirse mencionar las ideas del
3URI%8(5(6DXWRULQVRVOD\DEOHSDUDWRGROR
TXHVHDUHVSRQVDELOLGDGPpGLFDFXDQGRD¿UPD
“...la culpa profesional es la culpa común y corriente emanada en lo esencial del contenido de
ORVDUW\GHO&yGLJR&LYLO(OWLSR
GHFRPSDUDFLyQDEVWUDFWRVHUiYDULDEOH\ÀH[LEOH\FRUUHVSRQGHUiDOREUDUGHXQSURIHVLRQDO
prudente y diligente de la categoría o clase a la
FXDOSHUWHQH]FDHOGHXGRUHQHOFDVRFRQFUHWR´
Para aclarar algunos términos desde este discurVR MXUtGLFR TXH DWDxH D ORV PpGLFRV GHEHPRV
UHFRUGDUTXHFXDQGRHO3URI*KHUVLKDEODGHOD
RPLVLyQGHGLOLJHQFLDVGHEHHQWHQGHUVHTXHODV
GLOLJHQFLDV D TXH VH REOLJD XQ PpGLFR VRQ ODV
TXHWiFLWDPHQWH¿JXUDQHQHOOODPDGRcontrato
230 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
médicoTXHVHWUDWDSiUUDIRVPiVDEDMR3HURHQ
FRQFUHWRWDOREOLJDFLyQHVSRQHUORPHMRUGHOD
ciencia en el aquí y en el ahora. Es atender al
paciente con diligencia y voluntad. Es dedicarle
atención, los cuidados y los procedimientos indicados por la Medicina actual, pero se repite,
teniendo en cuenta las condiciones de lugar y
tiempo.
8QDGLVWLQFLyQFOiVLFDKDEODEDGHFXOSDFXOSRVDRFXOSDGRORVDHQWHQGLHQGRTXHHQHVWD~OWLPDH[LVWtDXQHOHPHQWRYROLWLYRFRQLQWHQFLyQ
GHFDXVDUXQPDORVLJQL¿FDEDODFDUJDGH¿QLGD
GHTXHUHUSURYRFDUOR(OPLVPR&yGLJR&LYLOOD
GHWHUPLQDFXDQGRHQVX$UWGLFH³(ODFWR
ilícito ejecutado a sabiendas y con intención de
GDxDUDODSHUVRQDRORVGHUHFKRVGHRWURVHOODPDHQHVWHFyGLJRGHOLWR´3RUVXSXHVWRTXHHO
alcance de los resarcimientos no será igual en
XQFDVRTXHHQRWUR3HURHOGRORRGHOLWRQRHV
el objeto de este trabajo.
3DUD D¿QDU PiV HO FRQFHSWR OD IRUPD FXOSRVD\GHWLSRLQFRQVFLHQWHFRQOOHYDUtDXQEDMR
JUDGR GH FXOSDELOLGDG GDGR SRU HO FDVR GH ³OD
IDOWD GH SUHYLVLyQ GH XQ UHVXOWDGR WtSLFDPHQWH
DQWLMXUtGLFRTXHSXGR\GHELyKDEHUVHSUHYLVWR
DO REUDU´11 3RU RWUR ODGR \ VLHPSUH GHQWUR GH
OD FXOSD FXOSRVD H[LVWLUtD OD IRUPD FRQVFLHQWH
HQ OD TXH HO LQGLYLGXR OOHJD D UHSUHVHQWDUVH HO
UHVXOWDGRQRFLYRGHXQDFWRSHURSLHQVDTXHORJUDUiHYLWDUOR9DGHVX\RTXHHQODFXOSDGRORVD
HO LQGLYLGXR VH UHSUHVHQWD HO UHVXOWDGR GDxRVR
pero tiene toda la intencionalidad de alcanzarlo.
3RGUtD GHFLUVH TXH OD FXOSD FRUUHVSRQGH D XQD
falla en la conductaTXHQRHVWXYRDODDOWXUD
GHORTXHPpGLFDPHQWHGHELyKDEHUVHKHFKR±R
dejado de hacer– por el profesional y acorde a
un caso puntual en cuestión.
&XDQGR QR KD H[LVWLGR OD LQWHQFLyQ GH FRPHWHUGRORHVWRHVODFXOSDculposapVWDSRGUi
DGRSWDU\VHUMX]JDGDEDMRODVIRUPDVRPDWLces de:
‡,PSHULFLD
‡,PSUXGHQFLD
‡1HJOLJHQFLD
‡,QREVHUYDQFLDGHODVREOLJDFLRQHV\GHEHUHV
a su cargo.
IHUDFRQWUDFWXDOQDGDLPSLGHDODSDUWHGHPDQGDQWHLQLFLDUDFFLRQHVQRDQWHHOIXHURFLYLOVLQR
DQWH HO SHQDO EDMR ODV IRUPDV MXUtGLFDV GH SRU
HMHPSOROHVLRQHVXKRPLFLGLRVLHPSUH\FXDQGR
HQORVDUWtFXORVLQYRFDGRVHVWpQFRQ¿JXUDGDVGH
PRGRWD[DWLYRODVIRUPDVHQXPHUDGDV
Impericia
Implica la falta de conocimientos técnicos báVLFRV H[SHULHQFLD R KDELOLGDG LPSUHVFLQGLEOHV
SDUD UHDOL]DU XQ DFWR PpGLFR GHWHUPLQDGR (V
VHJ~Q -LPpQH] 'tD] HMHUFHU FRQ LJQRUDQFLD GH
ODVUHJODVUHVSHFWLYDV6LJQL¿FDVDQFLRQDUWDQWR
DOPpGLFRTXHDQWHVGHLQLFLDUXQDFWRVHsabía
incapazFRPRDDTXHOTXHdebía saberse incapaz.
Imprudencia
No medir de forma adecuada las consecuencias
GH XQD DFFLyQ QR UHSUHVHQWiQGRVH ODV FRQVHcuencias. Es una omisión de los cuidados básiFRVDODSUiFWLFDUHDOL]DGDXQREUDUHQPiVHQ
IRUPD DSUHVXUDGD LQPDGXUD VLQ MXLFLR PpGLFR
DGHFXDGRVLQGLVFUHFLyQQLFDXWHOD3RUHMHPSOR
realizar una transfusión sin las adecuadas pruebas de compatibilidad.
Negligencia
6HUtD HQ FLHUWR PRGR OR LQYHUVR GH OR DQWHULRU
8Q GHMDU GH KDFHU SRU H[FHVR GH DXWRVX¿FLHQFLDHOFXPSOLPLHQWRIRUPDOGHREOLJDFLRQHVPpdicas inherentes a cada situación en particular.
Por ejemplo no controlar adecuadamente y en
IRUPD SHULyGLFD OD HYROXFLyQ GH XQ FRPD SRU
WUDXPDWLVPRGHFUiQHRORVREOLWRVDEGRPLQDOHV
HWF(QXQDSDODEUDODLPSUHYLVLyQGHDOJRTXH
GHELySUHYHUVH
Inobservancia de obligaciones
y deberes a su cargo
<DHOWtWXORGHOHStJUDIHFRQ¿JXUDODIRUPDFXOSRVD
GHOSURFHGHU(VWiQFRPSUHQGLGRVHQHO$UWGHO
&3HQDO6HUH¿HUHDOLQGLYLGXR IXQFLRQDULRHPSOHDGRS~EOLFR TXHHVWDQGRREOLJDGRSRUUHJODPHQWRVXRUGHQDQ]DVRPLWHFXPSOLUVXPDQGDWR
(QODHVIHUDFLYLODVLPLVPRHVHOLQFXPSOLPLHQWR
GHH[SUHVDVyUGHQHVDGPLQLVWUDWLYDV SRUHMHPSOR
$FOiUDVHTXHHQHVWRVFDVRVGDxRVFXOSRVRV DXVHQWDUVHGHODJXDUGLDRPLVLyQRGHIHFWRHQOD
originados por la conducta del médico en la es- FRQIHFFLyQGHKLVWRULDFOtQLFDSHUPLWLUODUHDOL]D)RQWiQ%DOHVWUD&Op. cit
%RODGRop. citSiJ
11
9 - Gestión jurídico legal en organizaciones de atención de la salud / 231
FLyQGHDFWRVPpGLFRVSRUSUDFWLFDQWHVHWF (QOD
UHDOLGDGQXQFDHVWDQFODUDODGLVWLQFLyQSRUORTXH
QRGHEHH[WUDxDUTXHVHLPEULTXHQGLVWLQWDVIRUPDV
de culpa en cada caso en particular.
Otros tipos de responsabilidad
1RGHEHGHVFDUWDUVHTXHHOSURIHVLRQDOFRPHWDFRPR
FLXGDGDQRFXDOHVTXLHUDGHORVGHOLWRVGHtQGROHJHQHUDOWLSL¿FDGRVHQGLYHUVRVDUWtFXORVGHO&yGLJR3HQDO
R DXQ DTXHOORV TXH OH VRQ DSOLFDEOHV SRU VX SURSLD
FRQGLFLyQGHPpGLFRWDOHVFRPRDERUWRDEDQGRQR
GHSHUVRQDVVXSUHVLyQGHHVWDGRFLYLOYLRODFLyQGH
VHFUHWRPpGLFRHMHUFLFLRLOHJDOGHODPHGLFLQDHWF\
TXHVHKDOODQGHELGDPHQWHWLSL¿FDGRVHQHO&3HQDO
(OHUURUPpGLFR$XQTXHQRVHWUDWDGHXQD
IRUPDGHUHVSRQVDELOLGDGFRQYLHQHWUDWDUHOFDVR
del error de diagnóstico. Acá no puede hablarse
HVSHFt¿FDPHQWHGHFXOSDWDOFXDOODGH¿QLPRVFRQ
anterioridad. Siendo la Medicina una ciencia conMHWXUDOVRPHWLGDDORVYDLYHQHV\VLQJXODULGDGHV
GHWRGRORELROyJLFRFRQODVGXGDVLQFHUWLGXPEUHV\GHVYtRVGHORKDELWXDOQRGHELHUDMDPiVHO
SURIHVLRQDO SURER ±OR TXH LQGLFD TXH DFWXy FRQ
FULWHULRFLHQWt¿FR\FRQODVQRUPDVDFRUGHVDOD
HVSHFLDOLGDG\DORTXHdebió hacerse según arte–
ser condenado por falta de responsabilidad.
$Vt OD &DP 1DF &LY 6DOD $ ('KDGLFKR³(OHUURUGHGLDJQyVWLFR
no es imputable si se han tomado todas las meGLGDVSDUDHYLWDUOR\QRVHKDSXHVWRGHPDQL¿HVWRXQDLJQRUDQFLDGHODPDWHULDQRSXGLHQGR
H[LJLUGHOPpGLFRPiVGHORTXHSXHGHH[LJLUVH
DOSURPHGLRGHPpGLFRVVDOYRTXHVHWUDWDUDGH
XQHVSHFLDOLVWD´'HFLPRV no debieraSRUTXHHQ
HVWRVWHUUHQRVGHODFXOSDHOGHFLVRU¿QDOHVHO
-XH]\VHUiVXFULWHULRHOTXHSULPDUi
$VLPLVPR $WD] /ySH] KD GLFKR TXH en
principio, parece que el error que exime de responsabilidad civil no ha de ser una anomalía de
conducta, sino una equivocación en el juicio.
Responsabilidad prestacional
y legal de la Auditoría médica dentro
de las instituciones de Salud
Dentro de la estructura de una institución médiFDHODXGLWRUMXHJDXQUROPX\LPSRUWDQWH(QOD
Op. citSiJ
%XHUHVop. cit
14
REUDFRPHQWDGDGHO'U%XHUHV VHVLHQWD
TXHHODXGLWRUPpGLFRFXPSOHXQGREOHUROTXH
VHSDWHQWL]DHQž ¿VFDOL]DUHOFRPHWLGRGHPpGLFRV\SHUVRQDOD¿QGHFRPSUREDUODH¿FLHQFLD\FDOLGDGGHODVSUHVWDFLRQHV\ž FRQFHGHU
o denegar autorizaciones para el suministro de
una prestación determinada. En este segundo
punto cabe hacer la siguiente aclaración: para
TXH HO DXGLWRU FXPSOD FRQ HVWH SUHFHSWR GHEH
LQH[FXVDEOHPHQWHFRQWDUFRQXQDQRUPDHVFULWD
TXHOHGLJDFXiOHVODH[WHQVLyQGHODFREHUWXUD
y cuáles son las prácticas autorizables. En los
VLVWHPDVGHVDOXGSUHSDJRVHVWDQRUPDWL]DFLyQ
YDGHWDOODGDHQHOFRQWUDWRTXHGHEHFRQIRUPDU
el cliente-paciente. En las obras sociales y esWDQGRHQYLJHQFLDODOH\\FRQIRUPDQGRHO6LVWHPD1DFLRQDOGH6HJXURGH6DOXG
VXMHWRVDODVGLVSRVLFLRQHV\QRUPDWLYDVTXHOR
UHJXODQ(QHVWHPRPHQWRHOFDWiORJRGHSUHVtaciones o canasta prestacional se halla basado
HQHO3URJUDPD0pGLFR2EOLJDWRULR 302 5HV
B06TXHSRUODemergencia económica se
KDOODSDUFLDOPHQWHDFRWDGRDO302( 3URJUDPD
0pGLFR2EOLJDWRULRGH(PHUJHQFLD 'HEHPHQFLRQDUVHTXHPiVDOOiGHODFUHHQFLD FRP~Q HVWH FRQWLQXDGRU GHO 1RPHQFODGRU
QR ¿MD YDORUHV VLQR TXH GHWDOOD SUHVWDFLRQHV \
SUiFWLFDVDFHSWDGDVSRUHOVLVWHPD/RVYDORUHV
±DSDUWLUGHOGHFUHWRB3(1±GHELHVHQVXUgir del libre juego de la oferta y la demanda entre prestadores e instituciones. En relación a lo
TXHRIUHFHHVWDFDQDVWDSUHVWDFLRQDOSXHGHGHFLUVHVXFLQWDPHQWHTXHHQPXFKRGHORVtWHPVWLHQH
OtPLWHVDOJRGLIXVRVORTXHGDSLHDODDSDULFLyQ
GHFRQWURYHUVLDVTXHGL¿FXOWDQODLQWHUSUHWDFLyQ
y tornan complicada la proyección de costos.
6HJ~QORV$JHQWHVGHO6HJXURGH6DOXG 2266 \ODV3UHSDJDV REOLJDGDVDOGDUHO302DWUDYpV
GHOD/H\ HVGHPDVLDGRDPSOLR\SHUPLVLYRDHVWRGHEHGHDJUHJDUVHODLQFRQWURODEOH
SUROLIHUDFLyQGHDSDUDWRORJtD\IiUPDFRVQXHYRV
GHGXGRVDUHODFLyQFRVWREHQH¿FLR
$GHPiV\FRPRSULQFLSLREiVLFR³ODLQH¿ciencia de la prestación de salud responsabili]DDODREUDVRFLDOVLHQGRWDOGHEHULUUHIUHQDEOH´14 (V GHFLU VL HO DXGLWRU HQ DWULEXFLRQHV
FRQIHULGDV H[SUHVDPHQWH SRU OD LQVWLWXFLyQ
DXWRUL]DRGHQLHJDXQDSUiFWLFD\SDUDHOORVH
ajusta al recto criterio médico y a las pautas
232 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
TXHUHJXODQVXFRPSHWHQFLDQROHSRGUiVHUUHSURFKDGDIDOWDDOJXQD6HUiODREUDVRFLDOSRU
HO ~OWLPR SiUUDIR VHxDODGR OD TXH GHEHUi UHVSRQGHU SRU GLFKD GHQHJDWRULD /R TXH Vt GHEH
hacer el auditor es –cuando el criterio médico
así lo dicte– poner en conocimiento fehaciente
GH ODV DXWRULGDGHV WDO FLUFXQVWDQFLD SDUD TXH
VHDQ pVWDV ODV TXH DVXPDQ OD UHVSRQVDELOLGDG
GHDFHSWDUODRGHQHJDUOD'HPiVHVWiGHFLUTXH
VLODSUiFWLFDPRWLYRGHOSHGLGRGHDXWRUL]DFLyQ
HVFRQVLGHUDGDLPSUHVFLQGLEOHSRUHODXGLWRU\
OD,QVWLWXFLyQVHQLHJDDFXEULUVXFRVWRGHEHUi
GHMDUFRQVWDQFLDHQIRUPDH[SUHVD\GRFXPHQtada de tal circunstancia.
$VLPLVPR VL HO DXGLWRU QR FXPSOH FRQ FRUUHFFLyQ OD YLJLODQFLD R FRQWURO GH SUHVWDGRUHV
\SUHVWDFLRQHVHOXGLHQGRGDUFRQVHMRVRVXPLQLVWUDQGR GLFWiPHQHV HTXLYRFDGRV D ODV DXWRULGDGHV DGPLQLVWUDWLYDV SRGUiQ pVWDV WDPELpQ
ejercer acciones legales de repetición contra el
DXGLWRUHQHOFDVRGHVHUFRQGHQDGDVSRUDTXHOODVFLUFXQVWDQFLDVRDFWRVHQORVTXHHODXGLWRU
REYLyRHUUyODFRUUHFWDDSUHFLDFLyQ
7DPSRFRSRGUiHODXGLWRUPpGLFRGDUXQDOWD
EDMR VX UHVSRQVDELOLGDG DO SDFLHQWH \D TXH QR
HQWUDGHQWURGHVXVDWULEXFLRQHV\HVGLItFLOTXH
HVWp OR VX¿FLHQWHPHQWH LQIRUPDGR GHO FXDGUR
clínico del enfermo como para asumir esta responsabilidad.
(QODDFWXDOLGDGHVWiSOHQDPHQWHYLJHQWHOD
obligación de los sistemas prepagos de brindar
HO 302 \ WRGDV DTXHOODV RWUDV SUHVWDFLRQHV \
WUDWDPLHQWRV TXH HO (VWDGR KD GHWDOODGR \ FDOL¿FDGR FRPR REOLJDWRULDV SDUD HO VLVWHPD GH OD
6HJXULGDG 6RFLDO 7DO OH\ OD VH GLFWy
HQ EDVH DO FULWHULR GH TXH HO (VWDGR GHEH FRQWURODUWRGRDTXHOORDWLQHQWHDOVLVWHPDGHVDOXG
TXHFXEUHDODSREODFLyQ6XRULJHQHVWiEDVDGR
HQTXHHO(VWDGRGHOHJDDOJXQDGHVXVIXQFLRQHV
EiVLFDVFRPRHVODDWHQFLyQGHODVDOXGODSUHYHQFLyQ\HOWUDWDPLHQWRGHODHQIHUPHGDGHWF
HQLQVWLWXFLRQHVSULYDGDVJXDUGiQGRVHHOSRGHU
GHFRQWURODU\¿VFDOL]DUVXFXPSOLPLHQWR
<OOHYDGHODPDQRDRWURGHORVSXQWRVLPSRUWDQWHVSXHV\DQRSRUYtDUHJODPHQWDULDVLQR
SRU OD MXULVSUXGHQFLD VH YD GH¿QLHQGR HVWD VXSHUYLVLyQHVWDWDOSHURD~QHQIRUPDLQFRPSOHWD
7RGDVDTXHOODVLQVWLWXFLRQHVRHQWHVTXHEULQGHQ
SUHVWDFLRQHV GH VDOXG EDMR DOJXQD IRUPD FRQWUDFWXDOHVWiQVLHQGRGHDOJXQDPDQHUDDFRWDGDV
15
\WXWHODGDVSRUVXFHVLYDVMXULVSUXGHQFLDVGHORV
7ULEXQDOHVGHWRGRHOSDtV
(QODREUDGHORV'UHV*KHUVL&:HLQJDUWHQ
C. e Ippolito S.15OHHPRVUHVSHFWRGHOLPLWDFLRnes contractuales: “Cláusulas de esta naturaleza
UHVXOWDQ DEVROXWDPHQWH LQH¿FDFHV SRU FXDQWR
afectan a la integridad del cumplimiento de la
SUHVWDFLyQ/DVREOLJDFLRQHVTXHHOHQWHPpGLFR
SUHSDJRDVXPHFRQWUDFWXDOPHQWHQRSXHGHQVHU
suprimidas o alteradas total o parcialmente en
IRUPD DUELWUDULD GHELHQGR FXPSOLU LQHOXGLEOHPHQWH FRQ DTXHOODV SUHVWDFLRQHV \ GHO PLVPR
PRGR HQ TXH VH KDQ FRPSURPHWLGR /D VXSUHVLyQ GH ORV VHUYLFLRV QR SXHGH HQFRQWUDU MXVWL¿FDWLYR HQ HVWLSXODFLRQHV GH HVWD QDWXUDOH]D \
VXHMHUFLFLRQRSXHGHGHVYLUWXDUODQDWXUDOH]DGH
OD SUHVWDFLyQ PpGLFD FX\R GHVDUUROOR SUHVXSRQH DGHPiV HO FXPSOLPLHQWR GH DTXHOORV SUHVXSXHVWRV LQH[FXVDEOHV TXH LPSRQH XQD FRUUHFWD
DWHQFLyQ PpGLFD ,QFOXVR OD PDJQLWXG GH OD
supresión de determinadas prestaciones puede
constituir un atentado contra la integridad de la
SHUVRQDFXDQGRDSDUWLUGHHVWDVH[FOXVLRQHVVH
SULYHDOSDFLHQWHGHODVSRVLELOLGDGHVGHREWHQHU
ODFXUDFLyQGHVXHQIHUPHGDG´
3XHGHQTXHGDULQFOXLGRVGHQWURGHORVFRQFHSWRVDQWHULRUHVODGHQHJDWRULDDDTXHOORVHVWXGLRVTXHHODYDQFHGHODFLHQFLDFRQVLGHUDYiOLGRV\~WLOHVDXQTXHQRH[LVWLHVHQDODIHFKDGH
OD¿UPDGHOFRQWUDWRODQHJDWLYDDGHWHUPLQDGRV
WUDWDPLHQWRVDGXFLHQGROtPLWHGHHGDGODH[FXVDGHODSUHH[LVWHQFLD \GHQRPHGLDUFRQGXFWD
GRORVD HWF7RGRHOORGHEHUiVHUHYDOXDGRSRU
HODXGLWRUSDUDHOPRPHQWRHQTXHGHDFXHUGR
DODUHJODPHQWDFLyQGHOVLVWHPDGHEDDXWRUL]DU
RGHQHJDUSUiFWLFDSUHVWDFLyQWUDWDPLHQWRHWF
(VWRQRVLJQL¿FDDFWXDUFRQWUDODQRUPDWLYDGH
VX VLVWHPD SHUR Vt GHMDU IRUPDO FRQVWDQFLD GH
TXH OD QHJDWLYD SXGLHVH UHSUHVHQWDU XQ GDxR
FLHUWR R XQD SpUGLGD GH FKDQFH SDUD XQ D¿OLDGRGHPDQHUDWDOTXHGHLQVLVWLUHOVLVWHPDFRQ
ODGHQHJDWRULDVHDXQVXSHULRUDODXGLWRUHOTXH
DYDOHWDOUHFKD]R
3ULPHURFRPR\DVHGLMRH[LVWHHOGHEHUPpGLFR\ODVQRUPDVFRQVWLWXFLRQDOHV\OHJDOHVTXH
WXWHODQODYLGD\VDOXGGHORVKDELWDQWHV$SRVWHULRUL H[LVWLUiQ ORV UHJODPHQWRV 3HUR HQ FDVR
GH FRQÀLFWR HQWUH DPERV HVWi SHUIHFWDPHQWH
FODURTXpHVORTXHLQWHUSUHWDUiQORVWULEXQDOHV
< HV HO PpGLFR HO TXH GHEHUi GH¿QLU DQWH HVD
Contrato de Medicina prepaga%XHQRV$LUHV(G$VWUHD
9 - Gestión jurídico legal en organizaciones de atención de la salud / 233
GLV\XQWLYD VX SRVWXUD 6L OD GH¿QLFLyQ LPSOLFD
TXHDPRGRGHVDQFLyQTXHGHVLQWUDEDMRHVWiOD
-XVWLFLDTXHDXQTXHOHQWD\FRQJUDYHVSUREOHPDVSXHGHUHSDUDUPXFKDVYHFHVODVLQMXVWLFLDV
ODERUDOHV 3RUTXH HO PpGLFR FRQYLHQH UHFRUGDUORHVXQWUDEDMDGRU\FRPRWDOSXHGH\GHEH
ejercer sus derechos. Y fue por recurrir a esas
LQVWDQFLDVTXHORVFRQWUDWRVGHPHGLFLQDSUHSDJD QR VH FRQVLGHUDQ \D FRPR H[FOXVLYDPHQWH
SULYDGRVVLQRTXHHORUGHQS~EOLFR\DWUDYpV
GHODWXWHODMXUtGLFDGHODVDOXGHVWiFRUULJLHQGR
su asimetría.
&DEUtD KDFHU XQD DFRWDFLyQ TXH HV IXQGDmental en estos momentos. Se multiplican los
recursos de amparo por el criterio del común
TXHWRGDSUiFWLFDRSUHVWDFLyQSRUHOPHURKHFKR GH VHU UHDOL]DGD X REWHQLEOH GHELHVH VHU
GDGDHQIRUPDLQPHGLDWDSRUHOVLVWHPDGHVDOXG
VLQDWHQGHUVLHVWiRQRHVSHFt¿FDPHQWHLQGLFDGD
SDUDODSDWRORJtDGHOSDFLHQWHSRUHOJUDGRHYROXWLYRGHVXHQIHUPHGDGSRUHOHVWDGRELROyJLFR
GHOLQGLYLGXR\RWUDVGLYHUVDVYDULDEOHVPpGLFDV
$QWHGLFKR5HFXUVRGH$PSDURRGH0HGLGDV
&DXWHODUHVHQODVTXHHO-XH]¿MDXQSOD]RSHUHQWRULR D OD ,QVWLWXFLyQ GHPDQGDGD SDUD TXH
LQIRUPH DO UHVSHFWR GHEH GHFLUVH TXH ODPHQWDEOHPHQWHODPD\RUtDGHODVYHFHVGLFKRVHVtablecimientos no se presentan dentro de dicho
ODSVRRVHSUHVHQWDQSHURQRH[SOLFDQGHIRUPD
FDEDOODUD]yQGHODQHJDWLYDDFXEULUODSUHVWDFLyQHOIiUPDFRRODSUiFWLFDGHPDQGDGDVLQR
TXHVHOLPLWDQDH[SUHVDU³TXH ODPLVPDQR¿JXUDGHQWURGHO302´(VGHFLUDQWHHOGHUHFKR
a la atención de la salud esgrimen una razón adPLQLVWUDWLYDFULWHULRTXHSDUDOD-XULVSUXGHQFLD
HVLQH¿FD]\DTXHXQDPHGLGDDGPLQLVWUDWLYDQR
puede oponerse a un derecho constitucional.
/RTXHVtGHELHUDKDFHUVHHVHVSHFL¿FDUSRU
TXp HQ HVH GHWHUPLQDGR LQGLYLGXR HO D¿OLDGR
UHFODPDQWH WDOWLSRGHSUiFWLFDQRHVWiLQGLFDGD
RHVVXSHUÀXDSXQWXDOL]DQGRORVFULWHULRVPpGLFRVTXHOOHYDQDGLFKDFRQFOXVLyQ2ELHQSUHsentar las pruebas necesarias como para crear la
FRQYLFFLyQHQHOMX]JDQWHGHTXHGHQWURGHOVLVWHPDGHVDOXGTXHFXEUHDOD¿OLDGRGHPDQGDQWH
las prestaciones o prácticas están perfectamente cubiertas y son realizadas por determinados
SUHVWDGRUHVTXHUH~QHQORVUHTXLVLWRVGHFDOLGDG
e idoneidad necesarios.
$QWH GLFKDV HYLGHQFLDV FRQFUHWDV FODUDV \
DSR\DGDVHQFULWHULRVWpFQLFRVUDUDYH]HO-XH]
GDUiODUD]yQDOGHPDQGDQWHVLOOHJDDOFRQYHQFLPLHQWR SRU ORV GDWRV DSRUWDGRV GH TXH OR
H[LJLGRQRHVORHVSHFt¿FDPHQWHLQGLFDGRHQHO
HQIHUPRVXSDWRORJtD\HOJUDGRGHHYROXFLyQGH
pVWD2TXHODSUHVWDFLyQTXHGHPDQGD\UHTXLHUHHOD¿OLDGRSXHGHVHUFXELHUWD\EULQGDGDSRUHO
VLVWHPDGHVDOXGDOTXHpVWHHVWiD¿OLDGR
3HUR SDUD WRGR HOOR VH UHTXLHUH XQ VLVWHPD
GH UHVSXHVWD iJLO \ FLHQWt¿FDPHQWH IXQGDGR<
SUpVWHVHDWHQFLyQDTXHSRUORJHQHUDOHOSOD]R
ordenado por el magistrado para la presentación
GHOVLVWHPDGHVDOXGVRQyKVRDYHFHV
PHQRV GHVGH HO PRPHQWR HQ TXH VH QRWL¿FD D
la institución asistencial. De ahí la necesidad de
normatizar un circuito ante la recepción de las
&pGXODVGH1RWL¿FDFLyQ-XGLFLDOHVHQODVTXHGH
LQPHGLDWRGHEHQWRPDUFRQRFLPLHQWRODViUHDV
Jurídicas y Médicas de las instituciones de salud
SDUDTXHSXHGDDUELWUDUVHXQDUHVSXHVWDHIHFWLYD
y razonable a lo reclamado.
Obligación jurídica de obrar
([LVWHXQLQGXGDEOHPDUFRMXUtGLFRGRQGHSDUD
ORVPpGLFRVVHH[SOLFLWDODREOLJDFLyQGHDFWXDU
No es éste un terreno claro y si bien algunos paUiPHWURV VRQ QtWLGRV QR IDOWDQ ORV FODURVFXURV
TXH HQ GH¿QLWLYD VHUiQ UHVXHOWRV ±HQ FDVR GH
FRQÀLFWR±HQVHGHMXGLFLDO3HURDIXHUGHUHLWHUDWLYRVVHxDODPRVTXHPiVTXHFRQRFHU/H\HV
'HFUHWRVRLQFLVRVGH&yGLJRVHOPpGLFRGHEH
tener por norma conductual los parámetros étiFRVTXHKDFHQDVXSURIHVLyQ(QOD&LXGDGGH
%XHQRV$LUHV \ HQ RWUDV -XULVGLFFLRQHV ULJHQ
legislaciones semejantes o idénticas:
‡/H\GHHMHUFLFLRSURIHVLRQDOGRQGHHVSHFt¿FDPHQWHHQUHODFLyQDOWHPDGHOHStJUDIHOHHPRVHQVX$UW³/RVSURIHVLRQDOHV
TXHHMHU]DQODPHGLFLQDHVWiQVLQSHUMXLFLR
GHORTXHHVWDEOH]FDQODVGHPiVGLVSRVLFLRQHVOHJDOHVYLJHQWHVREOLJDGRVD $VLVWLU
DORVHQIHUPRVFXDQGRODJUDYHGDGGHVXHVWDGRDVtORLPSRQJD\KDVWDWDQWRHQFDVRGH
GHFLGLUODQRSURVHFXFLyQGHODDVLVWHQFLDVHD
posible delegarla en otro profesional o en el
VHUYLFLRS~EOLFRFRUUHVSRQGLHQWH´
‡&yGLJR3HQDO$UW³(OTXHSXVLHUHHQ
SHOLJURODYLGDRODVDOXGGHRWURVHDFRORFiQGRORHQVLWXDFLyQGHGHVDPSDURVHDDEDQGRnando a su suerte a una persona incapaz de
YDOHUVH\DODTXHGHEDPDQWHQHURFXLGDUR
D OD TXH HO PLVPR DXWRU KD\D LQFDSDFLWDGR
será reprimido con prisión de seis meses a
234 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
tres años. La pena será de reclusión o prisión
GHVHLVPHVHVDVHLVDxRVVLDFRQVHFXHQFLD
GHODEDQGRQRUHVXOWDUHXQJUDYHGDxRHQHO
FXHUSRRHQODVDOXGGHODYtFWLPD6LRFXUULHUDODPXHUWHODSHQDVHUiGHWUHVDGLH]DxRV
GHUHFOXVLyQRSULVLyQ´
El caso del médico se encuadra a las claras
–y así lo ha entendido la jurisprudencia– en
GHMDU H[SXHVWD D VX VXHUWH D XQD SHUVRQD
LQFDSD]GHYDOHUVH\DODTXHVHGHEDPDQWHQHU R FXLGDU (VWD REOLJDFLyQ HQ VX FDVR
SXHGH WHQHU YDULDV IXHQWHV SHUR IXQGDPHQWDOPHQWH HVWi LPSOtFLWD HQ HO $UW GH OD
OH\ DQWHV QRPEUDGD ([LVWH XQ GHEHU OHJDO
GH DVLVWHQFLD OD OODPDGD obligación jurídica de actuar.16 $WD] /ySH] H[SUHVD HQ XQ
SiUUDIRTXH³(QFRQVHFXHQFLDHOGHEHUH[
R¿FLRGHDFWXDUVHFRQYLHUWHHQXQDHVSHFLH
de contrapartida del monopolio profesional:
sólo los pertenecientes a éste pueden ejercer
OD PHGLFLQD SHUR DO PLVPR WLHPSR GLFKRV
0LHPEURV GHO PRQRSROLR SURIHVLRQDO TXH
son los únicos legitimados para el ejercicio
GHODPHGLFLQDWLHQHQHOGHEHUGHDFWXDUHQ
GHWHUPLQDGRV FDVRV \ HVWR HV DVt SRUTXH
FRPRVHKDGLFKRVLWRGRVORVSURIHVLRQDOHV
UHKXVDUDQSUHVWDUVXVVHUYLFLRVHOVHUYLFLRGH
S~EOLFDQHFHVLGDGTXHHVODDFWLYLGDGPpGLFD
QRIXQFLRQDULD´
‡&yGLJR&LYLO$UW³7RGDSHUVRQDTXH
SRUFXDOTXLHURPLVLyQKXELHUHRFDVLRQDGRXQ
SHUMXLFLRDRWURVHUiUHVSRQVDEOHVRODPHQWH
cuando una disposición de la ley le impusiere
ODREOLJDFLyQGHFXPSOLUHOKHFKRRPLWLGR´
7HQHPRVGHQWURGHODYDVWDMXULVSUXGHQFLD\D
DFXPXODGD XQ LQWHUHVDQWH IDOOR GH OD &RUWH
6XSUHPD GH OD SURYLQFLD GH %XHQRV $LUHV
“...En el campo de la responsabilidad del
médico frente al enfermo y en especial frente
DO FDVR GH FXOSD SRU RPLVLyQ OD LQWHUSUHWDFLyQOHJDOKDOOHYDGRDFUHDUHOFRQFHSWRGH
REOLJDFLyQ MXUtGLFD GH REUDU HQWHQGLpQGRVH
SRU WDO QR VyOR OD TXH OD OH\ FRQVDJUD VLQR
WDPELpQODLPSXHVWDSRUODUD]yQSRUHOHVWDdo de las costumbres y por la práctica de los
KRPEUHVSURERV´
¿Hasta dónde llega esa obligación? Sabemos
TXHHQFDVRVGHHPHUJHQFLDQRSRGHPRVQH16
$WD]/ySH]op. cit.SiJ
JDUQRVDDWHQGHUDXQHQIHUPRJUDYHRPRULEXQGRDXQTXHQRWHQJDPRVFRQTXpKDFHUOR
RDXQTXHHVFDSHSRUFRPSOHWRDQXHVWUDHVSHFLDOLGDG (Q GH¿QLWLYD OD REOLJDFLyQ PiV
TXHGHDWHQFLyQHVGHasistir assistireHVWDU
DOODGR \HVRVHUiORPiVTXHSRGDPRVKDFHU
GHPDVLDGDVYHFHV&RPRGHFtD-2UJD]³VHU
HOPpGLFRWpUPLQRKXPDQRTXHGH¿QHDOTXH
FXUDDOLYLDRDVLVWHKDVWDHO¿Q´
(OSUREOHPDVHSODQWHD\OOHYDDXQGLOHPD
pWLFRHQDTXHOSDFLHQWHO~FLGR\FDSD]TXH
QR TXLHUH UHFLELU GHWHUPLQDGRV FXLGDGRV
PpGLFRV(OPLVPRDUWLQF GHODOH\
GLFHGHIRUPDWD[DWLYD³5HVSHWDUOD
YROXQWDG GHO SDFLHQWH HQ FXDQWR VHD QHJDWLYDDWUDWDUVHRLQWHUQDUVHVDOYRORVFDVRVGH
LQFRQVFLHQFLDDOLHQDFLyQPHQWDOOHVLRQDGRV
JUDYHVSRUFDXVDGHDFFLGHQWHVWHQWDWLYDVGH
suicidio o de delitos. En las operaciones mutantes se solicitará la conformidad por escriWRGHOHQIHUPRVDOYRFXDQGRODLQFRQVFLHQFLD
RDOLHQDFLyQRODJUDYHGDGGHOFDVRQRDGPLWLHUHGLODFLRQHV(QORVFDVRVGHLQFDSDFLGDG
ORVSURIHVLRQDOHVUHTXHULUiQODFRQIRUPLGDG
GHOUHSUHVHQWDQWHRLQFDSD]´
&XDQGRHOSDFLHQWHHVDGXOWRKiELO\HVWiHQ
SOHQRJRFHGHVXVIDFXOWDGHVPHQWDOHVQRVH
lo puede obligar ni a tratarse ni a internarse. Algunos autores mencionan como ejemSOR DO SDFLHQWH TXH DQWH OD FHUWH]D GH XQD
HQIHUPHGDG FDQFHURVD QR GHVHD WUDWDPLHQWRV PXWDQWHV X RQFROyJLFRV ([SUHVDQ TXH
ODQHJDWLYDSRGUtDVHUVLQyQLPRGHFRQGXFWD
VXLFLGD\ORTXHHOPpGLFRKDUtDFRQVLQWLpQGRODVHUtDVLPSOHPHQWHIDYRUHFHURD\XGDUD
su concreción.
&RPR VH YH HO GLOHPD HVFDSD D OR OHJDO \
entra de lleno en lo ético. Nuestra postura es
TXHDQWHODVLWXDFLyQGHVFULWDWUDWiQGRVHGH
DGXOWRKiELO\HQSOHQRXVRGHVXOXFLGH]VH
debe respetar su decisión. Debe entenderse
con estricta obediencia el precepto ético de
la libre autonomía y respeto a las decisiones
GHOLQGLYLGXR\DTXHHOKRPEUHHVGXHxRGH
VXGHVWLQR\DQWHXQDGHFLVLyQWDOVLWXDFLyQ
OtPLWH GLUtD -DVSHUV SXHGH \ GHEH HOHJLU VX
camino.
Las modernas tendencias sobre derechos
KXPDQRV GDQ DPSOLR DYDO D HVWD FRQGXFWD
(QHODPELHQWHMXUtGLFRXQDYH]GHPRVWUD-
9 - Gestión jurídico legal en organizaciones de atención de la salud / 235
GRTXHHOPpGLFRH[SOLFLWySHUIHFWDPHQWHDO
SDFLHQWHODVLWXDFLyQORVFDPLQRVSURSXHVWRVORVEHQH¿FLRV\ODVSRVLELOLGDGHV\TXH
éste comprendió de modo cabal la situación
GH HOOR KDEODUHPRV HQ FRQVHQWLPLHQWR LQIRUPDGR TXHGDHOSURIHVLRQDOOLEHUDGRGH
ODGHFLVLyQ¿QDO6REUHWRGRTXHQRHVXQ
GHVYDOLGR QL XQ KXpUIDQR DO TXH GHEDPRV
SURWHJHUVLQRXQLQGLYLGXRTXHPiVDOOiGH
VXFXOWXUD\HGXFDFLyQHVXQVHUFRQOLEHUWDG\GLVFHUQLPLHQWRGHSUHYHU\GHFLGLUVX
destino.
<SDUDWHUPLQDUHODFiSLWHWUDQVFULELPRVXQD
VHQWHQFLDTXHWUDGXFHELHQORTXHUHSUHVHQWD
la obligación jurídica de actuar:
³(QFDVRVJUDYHV\XUJHQWHVHOPpGLFRHVWi
REOLJDGRDSUHVWDUVXR¿FLRFXDQGRHVUHTXHULGR\HQFDVRQHJDWLYRVXUJHVXUHVSRQVDELOLGDGFLYLOH[WUDFRQWUDFWXDO5HJODPHQWRGH
SRUPHGLRRQRFRQRVLQSDJRGHODQWLFLSR
SRUHOWUDEDMRSURIHVLRQDOHOPpGLFRHQFX\DV
manos estaba en ese momento contribuir a la
VDOYDFLyQ GH XQ VHU KXPDQR GHELy FXPSOLU
DQWHWRGRFRQVXGHEHUSURIHVLRQDO\PRUDO
DIURQWDQGRFXDOTXLHUUHVSRQVDELOLGDGHQTXH
SXGLHUD LQFXUULU IUHQWH D ODV DXWRULGDGHV GH
ODLQVWLWXFLyQGRQGHSUHVWDEDVHUYLFLRVSRUOD
YLRODFLyQGHXQDGLVSRVLFLyQDGPLQLVWUDWLYD´
& $SHO &LY \ &RP 6DQ 0DUWtQ 6DOD ,
(' 4XHGH WDPELpQ HQ FODUR TXH HO QRDFWXDU
ante la inconsciencia o alienación del paFLHQWHRSRUODFDUHQFLDGHDXWRUL]DFLyQSRU
SDUWH GH IDPLOLDU KiELO QR VH MXVWL¿FD HQ
FDVRVGHJUDYHGDGRSHOLJURLQPLQHQWHGH
vida GRQGH H[LVWDQ WHUDSpXWLFDV SUHFLVDV
LQGLFDGDV \ TXH HQ SULQFLSLR WLHQGDQ UD]Rnablemente a resguardar el bien vida 7DO
autorización o permiso se desprende de forma indirecta de lo preceptuado en el &yGLJR
Penal. art. 34, inc. 4.³1RVRQSXQLEOHV (OTXHREUDUHHQFXPSOLPLHQWRGHXQGHEHU
RHQHOOHJtWLPRHMHUFLFLRGHVXGHUHFKRDXWRULGDGRFDUJR´
médico debían estar estipulados en forma escrita
RWiFLWDRVLVLPSOHPHQWHVHUHJtDQSRUHOSULQFLSLR JHQpULFR GH JHQHUDU EHQH¿FLR \ QR FDXVDU GDxR D RWUR UHODFLyQ H[WUDFRQWUDFWXDO /D
GLVWLQFLyQ QR HV PHUDPHQWH DFDGpPLFD SXHVWR
TXHVHJ~QVHDXQRXRWURHOHQFXDGUHYDULDUiD la extensión de la reparaciónE la obligación
de la llamada carga de la prueba (es decir, a
quién corresponde probar la culpa del incumplimiento)\F la prescripción, entendiendo por
tal el plazo que se extiende desde la comisión
del presunto daño hasta su extinción espontánea, si no se han iniciado acciones: diez años en
la responsabilidad contractual y dos años en la
extracontractual.8QHMHPSOREXUGRDFODUDUiOD
FXHVWLyQ8QLQGLYLGXRTXHVHSUHVHQWDDOFRQVXOWRULRGHXQSURIHVLRQDOFRPRSDFLHQWHFDSD]\
FRPSHWHQWHDFHSWDVHUH[DPLQDGRDFHSWDKDFHU
HVWXGLRVFXPSOHODVLQGLFDFLRQHVHWFHWF\SRU
VXSDUWHHOPpGLFRVHREOLJy GHPRGRWiFLWR D
SRQHUORPHMRUGHVtPLVPRGHVXFLHQFLD\VDSLHQFLDDPERVHQHVWHFRQWH[WRKDQGDGROXJDU
a la conformación no escrita de un contrato médicoHVGHFLUXQDUHODFLyQcontractual \HVWR
HVWiVHQWDGRHQODMXULVSUXGHQFLD &XDOTXLHULQcumplimiento por parte del médico de esas obliJDFLRQHVDODVTXHGHEtDDMXVWDUVHVLHOSDFLHQWH
VH DJUDYD R PXHUH H[LVWH XQD UHVSRQVDELOLGDG
a priori del primero por incumplimiento de sus
REOLJDFLRQHV6LHOUHVXOWDGRHVXQDJUDYDPLHQWR
o la aparición de un problema o patología no esSHUDGDHOSDFLHQWHSXHGHUHFXUULUDOIXHURFLYLO
SDUD H[LJLU XQD UHSDUDFLyQ SRU LQFXPSOLPLHQWR
GHO FRQWUDWR ±TXH GHEHUi GHPRVWUDUVH 3HUR VL
IDOOHFHSRUGLFKDFDXVD\HQUD]yQGHTXHHOFRQWUDWRVXSRQHTXHVHWUDWyGHXQFRQYHQLRGHGRV
±SDFLHQWHPpGLFR±HOGHUHFKRKDELHQWH FyQ\XJH SDGUH PDGUH HWF SRGUi UHFXUULU D H[LJLU
LQGHPQL]DFLyQEDMRHODPSDURGHODUHODFLyQH[WUDFRQWUDFWXDOHQUD]yQTXHHOPpGLFRQRUHDOL]y
ningún contrato con el paciente pero se siente
perjudicado por el fallecimiento de esa persona.
1XQFDHVWDQH[DFWRSHURHOHMHPSORYDOHFRPR
FULWHULR JHQHUDO 'H KHFKR XQ SDFLHQWH TXH QR
KD IDOOHFLGR SHUR TXH SRU HMHPSOR TXHGy FRQ
VHYHUDLQFDSDFLGDGSXHGHGHPDQGDUDVXPpGLFRSRUWRGRVORVGDxRV\SHUMXLFLRVXIULGRV\HO
EL CONTRATO MÉDICO
cónyuge accionar también contra el mismo pro6HGHEHGH¿QLUGHVGHORMXUtGLFRTXpWLSRGHUH- IHVLRQDOSRUGDxRPRUDORSVLFROyJLFRGHULYDGR
lación une al médico con el paciente. Mucho se del deterioro del paciente.
(V FULWHULR XQiQLPH \ SDFt¿FR TXH VDOYR
KD KDEODGR D WUDYpV GH ODV pSRFDV DFHUFD GH VL
HVWDUHODFLyQHUDGHWLSRFRQWUDFWXDOHVGHFLUORV FDVRV HVSHFLDOHV OD UHODFLyQ PpGLFRSDFLHQWH
derechos y obligaciones entre el paciente y el VH HQFXDGUD HQ XQ PDUFR FRQWUDFWXDO GHQWUR
236 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
de una forma atípica llamada contrato médico.
'HFLPRV DWtSLFD SRUTXH QL HQ HO &yGLJR &LYLO
ni en ningún otro ordenamiento superior se con¿JXUDGHIRUPDHVSHFt¿FDHVWHWLSRGHUHODFLyQ
FRQFUHWDGHDKtTXHHOFULWHULRHVWpGDGRSRUHO
peso de la jurisprudencia. Con este contrato y
FRPRELHQGLFH$FKDYDO³VHYLQFXODDOPpGLFRHQVXUHVSRQVDELOLGDGFRQHOSDFLHQWHFRQ
él se pretende obligar al médico y así se mencioQDQODVREOLJDFLRQHVGHPHGLRVRGHGLOLJHQFLD
las obligaciones de resultados o determinadas y
también las obligaciones de seguridad debida
por el hecho de las cosas que usa´
&ODURTXHGHQWURGHHVWDVJHQHUDOLGDGHVH[LVWHQQRWDEOHVYDULDQWHVWLSRVGHPpGLFRV JHQHUDOLVWDVHVSHFLDOLVWDV PRGDOLGDGHVGHDWHQFLyQ
SDWRORJtDV WUDWDGDV UHODFLRQHV GLUHFWDV HQWUH
SDFLHQWH \ PpGLFR R DTXHOODV TXH WLHQHQ FRPR
LQWHUPHGLDULDVDLQVWLWXFLRQHV±\DVHDQHVWDWDOHV
de obras sociales o de empresas de medicina
SUHSDJDHWF7RGRHOORGDXQDLGHDGHORFRPSOHMRGHODWUDPD\GHOSRUTXpGHODVGLVFXVLRQHV
acerca del encuadre conceptual de dicho contraWRDVtFRPRGHVX¿QDOLGDG
Efectos o implicancias
de la obligación asumida
¢(VHOREMHWLYRRHO¿QGHOFRQWUDWRDOFDQ]DUXQ
UHVXOWDGRHVSHFt¿FRHVWRHVXQDREOLJDFLyQGH
resultado? ¿O es un compromiso por parte del
médico de poner lo mejor de sí y de su ciencia
para el diagnóstico y tratamiento de una determinada afección –obligación de medios?
,QVLVWLPRV HQ TXH MXUtGLFDPHQWH VH WLHQGH D
considerar la relación médico-paciente como un
FRQWUDWRGHFDUDFWHUtVWLFDVSHFXOLDUHVQRGHVFULWRGHPRGRWD[DWLYRHQFyGLJRDOJXQRSHURSRU
HOTXHXQDSDUWH±el médico– se obliga a poner
ORPHMRUGHVt\GHVXFLHQFLDDFRUGHDOWLHPSR
OXJDU\FLUFXQVWDQFLDVGHODSUHVWDFLyQD¿QGH
LQWHQWDU OD FXUDFLyQ GHO SDFLHQWH FRPSURPHtiéndose la otra parte –el enfermo o acreedor– a
FXPSOLUFRQODVSUHVFULSFLRQHV\PDQGDWRV\D
retribuir por sí o por instituciones intermedias
±2EUD6RFLDO6DQDWRULR3UHSDJDHWF±ODDWHQFLyQ UHFLELGD TXHGDQGR LQFOXLGD WDPELpQ HVWD
relación en establecimientos públicos.
4XHGHWDPELpQHQFODURTXHHQODPD\RUtD
GHORVFDVRVHQWHQGLHQGRTXHHOPpGLFRDVXPH
por lo general una obligación de medios\TXH
esta obligación la concreta en base al cumpliPLHQWRGHWRGDVODVUHJODVGHODUWH\ODFLHQFLD
VHUiLQGLIHUHQWHTXHVHDOFDQFHRQROD¿QDOLGDG
SHUVHJXLGD(VWRHVODFXUDFLyQGHOSDFLHQWH(O
SURIHVLRQDO VH REOLJD D OD SUHVWDFLyQ GLOLJHQWH
DGHFXDGD FLHQWt¿FDPHQWH DFHSWDGD \ SHUIHFWDPHQWHDSOLFDGDGHOGHORVPpWRGRVLQGLFDGRVHQ
el caso en particular.
'LVWLQWRHVHOFDVRHQFLHUWDVHVSHFLDOLGDGHV
SRUHMHPSORFLUXJtDSOiVWLFDDQiOLVLVGHODERUDWRULR H[iPHQHV DQDWRPRSDWROyJLFRV DQiOLVLV
FOtQLFRVHWFHQODVTXHSXHGHH[LVWLUXQDobligación de resultado\DTXHSRUODSURSLDQDWXUDOH]DGHODVSUHVWDFLRQHVORTXHVHEXVFDHQHOODV
HVREWHQHUXQ¿QFRQFUHWRTXHHQXQDOWRSRUFHQtaje puede ser perfectamente alcanzado. Debe
DFRWDUVHTXHSDUWHGHODMXULVSUXGHQFLDFRQVLGHUD
TXH LQFOXVR HQ SHTXHxDV LQWHUYHQFLRQHV R D~Q
HQORVSDUWRVQRUPDOHVHQPXMHUHVVDQDVHVWDQ
UHPRWDODSRVLELOLGDGGHIUXVWUDFLyQTXHGHEHrían caer en esta obligación de resultados.
Éste sería un encuadre general dado por la
MXULVSUXGHQFLDDFWXDOORTXHQRVLJQL¿FDTXHVHD
GHDSOLFDFLyQREOLJDWRULD\DTXHHQFDGDFDVRHQ
SDUWLFXODU VHUi HO MX]JDGRU HO TXH DWULEX\D UHVponsabilidades –con la consecuente reparación
del daño– en casos de demandas o juicios por
UHVSRQVDELOLGDGPpGLFD 'HEHFRQVLGHUDUVHTXH
HQHVWDVDUHQDVPRYHGL]DVGHODFXOSDWLSRVGH
REOLJDFLyQIRUPDVGHFRQWUDWRHWFVHVXVFLWDQ
arduas discusiones entre los especialistas en
HVWRV WHUUHQRV MXUtGLFRV GH OD ¿ORVRItD GHO GHUHFKR \ HQ XQD VHULH GH FXHVWLRQHV PiV HQ ODV
TXHORVPpGLFRVVyORVRPRVHVSHFWDGRUHV%LHQ
GLFH%XHUHV³QRKD\GXGDGHTXHORVPpGLFRV
OHJLVWDVVLSRQHPRVDKRUDHODFHQWRVREUHHOORV
GHEHQTXHGDUVHFRQODPHGLFLQDOHJDOTXHQRHV
SRFR\GHMDUSDUDORVTXHVDEHQHOHVWXGLRGHORV
GHEHUHVUHSDUDWRULRVJDOpQLFRV´
(VFRQYHQLHQWHSRUHMHPSORFRPRPXHVWUD
de opiniones dispares en el terreno de las obliJDFLRQHVGHOFLUXMDQRFLWDUHOIDOORGHOD&1
&LY6DOD&GRQGHFRQHOYRWRGHO'U
&LIXHQWHVVHGLFH³6HSXHGHGLYLGLUHQWUHVVHFtores a la cirugía médica; trata una de la dirigida
D REWHQHU XQ UHVXOWDGR WHUDSpXWLFR 7LHQH SRU
¿QDOLGDG HO RWUR EHQH¿FLDU D WHUFHURV FDVRV
GHWUDQVSODQWHV \HQWHUFHUOXJDUODTXHEXVFD
XQPHMRUDPLHQWRH[WHUQRGHODEHOOH]DFRUSRUDO
Responsabilidad Civil del Médico%XHQRV$LUHV(G$EHOHGR3HUURW
9 - Gestión jurídico legal en organizaciones de atención de la salud / 237
llamada cirugía estética... En ninguna de las tres
FODVHVRSHUDWRULDVGHVGHHOSXQWRGHYLVWDGHOD
MXVWL¿FDFLyQMXUtGLFD\GHODKDELOLWDFLyQPpGLFD
SDUDDFWXDUTXLU~UJLFDPHQWHHVSRVLEOHSUHVFLQGLUGHOUHVXOWDGR´
2EVpUYHVHFyPRGL¿HUHHOHQFXDGUHGDGRSRU
HVWHMXULVWDGHORTXHKDEODPRVVREUHREOLJDFLyQ
GH PHGLRV HQ JHQHUDO *KHUVL D¿UPD
³+HPRV VRVWHQLGR TXH HO FRQWHQLGR GHO REMHWR
de la obligación es siempre una conducta… La
REOLJDFLyQPHGLFD(QVHQWLGRHVWULFWRHOODFRQVLVWLUiHQTXHODFRQGXFWDFLHQWt¿FDPHQWHFRQVLGHUDGDXWLOLFHWpFQLFDVXVXDOHV\DGPLWLGDVSRU
ODPHGLFLQDWHQGLHQWHVDODFXUDFLyQGHODGROHQFLDRPLWLJDFLyQGHOGRORUGHXQVHUKXPDQR´
5HFXpUGHVHWDPELpQTXHODPHQFLRQDGDFRQducta del profesional se debe caracterizar por la
DGHFXDGDDGRSFLyQGHORVGHEHUHVTXHHO&yGLJR
GHeWLFD¿MDDORVPpGLFRVFODUDFRQFLHQFLDGH
ORV UHTXHULPLHQWRV GHO HQIHUPR DQiOLVLV GH VX
propia aptitud y límites para tratar el caso con
WLHPSR\GHGLFDFLyQVX¿FLHQWHVSDUDHVWXGLDU\
DQDOL]DUOR FLHQWt¿FDPHQWH XVR SUXGHQWH \ QHFHVDULR GH WRGRV ORV PHGLRV GLDJQyVWLFRV TXH
HOFDVRUHTXLHUD\UHDOL]DUODSUHVWDFLyQFRQORV
PpWRGRV DGHFXDGRV QR GH PDQHUD VXSHU¿FLDO
DSXUDGDRSRUTXHVtVLQRFRQORVFRUUHFWRV1R
HVQLpWLFDQLMXUtGLFDPHQWHDFHSWDEOHH[FXVDUVH
GLFLHQGRTXH³VHKL]RORKDELWXDORORTXHKDFH
ODPD\RUtD´6HGHEHKDFHUORGHELGRORLQGLFDGRHQFDGDFDVR\FLUFXQVWDQFLD\TXHODFLHQFLD
médica repute como conducta apropiada.
La reparación por la responsabilidad médica
/OHJDGR HO FDVR HO HMH GH OD FXOSDELOLGDG GHO
PpGLFRSDVDUiSRUXQSXQWRIXQGDPHQWDOWDOHO
error inexcusable6HFRQ¿JXUDUiQDVtDJUDQGHV
UDVJRV ODV IRUPDV R ¿JXUDV H[SOLFLWDGDV HQ HO
apartado 01.1.4 HQ TXH SRGUi HQFXDGUDUVH OD
FRQGXFWDGHOSURIHVLRQDOJHQHUDGRUDGHGDxR\
FRPR WDO SDVLEOH GH OD REOLJDFLyQ GH VHU UHSDUDGDV HQ IRUPD GLQHUDULD VLQ TXH HOOR H[FOX\D
RWUDVVDQFLRQHVGHWLSRSXQLWLYR
5HLWHUDQGRORD¿UPDGRPDVDUULEDHQWpUPLQRVJHQHUDOHVODFRQGXFWDGHOPpGLFRHQVXGLDrio desempeño puede catalogarse como enmarFDGDGHQWURGHXQFRQWUDWRPpGLFR\SRUHQGH
se deben juzgar sus resultados dentro del marco
FRQFHSWXDOGHGLFKDUHVSRQVDELOLGDGTXHVHFDWDORJDUiFRPRFRQWUDFWXDO6LQHPEDUJRQRSXHGH
LJQRUDUVHTXHKD\RFDVLRQHVHQTXHODUHODFLyQ
QRUHXQLUiHVWRVUHTXLVLWRV\SRGUiKDEODUVHHQ-
WRQFHVGHUHVSRQVDELOLGDGH[WUDFRQWUDFWXDOSRU
HMHPSORHOFDVRGHODDWHQFLyQTXHGHEDUHDOL]DU
XQPpGLFRGHXUJHQFLDRHQODYtDS~EOLFD\DOD
TXHVHYHIRU]DGRQRHQYLUWXGGHFRQWUDWRSUHYLRVLQRGHODobligación de actuar\DYLVWD
Para analizar la conducta médica reprochaEOHTXHGpOXJDUDODFDOL¿FDFLyQGHGDxR\SRU
HQGH D OD REOLJDFLyQ GH UHSDUDU GHEHUiQ DQDOLzarse tres supuestos:
‡/DFRQGXFWDSUHVXQWDPHQWHUHSURFKDEOH
‡HOGDxRLQIHULGR\
‡ODUHODFLyQFDXVDO
&RQUHVSHFWRDODFRQGXFWDRKHFKRKXPDQR
debemos agregar a todo lo dicho hasta acá un
QXHYR HOHPHQWR DSHQDV HVER]DGR FRQ DQWHULRULGDG \ TXH HV HO GDxR RULJLQDGR SRU OD cosa.
&RQODSURJUHVLYDWHFQL¿FDFLyQGHOD0HGLFLQD
HO PpGLFR VH YDOH FDGD YH] PiV GH HTXLSRV R
LQVWUXPHQWRV TXH HQ VX FRPSOHMLGDG FRQOOHYDQ
WDPELpQ HOHYDGR JUDGR GH ULHVJR (O SURIHVLRQDOVHUiUHVSRQVDEOHSRUORVGDxRVTXHpVWH±la
cosa± FDXVH DO SDFLHQWH \D VHD SRU GH¿FLHQWH
QHJOLJHQWHRPDOPDQHMRGHODPLVPD RVHDOD
UHVSRQVDELOLGDG VXEMHWLYD con la cosa R GH OD
UHVSRQVDELOLGDG REMHWLYD SRU HO YLFLR R ULHVJR
creado por la cosapVWH~OWLPRSRUHMHPSORDQWH
los daños ocasionados por desperfectos técnicos
LPSUHYLVWRV\V~ELWRVTXHSXHGHQRFDVLRQDUSRU
sí mismo dichos instrumentos.
'HFXDOTXLHUPDQHUDVHYXHOYHDLQVLVWLUHQ
XQFRQFHSWRTXHHVFODYH$OPpGLFRQROHFRPpete analizar jurídicamente todas las situaciones
SRVLEOHVORVDWHQXDQWHV\RDJUDYDQWHVGHFDGD
FDVRHQSDUWLFXODU/HFRPSHWHHQEDVHDVXVGHEHUHV pWLFRV \ D VX FRQGXFWD WpFQLFD \ FLHQWt¿FDPHQWHFRUUHFWDKDFHUORTXHHVWpDVXDOFDQFH
dentro de las limitaciones de tiempo y lugar. No
será igualmente juzgada la conducta de un médiFRHQXQDPELHQWHKRVSLWDODULRFRQFDUHQFLDVGH
WRGRWLSR\SRUWRGRVFRQRFLGDVTXHODGHDTXHO
RWUR SURIHVLRQDO TXH WUDEDMDQGR HQ XQ FHQWUR
SULYDGRLQVWLWXFLyQFX\DMXVWL¿FDFLyQ~OWLPDGHO
OXFURTXHDFXPXODQHVODH[FHOHQFLDHQODFDOLGDG
GHODPHGLFLQDRIUHFLGD\GRQGHSRUHQGHGHEH
GLVSRQHUGHWRGRVORVHOHPHQWRVTXHODFLHQFLD\
técnica pueden aportar en ese momento y en ese
lugar. Si el médico actuante en ese sitio se enIUHQWD D FDUHQFLDV TXH SXHGHQ FRPSURPHWHU VX
FRUUHFWR GHVHPSHxR GHEH FODUDPHQWH R FRPXQLFDUDODVDXWRULGDGHVGHOFHQWURODGH¿FLHQFLD
SDUDTXHODVROXFLRQHQRGHULYDUGHLQPHGLDWR
238 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
DOSDFLHQWHEDMRODFDUJDGHVHUFRQVLGHUDGRFR
UHVSRQVDEOHGHORVGDxRVTXHSXGLHVHQVREUHYHQLUSRUGLFKRGp¿FLWRFDUHQFLDHVWUXFWXUDO
La carga de la prueba
¢4XLpQGHEHSUREDUODH[LVWHQFLDGHODFXOSDR
LQFXPSOLPLHQWRGHOFRQWUDWRHVGHFLUODOODPDda carga de la prueba"+DVWDQRKDFHPXFKR
OD MXULVSUXGHQFLD VHQWDED TXH FRUUHVSRQGtD DO
acreedor –el paciente– la obligación de probar
ODPDODSUD[LVRFXOSDLQIHULGDSRUHOSURIHVLRQDO VLQ SHUMXLFLR GH TXH pVWH DUULPDUD WRGRV
ORV HOHPHQWRV TXH D\XGDUDQ HQ VX GHVFDUJR
3HUR SDXODWLQDPHQWH VH YD DEULHQGR FDPLQR
XQDQXHYDYLVLyQGHQWURGHO'HUHFKRTXHWLHQH
TXHYHURHVWiUHODFLRQDGDFRQODOODPDGDteoría
de la carga probatoria 6HJ~Q GLFH 9i]TXH]
)HUUH\UD ³/R TXH TXHUHPRV GHFLU HV TXH HO
JUDQSUREOHPDDOTXHDKRUDQRVHQIUHQWDPRVGH
OOHQR HV HO TXH VH UH¿HUH D TXLpQ WLHQH OD FDUga de la prueba del factor de atribución en la
UHVSRQVDELOLGDGFLYLOPpGLFDORTXHVHUHVXHOYH
HQ SUHFLVDU VL HV HO SDFLHQWH HO TXH GHEH SUREDUODFXOSDGHOJDOHQRRVLHVpVWHTXLHQGHEH
SUREDU TXH DFWXy GLOLJHQWHPHQWH (Q UHDOLGDG
ambas partes deben desplegar o brindar todo su
esfuerzo probatorio en uno u otro sentido para
TXHHQGH¿QLWLYDHO-XH]GHFLGDVLKD\FXOSDQR
FXOSDRFDVRIRUWXLWR´
(VWR LPSOLFD TXH QXHYRV FRQFHSWRV HVWiQ
LUUXPSLHQGR HQ HVWH WHUULWRULR HQ TXH OD FDUJD
de la prueba caía en la cabeza del paciente. Es
FRP~QHQODDFWXDOLGDGTXHFRQHODGYHQLPLHQto de las llamadas cargas probatorias dinámicas
FRQFHSWR HPLQHQWHPHQWH MXUtGLFR TXH LPSOLFD
±\ GH PRGR DSUR[LPDGR± TXH HO PDJLVWUDGR
SXHGH REOLJDU D FXDOHVTXLHUD GH ODV SDUWHV D
FRODERUDU DFWLYDPHQWH VXPLQLVWUDQGR WRGDV ODV
SUXHEDVQHFHVDULDV VHDHOSURIHVLRQDOTXHDFWXy
HOTXHGHEDDSRUWDUODSUXHEDSRUHOcómo y el
cuántoGHGLFKDFRQGXFWDSRUVHUHOTXHHVWiHQ
mejor condición de producirla. Es clásico como
ejemplo el caso de los hechos acaecidos dentro
GHOTXLUyIDQRGRQGHHOSDFLHQWHSRUORJHQHUDO
está dormido y nada puede aportar ante una presunta negligencia o impericia de los profesionaOHVDFWXDQWHV6HUiHQWRQFHVHO-XH]TXLHQGHWHUPLQHEDVDGRHQHVWULFWRVLPSHUDWLYRVGHMXVWLFLD
DTXLpQFRUUHVSRQGHHQFDGDFDVRHQSDUWLFXODU
la prueba de los hechos alegados.
Presunciones de culpa
(QHOiPELWRGHO)XHUR3HQDOWRGDVODVSHUVRQDV
tienen derecho a la presunción de su inocencia
–o sea su inculpabilidad– hasta tanto no recaiga
VHQWHQFLD¿UPHHQODFDXVD(VGHFLUTXHODVSUHVXQFLRQHVTXHVHUtDQYiOLGDVVRQDTXHOODVTXHKDEODQGHODLQRFHQFLD3HURHQHO)XHUR&LYLOH[LVWH
una tendencia jurisprudencial otorgando –y en
FDVRVH[FHSFLRQDOHV±DODVSUHVXQFLRQHVGHFXOSD
XQ YDORU HVSHFt¿FR HQ FXHVWLRQHV FRPR ODV TXH
HVWDPRVWUDWDQGR(QSULQFLSLR\GHVGHHOSXQWR
GH YLVWD GRFWULQDULR OD SUHVXQFLyQ GH LQRFHQFLD
MXHJDHQHOSURFHVRSHQDOSRUORTXHXQDLPSRUWDQWHMXULVSUXGHQFLDDYDODTXHSDUDODyUELWDGHO
&yGLJR&LYLOHVWDVSUHVXQFLRQHVGHFXOSDSXHGHQ
WDPELpQHQFXDGUDUVHHQODPLVPDyUELWDWDOFRPR
VHYHHQHODUWtFXORFRQUHVSHFWRDODSUHVXQción de culpa del dueño o guardián de una cosa
supuestamente productora de un daño.
<HVWRDIHFWDSRUVXSXHVWRDTXHOODVFDXVDV
GHUHVSRQVDELOLGDGPpGLFDHQTXHQRHVSRVLEOH
poner la prueba de la culpa enteramente en cabeza del acreedor GHPDQGDQWHRSUHVXQWRGDPQL¿FDGR SRU OD FRQGXFWD PpGLFD (Q HIHFWR
SDUDODOH\H[LVWHXQDQHWDGHVYHQWDMDGHDTXHO
DQWHHODFWRPpGLFR\DTXHWLHQHTXHGHPRVWUDU
la culpaGHOSURIHVLRQDOHQWHPDVHQTXH\SRU
UHJOD JHQHUDO HV XQ SURIDQR DEVROXWR 0XFKR
PiV FXDQGR SRU HMHPSOR HO KHFKR VH VXVFLWy
HQXQTXLUyIDQRGRQGHDGHPiVGHVHUXQOXJDU
FHUUDGR HO SDFLHQWH HVWi DQHVWHVLDGR (Q FRQVHFXHQFLD\SDUDODOH\³VHGDDVtXQDWtSLFD
UHODFLyQGHH[SHUWRIUHQWHDSURIDQRHQODFXDO
ODEDODQ]DGHODMXVWLFLDGHEHIDYRUHFHUDO~OWLPR
por la situación de debilidad de conocimientos
HQTXHVHHQFXHQWUD´ Esta tendencia de mayor
SURWHFFLyQDOSDFLHQWHYtFWLPDVHHQURODHQXQD
FRUULHQWHPiVDPSOLDTXHLQXQGDHOGHUHFKRGH
daños. Es el favor victimae op. cit. \VLJQL¿FD
TXHVHUiHOPpGLFRHOTXHGHEHUiGHPRVWUDUTXH
DFWXyVLQFXOSDHVGHFLUTXHVXFRQGXFWDIXHOD
FLHQWt¿FDPHQWHFRUUHFWDSDUDODVFLUFXQVWDQFLDV
de lugar y tiempo.
Con respecto a este término no debe haber
FRQIXVLyQ TXH VXHOH QDFHU GH ORV LQWHUHVHV HQ
9i]TXH])HUUH\UDop. citSiJ
9i]TXH])HUUH\UD5Prueba de la Culpa Médica%XHQRV$LUHV(G+DPPXUDEL
9 - Gestión jurídico legal en organizaciones de atención de la salud / 239
juego y no de la real acepción. No se trata de
SHQDOL]DUQLODIXQFLyQGHXQMXLFLRFLYLOHVVDQFLRQDU R FDVWLJDU VLQR PHUDPHQWH UHVDUFLU 'H
PDQHUD TXH OD LQWHUSUHWDFLyQ MXUtGLFD ±\ HQ HO
FDPSR FLYLO± GH HVWH WpUPLQR LQYHUVLyQ GH OD
FDUJDHVVLPSOHPHQWHODUHDOLGDGGHTXHDTXpO
TXHHVWpPiVFDSDFLWDGRSDUDKDFHUORVXPLQLVWUH
WRGRVORVGDWRV\RHOHPHQWRVSRVLEOHVSDUDD\Xdar al juez a tomar una decisión.
Eximentes de la culpabilidad
(OPpGLFRSRGUiHQVXDOHJDWRSDUDUHFKD]DUOD
UHVSRQVDELOLGDGDGXFLGDHQVXFRQWUDSUREDUOD
presencia de la no culpa o bien del caso fortuito. La primera se satisface con la demostración
IHKDFLHQWH \ FRQFUHWD GH TXH REUy FRQIRUPH D
WRGDV ODV UHJODV GHO EXHQ FULWHULR PpGLFR GHO
VDQR GLDJQyVWLFR \ GH OD SUHYHQFLyQ \ FXLGDGR
HQWRGDVODVHWDSDVTXHOHWRFyLQWHUYHQLU1XQFD
estará de más insistir en la imperiosa necesidad
GH DQRWDU \ OOHYDU WRGRV ORV UHJLVWURV \ SDUWHV
PpGLFRVHQIRUPDPHWyGLFDRUGHQDGD\OHJLEOH
*UDYHLQGLFLRGHFXOSDELOLGDGFDUJDUiVREUHVt
VLDQWHXQFDVRGHQXQFLDGRHQFRQFUHWRHOSURIHsional no puede presentar testimonios de su acFLRQDUGHQWURGHOPDUFRGHORTXHUHSUHVHQWDOD
FRQGXFWDFLHQWt¿FD\UHVSRQVDEOH<HQWLpQGDVH
SRUWHVWLPRQLRQRVXSDODEUDVLQRHOUHÀHMRFRWLGLDQRGHVXDFFLRQDUTXHGHEHTXHGDULPSUHVR
HQ OD +LVWRULD &OtQLFD HOHPHQWR IXQGDPHQWDO
QR VyOR GHO WLSR PpGLFR VLQR FRPR SUXHED GH
H[LPHQWH OHJDO /D PHGLFLQD QR HV XQD FLHQFLD
H[DFWD$XQ HO DSDUHQWH FDVR LGpQWLFR WLHQH VX
SURSLD HYROXFLyQ R GLQiPLFD TXH KDFH TXH OD
mejor conducta médica se frustre ante lo impreYLVLEOHRORVDUFDQRVGHODELRORJtDSRUORTXH
el detallado historial de todo lo sucedido será el
mejor aliado del médico para probar su no culpa<SRU~OWLPRVHHQWLHQGHSRUFDVRIRUWXLWR
DTXHOGHFDUDFWHUtVWLFDVLPSUHYLVLEOHV'LFKRHQ
IRUPDWpFQLFDDTXHO³TXH QRSXGRVHUSUHYLVWR
R D~Q SUHYLVWR QR SXGR VHU HYLWDGR´< XQ UHFRUGDWRULRTXHHVPDQGDWRULR'LFHQORVOHWUDGRV
TXH³VyORH[LVWHORTXHHVWiHQHOH[SHGLHQWH´<
HVHQYHUGDGDVt
Responsabilidad compartida
Distintas posibilidades se presentan en base a toGDVODVYDULDQWHVTXHODDWHQFLyQPpGLFDDVXPH
HQODDFWXDOLGDGPpGLFRVTXHDWLHQGHQGHIRUPD
SDUWLFXODUGHSHQGLHQWHVGHXQD2EUD6RFLDOGH
XQ6DQDWRULRXQLGRVSRUFRQWUDWRVGHSUHVWDFLyQ
DHQWHV6RFLDOHVR3ULYDGRVPpGLFRVGHKRVSLWDOHVHVWDWDOHVRGHFRPXQLGDGMHIHVGHHTXLSR
HWF/DVYDULDQWHVVRQFDVLWDQWDVFRPRIRUPDV
GHSUDFWLFDUODPHGLFLQDH[LVWHQKR\
+D\ XQ SULQFLSLR IXQGDPHQWDO (O PpGLFR
FRPRWDOHVWiREOLJDGRSRUSULQFLSLRVRQRUPDV
básicas. El Juramento hipocrático; en Capital
)HGHUDOOD/H\\HQODVSURYLQFLDVGHODV
TXHODVXSODQWHQRODDVXPDQORVGLYHUVRVDUWtFXORVGHO&yGLJR3HQDOTXHLPSRQHQDOPpGLFROD
REOLJDFLyQGHDFWXDUGHPDQHUDGHWHUPLQDGD\
SRU~OWLPRORVUHJODPHQWRVDGPLQLVWUDWLYRVGHO
VLWLRHQTXHWUDEDMDSHURTXHGHQLQJXQDPDQHUD
SXHGHQREYLDUODVREOLJDFLRQHVFLWDGDVHQSULPHU
WpUPLQR3RUHOORHOPpGLFRHVUHVSRQVDEOHSRU
Vt\DQWHVtHQFDGDVLWXDFLyQHQTXHDFW~HRGHED
WRPDUXQDGHWHUPLQDFLyQ\VHUipOTXLHQGHEHUi
responder por la conducta adoptada sin poder inYRFDUGHQWURGHVXHVWULFWRDFFLRQDUSURIHVLRQDO
PDQGDWRVyUGHQHVRUHJODPHQWRVTXHFRQWUDGLJDQRLPSLGDQODVQRUPDVSRVLWLYDVTXHODVOH\HV
y Códigos imponen al profesional.
Con respecto a los HTXLSRV PpGLFRV HV HO
-HIHGHHTXLSR±FXDQGRDFW~DFRPRWDO±HOTXH
asume la obligación de responder por sí y por
VXV GHSHQGLHQWHV OR TXH QR LPSLGH TXH VL HV
FRQGHQDGR SXHGD DFFLRQDU VHFXQGDULDPHQWH
contra el responsable del daño. Cuando dentro
GHO HTXLSR KD\ SURIHVLRQDOHV FRQ DXWRQRPtD
FLHQWt¿FD FDVR GHO DQHVWHVLVWD FDUGLyORJR KHPRWHUDSHXWD HWF pVWRV GHEHUiQ UHVSRQGHU SRU
ORVGDxRVTXHVXDFFLRQDUHUUyQHRSXGLHVHQSURYRFDU 3HUR DWHQFLyQ DO KHFKR GH TXH DXQTXH
DXWyQRPRVKD\XQDGLUHFWDUHVSRQVDELOLGDGGHO
MHIHGHHTXLSRRFLUXMDQRVLODQHJOLJHQFLDQRHV
H[FOXVLYDPHQWHWpFQLFDVLQRSRUHMHPSOR\FDVR
FRP~QHODQHVWHVLVWDTXHVHDXVHQWDGHOTXLUyIDno o no presta debida atención a las indicaciones
GHOFLUXMDQRRTXHQRKDUHYLVDGRFRUUHFWDPHQWH
al enfermo en forma preoperatoria. Probada esta
negligencia de la obligación de conducción del
MHIH GH HTXLSR VXUJH FODUD VX UHVSRQVDELOLGDG
VDOYR TXH GHPXHVWUH TXH LQWHQWy SRU WRGRV ORV
PHGLRV UHYHUWLU D OD VLWXDFLyQ FRUUHFWD LQFOXVR
GHWHQLHQGR OD RSHUDFLyQ VL QR FRUULHVH SHOLJUR
GHYLGDHOSDFLHQWH $VXYH]ODV&OtQLFDVR6DQDWRULRVDGHPiV
GHUHVSRQGHUSRUVXSHUVRQDOGHSHQGLHQWHGHEHrán también hacerlo por el deber de seguridad
TXHDVXPHQVHJXULGDGWDQWRItVLFDFRPRGHFXLGDGRV\SRUHQGHVRQFRUHVSRQVDEOHVWDPELpQ
cuando el staff médico pertenece a la misma
240 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
FOtQLFDSRUORTXHGHEHUiQUHVSRQVDELOL]DUVHHQ
forma solidaria por su accionar.
&ULWHULRVHPHMDQWHGHEHREVHUYDUVHFRQUHVSHFWR D ORV KRVSLWDOHV GHO (VWDGR ([LVWH XQD
UHVSRQVDELOLGDGGHpVWRVFXDQGRSRUHMHPSOROD
UHODFLyQPpGLFRSDFLHQWHVHUHDOL]DDWUDYpVGHO
PLVPRSHURWDPELpQVHKDOODLPSOtFLWRHOGHEHU
GH JDUDQWtD TXH KD GH RIUHFHU GLFKR HVWDEOHFLmiento por la acción de sus dependientes.
$VLPLVPRODV2EUDV6RFLDOHVTXHFRQWUDWDQ
FRQ &OtQLFDV \ VX UHVSHFWLYRV SODQWHOHV WLHQHQ
una obligación de responder por el deber de seJXULGDG TXH OH GHEHQ D VXV D¿OLDGRV FRPR DVt
WDPELpQOD&OtQLFDVLWXDFLyQTXHHQHVWHFDVRHV
HQFXDGUDGDHQOD¿JXUDMXUtGLFDGH³HVWLSXODFLyQ
DIDYRUGHXQWHUFHUR´&RPRVHYHODVVLWXDFLRnes son complejas y nada fáciles de reducir a
XQDVSRFDVIyUPXODV/R~QLFRTXHTXHGDFRPR
principio básico son los deberes y obligaciones
GHOPpGLFRLPSRVLEOHVGHGHOHJDURVXERUGLQDU
DSULQFLSLRVDGPLQLVWUDWLYRV\RPXFKRPHQRV
DIDFWRUHVGHHFRQRPtDTXHULJHQORVVLVWHPDVGH
VDOXGVHDFXDOVHDVXWLSRGRQGHVXDFHSWDFLyQ
tácita de correr riesgos innecesarios por carencia
GHHOHPHQWRVQRWLHQHMXVWL¿FDWLYRpWLFRROHJDO
alguno.
EL SEGURO MÉDICO
/D 6XSHULQWHQGHQFLD GH 6HJXURV D WUDYpV GH
OD 5HV UHJOy ODV FRQGLFLRQHV EDMR ODV
TXH GHEHUtD GHVHQYROYHUVH HO UHIHULGR VHJXUR
YLVWRFRPRSDQDFHDSRUPXFKRVPpGLFRVSHUR
no tan seguro como inocentemente se supone.
En la actualidad no es obligatorio en términos
JHQHUDOHV 0XFKDV FOtQLFDV VDQDWRULRV \ FHQWURVSULYDGRVORH[LJHQDSURIHVLRQDOHVTXHGHseen actuar en ellas. Con gran acierto menciona
Ghersi “…el otro aspecto más complicado es
ODGHIHQVDHQMXLFLRSXHVODVHURJDFLRQHVVRQ
LPSRUWDQWHV VRVWHQHPRV TXH HQ ORV VXSXHVWRV
de médicos en relación de dependencia –priYDGDRS~EOLFD±HOHQWHSDWURQDO±KRVSLWDODULR
R VDQDWRULDO± GHEH SURYHHU JUDWXLWDPHQWH GH
DVLVWHQFLDOHWUDGDSXHVHVWRHVXQDGHODVSUHPLVDVGHODOHJLVODFLyQODERUDO\DGPLQLVWUDWLYD
de mantener la integridad en la contraprestaFLyQWDPELpQSRGUtDHODERUDUVHFRQHODX[LOLR
GHODREOLJDFLyQWiFLWDGHLQGHPQLGDGH[LVWHQWH
Op. cit.SiJ
HQWRGDVLWXDFLyQFRQWUDFWXDO\pVWDREYLDPHQWH
ORHV´$QDOtFHVHHVWHPDUFRFRQFHSWXDOWHyULFRFRQHOGHVDPSDURGHPXFKtVLPRVPpGLFRV
TXH DGHPiV GH SURGXFLU XQ OXFUR R EHQH¿FLR
D ORV VDQDWRULRV FRQ VX WUDEDMR ±OR TXH QR HVWDUtDPDO±GHEHQFDUJDUFRQORVFRVWRVGHXQD
DVLVWHQFLD OHWUDGD SRU GDxRV SURGXFLGRV PXFKDV YHFHV SRU GH¿FLHQFLDV GH LQIUDHVWUXFWXUD
\SHUVRQDOGHGLFKRVFHQWURV±ORTXHHVGRORURsamente injusto.
Con respecto a los seguros médicos rige una
QRUPDEiVLFDQR¿UPDUXQDSyOL]DGHHVWHWLSR
VLQDVHVRUDUVHGHIRUPDHVSHFt¿FDDFHUFDGHVX
FREHUWXUDFRQXQDERJDGRFLYLOLVWDH[SHUWRHQ
WDOHVWHPDV0iVDOOiGHWRGDODSURSDJDQGDHO
objeto del seguro parecería pasar por cubrir el
Pi[LPRGHSUHVXQWRVULHVJRVSHUR±HQHOPRPHQWR SUHFLVR± WUDWDUi GH UHFXUULU D FXDOTXLHU
cláusula con letra chica SDUD HYLWDU KDFHUVH
FDUJR GH OD REOLJDFLyQ YHUEDOPHQWH SURPHWLGD1RGXGDPRVTXHH[LVWHQFRPSDxtDVVHULDV
\ VyOLGDV (O FRQVHMR HV MXVWDPHQWH VDEHUVH
DVHVRUDU QR SRU XQ DPLJR DERJDGR VLQR SRU
XQDERJDGRTXHHVWpHQHOWHPD$VtFRPRXQ
médico no se operaría un aneurisma cerebral
FRQXQGHUPDWyORJRDPLJRQRYHPRVSRUTXp
HQHVWRVFDVRV±VLELHQQRGHJUDYHGDGWDQLQTXLHWDQWH± SURFHGHUtDPRV GLVWLQWR VREUH WRGR
HVWDQGR HQ MXHJR TXL]i HO SDWULPRQLR GH WRGD
XQDYLGD
2WURDVSHFWRUHVLGHHQTXHODVGHPDQGDVVH
realizan por lo general contra el o los médicos
DFWXDQWHV OD LQVWLWXFLyQ \ GH H[LVWLU OD REUD
VRFLDORHOVLVWHPDSULYDGR(VQXHVWUDRSLQLyQ
TXHGDGRTXHHQORVDYDWDUHVGHOMXLFLRSXHGHQ
darse situaciones de incompatibilidad de intereVHVHQWUHORVGLVWLQWRVGHPDQGDGRVHVGHEXHQD
práctica ser representado por un letrado distinto
al del sanatorio o clínica o aún al de otros co-demandados. Asimismo y aun teniendo cobertura
DVHJXUDGRUD GHEHUi HVWDUVH PLQXFLRVDPHQWH DO
WDQWR GH FyPR HO DERJDGR TXH SRQH OD FRPSDxtDOOHYDODFDXVDOOHJDQGRLQFOXVRHQFDVRGH
dudas acerca de su idoneidad o de su carencia
GHH[SHULHQFLDHQODSUREOHPiWLFDGHODUHVSRQVDELOLGDGPpGLFDDSRQHUSRUFXHQWDSURSLDRWUR
OHWUDGR \ FRQ¿UPDGD OD LQHSWLWXG GHO DVHVRUDPLHQWR DVHJXUDGRU LQLFLDUOH DFFLRQHV SRU ORV
GDxRV VXIULGRV PRUDOHV \R SDWULPRQLDOHV D OD
compañía aseguradora.
9 - Gestión jurídico legal en organizaciones de atención de la salud / 241
CONSENTIMIENTO INFORMADO
La citada Ley 17.132 HQ HO Art. 19 menciona
la necesidad de la debida autorización para reaOL]DU RSHUDFLRQHV PXWLODQWHV OD TXH GHEHUi VHU
FRQIRUPDGDSRUHVFULWRSRUHOSDFLHQWHRHQVX
LPSRVLELOLGDGSRUORVIDPLOLDUHV<DVHPHQFLRQyTXHHQFDVRVGHSHOLJURGHYLGDHVHOPpGLFR
TXLHQGHEHDFWXDUEDMRVXUHVSRQVDELOLGDGFRQ
RVLQFRQVHQWLPLHQWRVLHPSUH\FXDQGRODRSHración propuesta tenga razonables posibilidades
GHVDOYDUGLFKRELHQ\VLQTXHH[LVWDXQDFODUD
QHJDWLYDGHOSDFLHQWHHQXVRGHUD]yQDGHMDUVH
LQWHUYHQLU
7DPELpQ OD Ley 24.193 de Transplante de
yUJDQRVHQVXArt. 13HVWDEOHFHODREOLJDFLyQ
GHLQIRUPDUDFDGDSDFLHQWH\VXJUXSRIDPLOLDU
GHPDQHUDVX¿FLHQWHFODUD\DGDSWDGDDVXQLYHO
FXOWXUDO VREUH ORV ULHVJRV GH OD RSHUDFLyQ (Q
HVWRV WUHV WpUPLQRV FODUD VX¿FLHQWH \ DGHFXDGD DO QLYHO FXOWXUDO VH UHVXPHQ ODV FDUDFWHUtVWLFDVTXHGHEHWHQHUODLQIRUPDFLyQQRVyORHQ
HVWRV FDVRV VLQR HQ WRGRV DTXHOORV HQ TXH ORV
SDFLHQWHVTXHYD\DQDVHUVRPHWLGRVDPpWRGRV
GLDJQyVWLFRVRWUDWDPLHQWRVVHDQPpGLFRVRTXLrúrgicos. Esto no nace de un acto de gracia de
ORVPpGLFRVKDFLDORVSDFLHQWHVVLQRTXHHQIRUPDXQLYHUVDOVHLQVFULEHGHQWURGHORVGHUHFKRV
personalísimos del ser humano. Sea cual sea su
QLYHOGHLQVWUXFFLyQRFDWHJRUtDVRFLDOGHEHVHU
FODUDPHQWHLQIRUPDGRGHORTXHSHQVDPRVUHDOL]DU\VXFRQVHQWLPLHQWRHVFULWRRH[WHULRUL]DGR
SRUVXFRQGXFWDHVODFRQGLFLyQsine qua non de
la medicina actual.
7RGDYtD HVWDPRV LPEXLGRV GH ODV GRFWULQDV
SDWHUQDOLVWDV TXH OD 0HGLFLQD IXH WUDQVPLWLHQGRMXQWRDVXVFRQRFLPLHQWRV(OYLHMRmagister
dixitKDPXHUWRVLQUHPHGLRVLELHQHQFRQWUDPRV
WRGDYtDPXFKRVFRQYHQFLGRVHQVXHJRODWUtDGH
TXHHVWiQHQHOPXQGRPpGLFRSDUDLPSRQHUVXV
SDUWLFXODUHVHLQGLVFXWLEOHVFULWHULRVVREUHWRGR
VL ORV TXH GHVHDQ LQWHULRUL]DUVH PiV VREUH VX
patología o circunstancias de la misma son los
SURSLRVHQIHUPRV6LELHQFRQVHUYDPRVHOSULYLOHJLRGHSRGHUORJUDUODFRQ¿DQ]DGHOHQIHUPR
\ VX DFHSWDFLyQ GH OR SURSXHVWR HVWR QR GHEH
ser una imposición sino una cabal aceptación de
ORVEHQH¿FLRV\ORVULHVJRVTXHGHEHUiQH[SOLFLWDUVH &RPR VH OHH HQ +LJKWRQ ( \ :LHU]ED
S. ³/D GRFWULQD GHO FRQVHQWLPLHQWR LQIRUPD
GRVHKDGHVDUUROODGRHQEDVHDGRVYDORUHVD HOSULQFLSLRGHOLQGLYLGXDOLVPRTXHVXSRQHXQD
GHFLVLyQEDVDGDHQODDXWRQRPtDGHODYROXQWDG
\E HOSULQFLSLRGHODPD[LPL]DFLyQGHODVDOXG
GHOSDFLHQWH\HOHTXLOLEULRHQWUHHVWRVYDORUHV
–para algunos contradictorios– sigue siendo moWLYRGHGHEDWH´
$VtWDPELpQORKDHQWHQGLGRXQDYDVWDMXULVSUXGHQFLDGHODTXHRIUHFHPRVXQDVHQWHQFLDGH
OD &1&LY 6DOD , // ³(O
médico debe tener en cuenta los riesgos o secueODV TXH GHULYHQ GHO WUDWDPLHQWR R LQWHUYHQFLyQ
a efectuar y hacer conocer al paciente dichos
ULHVJRVVLHQGRVXFRQVHQWLPLHQWRLQGLVSHQVDEOH
SDUD MXVWL¿FDU ODV FRQVHFXHQFLDV JUDYHV GH XQD
DWHQFLyQ PpGLFD \ VX DXVHQFLD WRUQD LOHJtWLPR
HOKHFKRPpGLFR´
4XHGHSHUIHFWDPHQWHFODURTXHODRPLVLyQGH
HVWH UHTXLVLWR UHSUHVHQWD XQD YLRODFLyQ GHO GHber de información y el incumplimiento de sus
REOLJDFLRQHVGHUHVSHWR\¿GHOLGDGDOSDFLHQWH
'H QLQJXQD PDQHUD OD H[LVWHQFLD GH XQD DXWRUL]DFLyQSDUDUHDOL]DUGHWHUPLQDGDLQWHUYHQFLyQ
RWUDWDPLHQWRVHUYLUiSDUDH[FXVDUODIDOWDTXH
HQ OD HMHFXFLyQ GHO PLVPR HO SURIHVLRQDO SXHda cometer. No debe confundirse este deber de
hacer conocer al paciente las presuntas alternatiYDVRSRVLELOLGDGHVTXHFDGDWUDWDPLHQWRSXHGH
OOHYDULPSOtFLWDVFRQODIDOWDGHODVHOHPHQWDOHV
PHGLGDV \ GHEHUHV GHO DFWXDU PpGLFR TXH SRU
PiVFRQVHQWLPLHQWRLQIRUPDGRTXHH[LVWDQROR
liberará del resarcimiento del daño por la culpa
cometida.
ASPECTOS INSTRUMENTALES
La historia clínica. Importancia médico legal
0HQFLyQ DSDUWH PHUHFH HO WHPD +,6725,$
&/Ë1,&$ 1R VRODPHQWH WLHQH LPSOLFDQFLDV
SDUD HO PpGLFR DXGLWRU VLQR TXH HV OD KHUUDPLHQWDPiV¿HOTXHSRVHHHOPpGLFRSDUDGHMDU
constancia de su accionar y –a posteriori y lleJDGRHOFDVR±MXVWL¿FDUVXFRUUHFWRGHVHPSHxR
(Q SULQFLSLR HV XQ GRFXPHQWR LQIRUPDFLyQ
realizada por escrito de todo el proceso médico
GHO SDFLHQWH LQFOX\HQGR ODV SUXHEDV TXH VH OH
UHDOL]DURQ (V XQ GRFXPHQWR SUHFLRVR DJUHJDUtDPRVGRQGHVHYHUHÀHMDGD±FXDQGRVHKDUHD-
La relación médico paciente. El consentimiento informado(G%XHQRV$LUHV$G+RF
242 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
lizado de forma adecuada– la correcta asistencia
PpGLFDGHOSDFLHQWH'HVGHHOSXQWRGHYLVWDGH
OD DXGLWRUtD PpGLFD HV OD KHUUDPLHQWD TXH SHUPLWLUi DO DXGLWRU HYDOXDU OD DWHQFLyQ SUHVWDGD
comparando sus datos con los estándares de caOLGDGDOPLVPRWLHPSRTXHOHSHUPLWLUiYHUL¿FDU
a ciencia cierta las prestaciones realizadas. De
más está insistir en la necesidad imperiosa de
FRQIHFFLRQDUOD HQ IRUPD OHJLEOH QR QHFHVDULDPHQWHFRQOHQJXDMHSRSXODUSHURVtFODUD\FRPSUHQVLEOHSDUDHORORVPpGLFRVTXHDSRVWHULRUL
SRUSUREOHPDVDVLVWHQFLDOHVSRUDXGLWRUtDVRSRU
SHULWDMHVGHEDQUHFRPSRQHUODYHUGDGKLVWyULFD
GH OR DOOt YROFDGR /D QHJOLJHQFLD HQ HVWD FRQfección tendrá así una doble repercusión. Si el
SDFLHQWHVHFRPSOLFDHPSHRUDRUHTXLHUHXUJHQWHWUDWDPLHQWRHOPpGLFRTXHGHEDKDFHUVHFDUJR
GHODVLWXDFLyQVHHQFRQWUDUiPXFKDVYHFHVDQWH
la imposibilidad de tratarlo de forma adecuada
por carencia de información. Y desde el punto
GHYLVWDOHJDOODKLVWRULDFOtQLFDHQWHQGLGDFRPR
GRFXPHQWR GH LQWUtQVHFD YDOLGH] SRQGUi VREUH
la cabeza de los responsables de sus carencias
una razonable sospecha o duda acerca de su actuación.
5HVSHFWR D VX FRQVHUYDFLyQ HQ JXDUGLD SRU
OD FOtQLFD R HVWDEOHFLPLHQWR DVLVWHQFLDO H[LVte una resolución de la Secretaría de Salud
GHO0LQLVWHULRGH6DOXG\$FFLyQ6RFLDOOD1ž
GHIHFKDGRQGHVH¿MD³XQODSVR
GHDxRVSDUDODFRQVHUYDFLyQGHODVKLVWRULDV
clínicas en los distintos establecimientos asisWHQFLDOHVSULYDGRVDXWRUL]DGRVSRUOD$XWRULGDG
6DQLWDULD1DFLRQDO<HQHOFDVRTXHFHVDVHQHQ
VXDFWLYLGDGORVFRQVXOWRULRVRHVWDEOHFLPLHQWRV
SULYDGRVODVKLVWRULDVFOtQLFDVFRUUHVSRQGLHQWHV
DSDFLHQWHVFRQFREHUWXUDVRFLDOGHEHUiQVHUUHPLWLGDVDORVUHVSHFWLYRVHQWHVGHREUDVRFLDO\OD
GHORVGHPiVSDFLHQWHVDHVWDVHFUHWDUtD´
(VWDUHVROXFLyQWLHQHYLJHQFLDVREUHiPELWRV
SULYDGRV VRPHWLGRV DO FRQWURO VDQLWDULR QDFLRQDO%LHQSXHGHLQWHUSUHWDUVHTXHHQFXDOTXLHU
RWURHOSOD]RGHFRQVHUYDFLyQGHKLVWRULDV\¿FKDVFOtQLFDVGHELHUDH[WHQGHUVHDOPHQRVD
DxRVGHODOWDGHOSDFLHQWHFRQVLGHUDQGRTXHOD
relación médico-paciente se incluye en la esfera
FRQWUDFWXDOFRQSOD]RGHSUHVFULSFLyQGHGLFKR
período.
Respecto de la propiedad de dicho documenWR OD MXULVSUXGHQFLD WLHQGH D DFHSWDU SDFt¿FDPHQWHTXHVLELHQODFOtQLFDRHOHVWDEOHFLPLHQWR
HVGXHxRRFXVWRGLRGHHOODQRVHOHSXHGH±QL
GHEH± QHJDU DO SDFLHQWH VX FRQVXOWD H LQFOXVR
sería una buena medida entregar al alta del paFLHQWHXQDIRWRFRSLDGHODPLVPDRFXDQGRPHQRVXQUHVXPHQFODURGHSURFHGLPLHQWRVHIHFWXDGRV GLDJQyVWLFRV UHDOL]DGRV \ WUDWDPLHQWRV
RUGHQDGRV(OOREDVDGRHQHOFDGDYH]PD\RU\
\DPHQFLRQDGRHQYDULRVtWHPVGHUHFKRGHORV
SDFLHQWHV D OD LQIRUPDFLyQ9HDPRV SRU HMHPSOR HO VLJXLHQWH IDOOR GH &iPDUD ³/D KLVWRULDFOtQLFDHVHGRFXPHQWRPpGLFRHVODPHMRU
IXHQWHGHLQIRUPDFLyQSDUDHYDOXDUODFDOLGDGGH
ODDWHQFLyQPpGLFDEULQGDGDDOSDFLHQWHVLHQGR
XQGHUHFKRGHpVWHTXHVHGHMHFRQVWDQFLDHQHO
PLVPRGHWRGRORTXHVHUHDOL]DSDUDHQWUHRWURV
VXSXHVWRVVHUHQVXPRPHQWRHYDOXDGRGHWHUminando según su resultado el comportamiento
PpGLFRGHVGHGLIHUHQWHViQJXORVWpFQLFROHJDO
DGPLQLVWUDWLYR´ &iP&LY\&RP0RUyQ6DOD
,,-XULV < XQD LQWHUHVDQWH VHQWHQFLD WDPELpQ GH
&iPDUD H[SUHVD ³HQWUDQGR \D D GH¿QLU OD VLtuación del estado –Hospital Aeronáutico– cabe
VHxDODU SULPHUDPHQWH TXH SRU H[SUHVD GLVSRVLción legal estaba obligado a custodiar el parte
DQHVWpVLFR $UW /H\ \ WHQtD OD FDUJDGHDSRUWDUORDOH[SHGLHQWHD¿QGHGLOXFLGDU
ODYHUGDGGHORVKHFKRV $UW&RG3URF UHVXOWDQGR SHUWLQHQWH H[WUDHU GH VX RPLVLyQ
presunciones en su contra... La falta de ese elePHQWR GH SUXHED FX\D LPSRUWDQFLD GHVWDTXp
DQWHULRUPHQWHHQUD]yQGHODSRVLELOLGDGGHTXH
HODFFLGHQWHVHYLQFXOHHQIRUPDGLUHFWDFRQHO
WUDWDPLHQWRDQHVWpVLFRGLVSHQVDGRMXVWL¿FDKDFHUORUHVSRQVDEOHGHORVGDxRVH[SHULPHQWDGRV
SRUORVDFWRUHV´ &1)HG&LY\&RP6DOD,,
-$ Podemos sintetizar:
‡&$5È&7(5,QVWUXPHQWRRGRFXPHQWRSULYDGR
‡ 2%/,*$725,('$' GH KDFHUOD OOHQDU GH
VXFRQVHUYDFLyQ\DUFKLYR'LUHFWRU0pGLFR
$UW/H\
‡ 68$'8/7(5$&,Ï1 9LRODFLyQ GH GRFXPHQWRV $UW&3 R)DOVL¿FDFLyQGHGRFXPHQWRV $UW\VV
‡)250$YDULDEOHQRH[LVWHQRUPDOHJDOTXH
REOLJXHDTXHVHDPDQXVFULWD
‡ 6(17,'2 VHFXHQFLD KLVWyULFD GH WRGRV ORV
HYHQWRVPpGLFRVGHWDOODGRVFURQROyJLFDPHQWH
Historia clínica informatizada. El futuro
/D /H\ GH )LUPD 'LJLWDO /H\ H[SUHVD
$UW TXHODPLVPDHV³«HOUHVXOWDGRGHDSOLcar a un documento digital un procedimiento
9 - Gestión jurídico legal en organizaciones de atención de la salud / 243
PDWHPiWLFRTXHUHTXLHUHLQIRUPDFLyQGHH[FOXVLYR FRQRFLPLHQWR GHO ¿UPDQWH HQFRQWUiQGRVH
pVWH EDMR VX DEVROXWR FRQWURO /D ¿UPD GLJLWDO
GHEHVHUVXVFHSWLEOHGHYHUL¿FDFLyQSRUWHUFHUDV
SDUWHV WDO TXH GLFKD YHUL¿FDFLyQ VLPXOWiQHDPHQWHSHUPLWDLGHQWL¿FDUDO¿UPDQWH\GHWHFWDU
FXDOTXLHUDOWHUDFLyQGHOGRFXPHQWRGLJLWDOSRVWHULRUDVX¿UPD´'HEHDFODUDUVHTXHHVWHVLVWHma no puede aplicarse a disposiciones por causa
de muerte; a los actos jurídicos de derecho de
IDPLOLD\DORVDFWRVTXHGHEHQSRUOH\RFRQWUDWR
UHVSHWDURWURWLSRGHH[LJHQFLDVIRUPDOHV
/RVFULWHULRV\HVSHFL¿FDFLRQHVGHHVWDOH\DVHJXUDQTXHXQGRFXPHQWRGLJLWDO\OD¿UPDDXWRUL]DGDJXDUGDQXQDUHODFLyQGHLQYLRODELOLGDGSRVWHULRU
DVX¿UPDORTXHDVHJXUDODSUHVXQFLyQGHDXWRUtD
ODGHLQWHJULGDG\ODYDOLGH]GHORVGDWRVUHJLVWUDGRV HQ pO &XPSOLHQGR ORV UHTXLVLWRV HVWLSXODGRV
SRUOH\VHSUHVXPLUiWDPELpQTXHXQGRFXPHQWR
HQYLDGRSRUXQGLVSRVLWLYRSURJUDPDGR\TXHOOHYHOD¿UPDGLJLWDOGHOUHPLWHQWHHVSURYHQLHQWHGH
pVWH(O$UWH[SUHVDTXH³ODH[LJHQFLDOHJDOGH
FRQVHUYDU GRFXPHQWRV UHJLVWURV R GDWRV WDPELpQ
TXHGDVDWLVIHFKDFRQODFRQVHUYDFLyQGHORVFRUUHVSRQGLHQWHVGRFXPHQWRVGLJLWDOHV¿UPDGRVGLJLWDOPHQWHVHJ~QORVSURFHGLPLHQWRVTXHGHWHUPLQHOD
UHJODPHQWDFLyQVLHPSUHTXHVHDQDFFHVLEOHVSDUD
su posterior consulta y permitan determinar fehaFLHQWHPHQWHHORULJHQGHVWLQRIHFKD\KRUDGHVX
JHQHUDFLyQHQYtR\RUHFHSFLyQ´
Certificados
por no decir casi única defensa del médico impuWDGRHQXQDFDXVDGHUHVSRQVDELOLGDGPpGLFDHV
DFUHGLWDUIHKDFLHQWHPHQWHDWUDYpVGHODKLVWRULD
FOtQLFDTXHHQHIHFWRUHDOL]yWRGDVDTXHOODVPHGLGDV\FXLGDGRVTXHODQDWXUDOH]DGHVXREOLJDFLyQH[LJtD&ODURHVWiTXHHVWHGRFXPHQWRGHEH
DUPRQL]DUFRQHOUHVWRGHODVSUXHEDVHLQGLFLRV
GDGR TXH DQWH JURVHUDV GLVFRUGDQFLDV SXHGH VHU
GHVHFKDGD R GHVYDORUDGD SRU HO MX]JDGRU EDMR
presunciones de adulteración.
¢&XiOHV VRQ ORV FHUWL¿FDGRV PiV KDELWXDOHV
TXH GHEH H[WHQGHU XQ PpGLFR" $OJXQRV VHUiQ
H[SOLFLWDGRVPiVDGHODQWH
Defunción
‡2EOLJDWRULHGDG /H\$UW'HFUHWR
/H\$UW
‡)DOVHGDG $UW&3\
‡&HUWL¿FDGRGH'HIXQFLyQIHWDO
Nacimiento
‡/H\ 5HJLVWURGH,GHQWLGDGGHO5HFLpQ
1DFLGR
Prenupcial
‡9DUyQ/H\ /H\GH3UR¿OD[LV
‡0XMHU/H\ &HUWL¿FDGR3UHQXSFLDO
Alienación mental
‡/H\ ,QWHUQDFLyQ3VLTXLiWULFD$UW
&&
Certificado de cremación
‡$ SHGLGR \ VLHPSUH TXH QR TXHGH QLQJXQD
3RUUHVSHWRDOSDFLHQWH\DVXVGHUHFKRV\SRUSURpia obligación encuadrada en las reglas del arte y
duda en cuanto a la causa del fallecimiento y
ODUHVSRQVDELOLGDGTXHpVWHFRQOOHYDQRSXHGHHO
QRVHKDOOHHOFDGiYHUEDMRLQWHUYHQFLyQSRlicial o judicial.
PpGLFRQHJDUVHQLDH[WHQGHUXQFHUWL¿FDGRGHOR
TXHKDFRQVWDWDGRDVtVHDHVWRVyORXQGDWRQHJDWLYRQLSXHGHWDPSRFRQHJDUVHDGDUDOSDFLHQWHXQ Certificado de atención
UHVXPHQGHODDIHFFLyQSRUODTXHORWUDWyRWXYRHQ ‡7HVWLPRQLRHVFULWRGHDOJRTXHFRPSUXHEDR
comprobó el profesional. Puede ser público
YLJLODQFLD (OOR HQFXDGUD HQ HO PRGHUQR GHUHFKR
R SULYDGR VHJ~Q OR H[WLHQGD SRU UHTXLVLWRV
GHORVLQGLYLGXRVDODLQIRUPDFLyQDORVderechos
legales o a pedido del paciente. 'HEHVHU¿HO
personalísimos y a conocer por sí mismo todo lo
expresión de la verdad &3$UW\
TXHDWDxHDVXVDOXG1RHQWHQGHUORDVtHVSUHWHQder retroceder a la medicina paternalista y autorita ULDTXHQRWLHQHFDELGDHQHOPXQGRDFWXDO
&RQVLGHUDPRVHOWHPDGHJUDQYDORUWDQWR±\ Vacunas
‡ )RUPXODULRV HVSHFLDOHV 63 R UHFHWDULRV GHO
FRPRVHGLMR±GHVGHHOSXQWRGHYLVWDGHODXGLWRUPpGLFRTXHGHEHUiDVHQWDUVXRSLQLyQFXDQGR
médico
GHEDHYDOXDUXQDDWHQFLyQFRPRGHVGHODySWLFD
GHOPpGLFRDVLVWHQFLDOSRUORJHQHUDOSRFRDPLJR Traslado al exterior de incapaces
‡ 6yOR DXWRUL]DGR FRQ HVFULWR MXGLFLDO \ FHUGHHVFULELU\HQFDVRGHKDFHUORGLEXMDQGRPXFKDVYHFHVMHURJOt¿FRVTXHQDGDGLFHQ/DPHMRU
WL¿FDGR GH GRV PpGLFRV TXH DYDOHQ OD FRQ-
244 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
YHQLHQFLDTXHODPHGLGDWLHQHSDUDVXVDOXG medicina. Se ha producido al mismo tiempo la
emergencia de una conciencia moral y la necesi$UW&& dad de implementar normas éticas en este terreQRQHFHVLGDGTXHQRHVREYLDPHQWHFRQWHPSRCertificados de demencia
UiQHDSHURTXHVHKDGLIXQGLGRGHIRUPDQRWDEOH
‡/H\,QWHUQDFLyQSVLTXLiWULFD
HQORV~OWLPRVDxRV$PHGLGDTXHODHVSHUDQ]D
GH YLGD GH OD SREODFLyQ YD HQ DXPHQWR HO YDLos comités de Bioética
ORUGHODYLGDRPHMRUD~QHOYDORUGHODYLGD
6DEHPRVTXHXQRGHORVUHSDURVRSDXWDV~WLOHV con incremento de salud y/o bienestar aumenta
SDUD HYDOXDU FDOLGDG GH DWHQFLyQ PpGLFD GH XQ WDPELpQ\SRUHQGHODLPSRUWDQFLDRWRUJDGDD
VLVWHPDHVODH[LVWHQFLDRQRGH&RPLWpVGHeWLFD los cuidados del cuerpo y al espíritu. Son ob3HURWDPELpQHVWHFULWHULRTXHKDFHD*DUDQWtD MHWRVGHFRQVXPRJHQHUDGRUHVGHGHUHFKRVGH
GH&DOLGDGGHGLFKDDWHQFLyQVHKDOODHQFXDGUD- OLEHUWDGHVGHH[LJHQFLDVFDGDYH]PiVGHVSURdo dentro de determinadas obligaciones técnico- porcionadas respecto de las responsabilidades y
DGPLQLVWUDWLYDVTXHKDQVLGRLPSOHPHQWDGDVHQ SRVLELOLGDGHVGHDTXHOORVDTXLHQHVOHVFRPSHWH
QXHVWURSDtV(QHIHFWRODOH\HVWLSXODHQ saciar dichas necesidades. No se trata sólo de
VX$UWTXH³HQWRGRKRVSLWDOGHOVLVWHPDS~- FXHVWLRQHV¿ORVy¿FDVVLQRTXHWRFDDODDGPLQLVEOLFRGHVDOXG\VHJXULGDGVRFLDOHQODPHGLGD WUDFLyQGHORVVHUYLFLRVGHVDOXG\VREUHWRGRD
HQTXHVXFRPSOHMLGDGORSHUPLWDGHEHUiH[LVWLU ODJHVWLyQ\SUiFWLFDVPpGLFDVFRWLGLDQDVTXHVH
XQ&RPLWp+RVSLWDODULRGHeWLFDHOTXHFXPSOL- YHQGHVERUGDGDVSRUHVWDVDSHWHQFLDVGHLQPRUUiIXQFLRQHVGHDVHVRUDPLHQWRHVWXGLRGRFHQ- WDOLGDGMXYHQWXG\VDOXGHWHUQDV¢&yPRKDFHU
FLD \ VXSHUYLVLyQ GH OD LQYHVWLJDFLyQ UHVSHFWR y cómo proceder médicamente ante situaciones
GH DTXHOODV FXHVWLRQHV pWLFDV TXH VXUJHQ GH OD OtPLWHHQXQDVRFLHGDGTXHQLHJD\H[SXOVDDOD
SUiFWLFDGHODPHGLFLQDKRVSLWDODULD´H[SUHVDQGR YHMH]DODHQIHUPHGDG\DODPXHUWHGHVXUHDOLHO$UWžTXHGHEHUiQIXQFLRQDUFRPR³HTXLSRV dad cotidiana?
<HOWHPDLQWHUHVDDWRGRVVLQLPSRUWDUODV
LQWHUGLVFLSOLQDULRVLQWHJUDGRVSRUPpGLFRVSHUVRQDOSDUDPpGLFRDERJDGRV¿OyVRIRV\SURIH- diferentes culturas e historicidades caracterizaVLRQDOHVGHODVFLHQFLDVGHODFRQGXFWDKXPDQD GDVSRUODHPHUJHQFLDHQHOVLJOR;;\GHQWUR
TXH SRGUiQ SHUWHQHFHU R QR D OD GRWDFLyQ GHO GH ORV SDtVHV LQGXVWULDOL]DGRV SRU SROtWLFDV VRSHUVRQDO GHO HVWDEOHFLPLHQWR´ 7DPELpQ GHWDOOD FLDOHVTXHVHEDVDQHQLQYHVWLJDFLRQHVPpGLFDV
ODOH\VLQQHFHVLGDGGHVHUXQDOLVWDH[KDXVWLYD \ELROyJLFDVSHURIXQGDPHQWDOPHQWHVREUHQXHTXH HQWHQGHUiQ HQ WHFQRORJtDV UHSURGXFWLYDV YRVyUGHQHV\WHRUtDVSROtWLFDV6LQHPEDUJRUHH[SHULPHQWDFLyQHQKXPDQRVSURORQJDFLyQDU- FLpQSRUORVDxRVFREUDLPSXOVRODFUHDFLyQ
de espacios o de debates públicos originados por
WL¿FLDOGHODYLGDHXWDQDVLDHWF
([SOLFLWDDVLPLVPRHQHO$UWžTXHODVRSL- ODVFRQVHFXHQFLDVGHODVLQYHVWLJDFLRQHVELRPpQLRQHVGHO&RPLWpQRWHQGUiQIXHU]DYLQFXODQWH dicas y bajo la forma de comités de éticaDQLYHO
\ QR H[LPLUiQ GH UHVSRQVDELOLGDG pWLFD \ OHJDO QDFLRQDORLQWHUQDFLRQDO(VHYLGHQWHTXHHQORV
DOSURIHVLRQDOLQWHUYLQLHQWHQLDODVDXWRULGDGHV países desarrollados se han establecido estrechas
GHO HVWDEOHFLPLHQWR 7DPELpQ PHUHFH GHVWDFDU- UHODFLRQHVHQWUHODVLQYHVWLJDFLRQHVELRPpGLFDV
VH TXH GHQWUR GHO PDUFR JHQHUDO GHO 3URJUDPD ORVUHJtPHQHVSROtWLFRV\ODVFRQGLFLRQHVGHOYLNacional de Garantía de Calidad de la Atención YLU\HOPRULU/DLPSRUWDQFLDGHHVWRVIHQyPH0pGLFD 5HV06\$6 VHKDGLFWDGROD nos dentro de los países occidentales muestra la
5HVWDPELpQGHGLFKR0LQLVWHULRGRQ- concientización de los ciudadanos ante situacioGHWD[DWLYDPHQWHVHGLVSRQHODFUHDFLyQFRQFD- QHVRSROtWLFDVTXHSXGLHQGRVHUWRPDGDVDVXV
rácter obligatorio de los Comités Hospitalarios HVSDOGDVFRPSURPHWHQODVFRQGLFLRQHVGHYLGD
de Ética Médica a implementarse en los y hábitat. Baste con recordar tantos desastres
Hospitales Públicos de Autogestión y en los RULJLQDGRV SRU HUURUHV GHIHFWRV R QHJOLJHQFLDV
Establecimientos Nacionales de Salud tomando HQHOPDQHMRGHH[SHULPHQWRVPpWRGRVRPDQLSXODFLRQHVJHQpWLFDV1RFUHHPRVTXHYDOJDOD
IXHU]DGHOH\EDMRHO'HFUHWR3(1
$KRUD ELHQ ¢TXp VRQ TXp URO FXPSOHQ \ SHQDH[WHQGHUVHVREUHORVGHOHWpUHRVHIHFWRVTXH
cuáles son las raíces históricas de tales comités? HQXQSDtVSRFRGHVDUUROODGRSXHGHQSURYRFDU/RVSUREOHPDVGHVDOXGYDQPXFKRPiVDOOiGH se por el desmadre de manipulaciones genéticas
ORVSURJUHVRVWpFQLFRVRGHLQYHVWLJDFLyQHQELR- VREUHPLFURELRVREDFWHULDVPi[LPHTXHHQWD-
9 - Gestión jurídico legal en organizaciones de atención de la salud / 245
OHV SDtVHV QR H[LVWHQ PHFDQLVPRV GH FRQWURO R
consenso para la realización de tales manipulaFLRQHVFDVLLPSRVLEOHVGHUHDOL]DU SRUVXULHVJR HQSDtVHVGHOSULPHUPXQGR
Es interesante analizar cómo se desarrollaron
\VXUJLHURQDTXpLQWHUHVHVREHGHFLHURQ\FXiOHV
IXHURQEiVLFDPHQWHORVREMHWLYRVGHORVFRPLWpV
GHpWLFD(VGHREVHUYDFLyQKDELWXDOTXHODJHQWHFRP~QYHHVWDVFUHDFLRQHVGHOHMRVFRPRVL
QR OHV LQFXPELHUDQ FRPR VL VyOR VH WUDWDUD GH
“problemas o asuntos de los médicos o los cienWt¿FRV´'HEHVLQHPEDUJRGHFLUVHTXHHQORV
últimos tiempos esta concepción está cambianGR\TXHFDGDYH]PiVODVLPSOLFDQFLDV\UHODFLRQHVHQWUHLQYHVWLJDGRUHVFLXGDGDQRVOH\HV\
UHJXODFLRQHV \ FRQÀLFWRV PRUDOHV DOUHGHGRU GH
OD YLGD \ GH OD PXHUWH VRQ FRPSDUWLGDV SRU XQ
mayor número de personas. El peligro latente de
todo esto se halla en el desarrollo de políticas
GHLQYHVWLJDFLyQELRPpGLFDSRUORVJRELHUQRVGH
SDtVHVGHVDUUROODGRVWUD]DGDVEDMRODVSUHVLRQHV
de los intereses económicos o empresariales
SXHVWRVHQMXHJR\TXHHQGH¿QLWLYDUHYLHUWHQ
en situaciones donde pueden hallarse en juego
QXHVWUDKLVWRULDQXHVWURSRUYHQLURQXHVWURVGHrechos.
/RV QXHYRV SRGHUHV HFRQyPLFRV SXHGHQ
condicionar o limitar nuestras instituciones en
forma tal como para imponernos patrones de
YLGDTXHQRQRVSHUPLWDQFRPSUHQGHUQLDEDUFDU
ORTXHUHDOPHQWHVXFHGH\HQODPDQHUDHQTXH
HVWDPRVLPSOLFDGRVGHPRGRGLUHFWRDWHQGLHQGRHQSDUWLFXODUTXHVHWUDWDGHGHFLVLRQHVVREUH
QXHVWUDYLGD\VREUHQXHVWURVYDORUHV'HDOOtOD
LPSRUWDQFLDFUXFLDOTXHGHELHVHQWHQHUODVFRPLVLRQHVRFRPLWpVGHpWLFDDFRQGLFLyQGHTXHHQ
HOODVQRVFRPSURPHWDPRV\SDUWLFLSHPRVEDMR
HOULHVJRTXHGHQRKDFHUOR\HQDTXHOODVFXHVWLRQHVELRpWLFDVIXQGDPHQWDOHVWHUPLQHPRVFRPR
meros espectadores de decisiones adoptadas a
QXHVWURQRPEUH\SRUSRGHUHVGHORVTXHQRSRdríamos señalar un responsable
BREVE SINOPSIS DE ASPECTOS INSTITUCIONALES
BÁSICOS OBLIGATORIOS EN INSTITUCIONES MÉDICAS
6LHQGR OD YLGD \ OD VDOXG ELHQHV IXQGDPHQWDOHV
MXUtGLFDPHQWH SURWHJLGRV HV OyJLFR TXH WRGDV
DTXHOODVLQVWLWXFLRQHVFRQIRUPDGDVRGHVWLQDGDVD
EULQGDUSUHVWDFLRQHVGHVDOXGHQIRUPDJHQpULFD
TXHGHQEDMRODWXWHODGHO(VWDGRDWUDYpVGHXQVLQQ~PHURGHLQVWUXPHQWRVOHJDOHV /H\HV'HFUHWRV
5HVROXFLRQHV 0LQLVWHULDOHV 5HVROXFLRQHV GH OD
6XSHULQWHQGHQFLD GH 6HUYLFLRV GH 6DOXG HWF Para ello analizaremos primero los fundamentos
MXUtGLFRVGHWRGDODHVWUXFWXUDRUGHQDWLYD
Derecho a las prestaciones de salud
‡&RQVDJUDGRSRUODQRUPDFRQVWLWXFLRQDOpero
‡4XHGDOLEUDGRDOOHJLVODGRULQIUDFRQVWLWXFLRQDOpor ello es el &RQJUHVR1DFLRQDOTXLHQ
GHEHUiGHWHUPLQDUVLH[LVWHXQVLVWHPDS~EOLFRRSULYDGRVLKD\GHUHFKRDXQPtQLPRGH
SUHVWDFLRQHVRQR\ODFDOLGDG¿QDOGHOWLSR
de prestaciones médicas.
‡ 6LVWHPD 1DFLRQDO GHO 6HJXUR GH 6DOXG ³D
efectos de procurar el pleno goce del derecho
DODVDOXGSDUDWRGRVORVKDELWDQWHVGHOSDtV´
$UWž/H\ ‡3DUDSURPRYHUSUHVWDFLRQHVGHVDOXGWHQGLHQWHV
DODSURPRFLyQSURWHFFLyQUHFXSHUDFLyQ\UHKDELOLWDFLyQGHODVDOXGTXHUHVSRQGDQDOPHMRU
QLYHOGHFDOLGDGGLVSRQLEOH\TXHJDUDQWLFHQD
ORVEHQH¿FLDULRVHOPLVPRWLSRGHQLYHOGHSUHVWDFLyQHOLPLQDQGRWRGDIRUPDGHGLVFULPLQDFLyQ
\HQEDVHDFULWHULRVGHMXVWLFLDGLVWULEXWLYD
/D/H\GLVSXVRXQPtQLPRGHSUHVWDciones obligatorias para las empresas de mediciQDSULYDGD 302 (VWRLPSOLFDTXH
a. Se establece un derecho a las prestaciones
de salud.
E)LMDXQOtPLWHDVXHMHUFLFLRHQUHODFLyQDOD
calidad disponible (desarrollo progresivo en
relación a los recursos).
c. Otorga una garantía mínima al mismo tipo
GHSUHVWDFLyQ\
GULJHQORVSULQFLSLRVGHMXVWLFLDUHWULEXWLYD
3RUHOORKD\TXHGLVWLQJXLU
‡(OGHUHFKRIXQGDPHQWDODODVSUHVWDFLRQHVGH
salud
‡(OHMHUFLFLRGHHVHGHUHFKR
‡/DJDUDQWtDDFRUGDGD
Las empresas o instituciones de salud
$XQTXHODVUHVSRQVDELOLGDGHVHPHUJHQWHVGHORV
actos médicos recaen fundamentalmente sobre
DTXHOORV SURIHVLRQDOHV TXH ORV UHDOL]DQ GHEHQ
estudiarse los diferentes tipos de organización
HQ UHODFLyQ D OD UHVSRQVDELOLGDG TXH OHV FDEH
por ser el ámbito donde dichas prestaciones se
realizan y por ser garantes de la calidad de la
DWHQFLyQHQVHQWLGRDPSOLRDVtFRPRGHODVH-
246 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
guridad de los pacientes durante su permanencia
HQHOORV&DEHDFRWDUTXHGLYHUVDVLQVWLWXFLRQHV
RIRUPDVMXUtGLFDVGHODVPLVPDVHVWiQDXWRUL]DGDVSDUDEULQGDUSUHVWDFLRQHVGHVDOXGSRUOR
TXHGHEHPRVFRQRFHUFXiOHVVRQGLFKRVWLSRV
+DFLHQGRXQEUHYHUHVXPHQDFHUFDGHFyPR
son consideradas las Instituciones como tales
GHQWURGHORUGHQDPLHQWRMXUtGLFRDYDQ]DUHPRV
luego a la comprensión de sus obligaciones y del
PDUFROHJDOGHQWURGHOTXHVHGHVHQYXHOYHQ
Puede englobárselas a todas dentro del concepto personas jurídicas: “Son personas todos
ORV HQWHV VXVFHSWLEOHV GH DGTXLULU GHUHFKRV R
FRQWUDHUREOLJDFLRQHV´&&$UW³/DVSHUVRnas son de una existencia ideal o de una existencia visible VHUHVKXPDQRV &&$UW\HO
$UWGHO&&FRPSOHWD³7RGRVORVHQWHVVXVFHSWLEOHVGHDGTXLULUGHUHFKRVRFRQWUDHUREOLJDFLRQHVTXHQRVRQSHUVRQDVGHH[LVWHQFLDYLVLEOH
VRQSHUVRQDVGHH[LVWHQFLDLGHDO´
%DVDGRV HQ HO$UW GH OD &1 SRGHPRV
LGHQWL¿FDUHQIRUPDJHQHUDOGLYHUVDVPRGDOLGDdes de personas jurídicas:
3HUVRQDV MXUtGLFDV GH FDUiFWHU S~EOLFR
6RQHO(VWDGRQDFLRQDOODVSURYLQFLDVORVPXQLFLSLRV ODV HQWLGDGHV DXWiUTXLFDV \ OD ,JOHVLD
católica.
Personas públicas no estatales: Si bien no
IRUPDQ SDUWH GH OD DGPLQLVWUDFLyQ S~EOLFD GHsarrollan directa o indirectamente una función
S~EOLFD R DFWLYLGDGHV FRDG\XYDQWHV FRQ ORV
FRPHWLGRV HVWDWDOHV 6LQGLFDWRV &ROHJLRV SURIHVLRQDOHV2266GHO(VWDGRQDFLRQDO\VXVUHparticiones. Se las denomina o encasilla como:
³HQWLGDGHVGHGHUHFKRS~EOLFRQRHVWDWDO´ $UW
ž/H\ 3HUVRQDV MXUtGLFDV GH FDUiFWHU SULYDGR
6RQWRGDVDTXHOODV³$VRFLDFLRQHV\)XQGDFLRQHV
TXHWHQJDQSRUSULQFLSDOREMHWRHOELHQFRP~Q
y obtengan autorización del Estado para funcioQDU´$UW&&
³6RFLHGDGHV FLYLOHV \ FRPHUFLDOHV R HQWLGDGHV TXH FRQIRUPH D OD OH\ WHQJDQ FDSDFLGDG
SDUDDGTXLULUGHUHFKRV\FRQWUDHUREOLJDFLRQHV
DXQTXH QR UHTXLHUDQ DXWRUL]DFLyQ H[SUHVD GHO
(VWDGRSDUDIXQFLRQDU´$UW&&
([LVWHXQFRQWUDORUSRUSDUWHGHO(VWDGRDWUDYpVGHOD,QVSHFFLyQ*HQHUDOGH-XVWLFLD\EiVLFDPHQWHVHODVSXHGHFODVL¿FDUHQ
Asociaciones: $JUXSDFLRQHV GH LQGLYLGXRV
TXHWLHQHQFRPRSULQFLSDOREMHWRODSHUVHFXFLyQ
GHO ELHQ FRP~Q WLHQHQ SDWULPRQLR SURSLR QR
GHSHQGHQH[FOXVLYDPHQWHGHO(VWDGRSDUDVXE-
sistir y deben obtener autorización para funcioQDU3RVHHQXQD¿QDOLGDGQROXFUDWLYD
Sociedades: $JUXSDFLRQHV GH LQGLYLGXRV
TXHVHXQHQSDUDUHDOL]DUXQDDFWLYLGDGOtFLWD\
OXFUDWLYDGRQGHFDGDXQRGHORVVRFLRVGHEHUHDlizar un aporte.
3HUR H[LVWH RWUR WLSR GH 3HUVRQDV -XUtGLFDV
TXHDSDUHQWHPHQWHWLHQHQFDUDFWHUtVWLFDVFRPXQHVFRQODVHQXPHUDGDVSHURFX\RRULJHQ¿QDOLGDG\yUJDQRGHWXWHODGL¿HUHGHpVWDVSXHGHQ
FODVL¿FDUVHHQ
$VRFLDFLRQHV0XWXDOHV)XQFLRQDQEDMROD
QRUPDWLYDGHOD/H\FRQVWLWXLGDV³OLEUHPHQWH VLQ ¿QHV GH OXFUR SRU SHUVRQDV LQVSLUDGDVHQODVROLGDULGDGFRQHOREMHWRGHEULQGDUVH
D\XGDUHFtSURFDIUHQWHDULHVJRVHYHQWXDOHVRGH
FRQFXUULU D VX ELHQHVWDU PDWHULDO \ HVSLULWXDO
PHGLDQWH XQD FRQWULEXFLyQ SHULyGLFD´ 3XHGHQ
satisfacer necesidades de asistencia médica o
IDUPDFpXWLFD DUWž (OFRQWURO\VXSHUYLVLyQGH
su funcionamiento se halla en manos del INAM
,QVWLWXWR1DFLRQDOGH$VRFLDFLRQHV0XWXDOHV Cooperativas: Se hallan reguladas por la
/H\\VRQ³HQWLGDGHVIXQGDGDVHQHOHVfuerzo propio y la ayuda mutua para organizar y
SUHVWDUVHUYLFLRV´6X¿QDOLGDGEiVLFDHVREWHQHU
YHQWDMDVHFRQyPLFDV\QRXWLOLGDGHVHQGLQHUR
Su órgano de contralor estatal es el INAES.
<SRU~OWLPRGHEHPRVKDFHUPHQFLyQDGRV
IRUPDV GH LQVWLWXFLRQHV TXH SXHGHQ REVHUYDUVH
en la actualidad:
&RQWUDWRV GH &RODERUDFLyQ (PSUHVDULD
%DVDGDVHQOD/H\(VWHWLSRGHDJUXSDFLyQOODPDGDen colaboraciónWLHQHSRUREMHWR
“facilitar o desarrollar determinadas fases de la
DFWLYLGDG GH VXV PLHPEURV´$UW /6 1R
SXHGHQWHQHU¿QHVGHOXFURSHUVRQDOQLSXHGHQ
conformar un grupo monopólico.
8QLyQ 7UDQVLWRULD GH (PSUHVDV 87( )RUPDGDSDUDHO³GHVDUUROORRHMHFXFLyQGHXQD
REUD VHUYLFLR R VXPLQLVWUR FRQFUHWR GHQWUR R
IXHUDGHOD5HS~EOLFD´1RHVXQDQXHYDHPSUHVD\VXGXUDFLyQHVWiYLQFXODGDDODGHODREUD
VHUYLFLRRVXPLQLVWUR(QUHDOLGDG\GHDFXHUGR
D YDULRV DXWRUHV SRVHHQ XQD GXGRVD XELFDFLyQ
jurídica y no se la encuentra habitualmente en
HPSUHVDVGHVHUYLFLRVGHVDOXG
Obligaciones básicas y comunes
de las empresas de salud. Ley 17132
7RPDPRV FRPR HMHPSOR HQ HVWD WHPiWLFD D OD
mencionada Ley de Ejercicio de la Medicina y
9 - Gestión jurídico legal en organizaciones de atención de la salud / 247
3URIHVLRQHVFRQFXUUHQWHV$XQTXHVHFRQRFHFRPR
GHFDUiFWHU1DFLRQDOGHEHFRQVLGHUDUVHTXHQXHVWUR
SDtVWLHQHXQRUGHQDPLHQWRIHGHUDOSRUORTXHQR
es obligatoria su aplicación en todo el territorio de
OD1DFLyQVLQRVyORHQOD&LXGDGGH%XHQRV$LUHV
1RREVWDQWHKDVLGRDGRSWDGDYROXQWDULDPHQWHSRU
YDULDVSURYLQFLDV\RWRPDGDFRPRSDUiPHWURSRU
ODV-XULVSUXGHQFLDVSURYLQFLDOHVFXDQGRQRH[LVWH
RUGHQDPLHQWR HVSHFt¿FR HQ HOODV ([LVWH XQD VHULHGHREOLJDFLRQHV\SURKLELFLRQHVTXHFRQYLHQH
WHQHUSUHVHQWHVVREUHWRGRDODKRUDGHWHQHUTXH
FRQWUDWDUVHUYLFLRVRSUHVWDGRUHVRHQHOFDVRGH
WHQHUTXHJHVWLRQDURDGPLQLVWUDUXQDLQVWLWXFLyQGH
VDOXG$WtWXORGHHMHPSORVHFLWDQODVPiVWtSLFDV
1. Habilitación de establecimientos:5HTXLHUH
autorización de la Secretaria de Salud. Detalla
HVWUXFWXUDSHUVRQDOLQVWUXPHQWDOQRUPDVGH
KLJLHQH HWF HVSHFt¿FDV SDUD FDGD VHUYLFLR
HQSDUWLFXODU3UHYpVDQFLRQHVKDVWDODFODXVXUDGH¿QLWLYD
'LUHFFLyQ 7pFQLFD GHO HVWDEOHFLPLHQWR
La propiedad debe ser de profesionales de la
VDOXG HQ FDVR FRQWUDULR ORV VRFLRV QR SXHden tener injerencia alguna en la dirección
WpFQLFD(O'LUHFWRU7pFQLFRGHEHVHUPpGLFRXRGRQWyORJRVHJ~QHOWLSRGHHVWDEOHFLPLHQWR\HVUHVSRQVDEOHDQWHODVDXWRULGDGHV
del cumplimiento de normas y obligaciones
legales (no excluye responsabilidad de profesionales por su accionar).
3. Restricciones de publicidad:$UWžGHOD
Ley. Responsable la Institución por sus actos
RSRUODSXEOLFLGDGGHORVTXHHQHOODWUDEDjen. Sanciones pecuniarias y clausuras.
4. Prohibiciones de objeto: Las entidades
TXH VH GHGLFDQ D KLJLHQH \ HVWpWLFD GH ODV
personas no pueden realizar ni promocioQDU DFWLYLGDGHV GH WLSR PpGLFR ([FHSFLyQ
autorización de SP cuando sea necesario un
consultorio para el control de las personas
TXH KDUiQ XVR GH ODV LQVWDODFLRQHV $UW ž
GHFUHWR 5. Prohibiciones relacionadas a ciertos actos
MXUtGLFRV
Contratos de sociedad entre: Médicos y farmacéuticos; odontólogos y farmacéuticos;
odontólogos y mecánicos dentales.
/RVRGRQWyORJRVQRSXHGHQYHQGHUFXDOTXLHU
clase de medicamento o instrumental.
$X[LOLDUHVD¿QHV
Parteras: Prohibición de poseer instrumental ajeno a la especialidad
(Q ORFDOHV GRQGH DWLHQGDQ GLHWLVWDV no
puede haber instrumental médico.
Los mecánicos dentales no pueden tener
sillón de dentista o instrumental propio de
consultorios odontológicos.
5HJLVWURVHVSHFLDOHV(serán analizados más
adelante según las áreas)
Libro Registro Cirugía; de anestesias; liEUR GH DWHQFLRQHV HQ *XDUGLD GH %DQFRV
de sangre; de Hemoterapia; registro de
SURWRFRORVELRTXtPLFRVGHDQDWRPtDSDWRlógica; libro registro de asistidos de actiYLGDGHV GH FRODERUDFLyQ FRQ 2GRQWRORJtD
y Medicina tanto en consultorios como en
HVWDEOHFLPLHQWRVHWF
Espectro de las responsabilidades
de las instituciones de salud
7RGDLQVWLWXFLyQTXHUHDOLFHSUHVWDFLRQHVGHVDlud tiene una doble responsabilidad surgida de
VXVREOLJDFLRQHVDGPLQLVWUDWLYDV\MXGLFLDOHV(V
GHFLUVHREOLJDQDUHVSRQGHUSRUWRGDVDTXHOODV
FLUFXQVWDQFLDV HQ ODV TXH D WUDYpV GH DFFLRQHV
XRPLVLRQHVVHSURGX]FDXQGDxR\TXHHVDDFFLyQXRPLVLyQVHUH¿HUDDQRUPDWLYDVDGPLQLVWUDWLYDVRMXUtGLFDV3RUHQGHSXHGHGHFLUVHTXH
la responsabilidad de los entes asistenciales es
UHSDUDUORVGDxRVRFDVLRQDGRVDWHUFHURVFRPR
consecuencia de las falencias propias de la orJDQL]DFLyQ\RIXQFLRQDPLHQWRGHOHQWHDVLVWHQcial u ocasionados por profesionales médicos de
TXLHQHVVHKDQVHUYLGRSDUDGHVHPSHxDUVXDFWLYLGDG(QEDVHDORGLFKRSRGHPRVGLVFULPLQDU
dos aspectos básicos:
D 5HVSRQVDELOLGDGGHOHQWHGHFDUiFWHUUHÀHMR\REMHWLYRSRUORVKHFKRVGHVXVGHSHQGLHQWHVIXQGDGRHQHOSULQFLSLRGHgarantíaLQFOX\HQGRHODFFLRQDUGHDTXHOORVSURIHVLRQDOHVTXH
SRQHQVXIXHU]DGHWUDEDMR\FRQRFLPLHQWRSHUR
VLQTXHFRQHOORVH[LVWDXQDUHODFLyQGHGHSHQGHQFLD E 5HVSRQVDELOLGDG RULJLQDGD GLUHFWDPHQWHHQHOSURSLRHQWHDVLVWHQFLDODQWHODIDOWD
GH RUJDQL]DFLyQ GH ORV GLYHUVRV HOHPHQWRV TXH
ORFRQVWLWX\HQ 3URI'U&*KHUVL (VWHDVSHFWRKDFHUHIHUHQFLDDOKHFKRGHTXH
OD UHVSRQVDELOLGDG SRU FXDOTXLHU FRQVHFXHQFLD
SHUMXGLFLDO VXUJLGD GH Gp¿FLW R GH¿FLHQFLDV GH
FXDOTXLHUWLSRHQXQHVWDEOHFLPLHQWRDVLVWHQFLDO
±VHDS~EOLFRSULYDGRRGHOD6HJXULGDG6RFLDO±
UHFDHUi VREUH pVWH GDGR TXH WDOHV SUHVWDFLRQHV
VRQHOREMHWRSULQFLSDOSDUDHOTXHVHKDQFRQIRUPDGRSRUORTXHGHEHUiUHVSRQGHUSRUODPDOD
248 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
RUJDQL]DFLyQTXHSHUPLWHODH[LVWHQFLDGHDVSHFWRVYXOQHUDEOHV\SUHVXQWDPHQWHGDxRVRV
9DOH GHFLU H[LVWH XQD UHVSRQVDELOLGDG TXH
QDFHHQODSHUVRQD HPSOHDGRWpFQLFRSURIHVLRQDO RHQODHVWUXFWXUD ItVLFDDSDUDWRORJtDHTXLSRVHWF DWUDYpVGHODTXHVHDSRUXQDFRQGXFWDFXOSRVDRXQDPDODRUJDQL]DFLyQGHOVLVWHPD
XQDSHUVRQDSXHGDVXIULUXQGDxRLQMXVWRUD]yQ
VX¿FLHQWHSRUODTXHOD,QVWLWXFLyQGHEHUiDVXPLU
la responsabilidad. Puede estar relacionada con
dos principios básicos:
‡'HEHQUHVSRQGHUSRUHOFXHUSRGHSURIHVLRnales.
‡'HEHQUHVSRQGHUSRUODREOLJDFLyQWiFLWDGH
seguridad.
Consentimiento Informado: Autorización
GDGDSRUHOSDFLHQWHFDSD]FRQGLVFHUQLPLHQWR\
OLEHUWDGSUHYLDLQIRUPDFLyQFODUDDGHFXDGDDVX
QLYHOLQWHOHFWXDO\SUHFLVDDFHUFDGHORVULHVJRVSRWHQFLDOHV\GHODVGLIHUHQWHVDOWHUQDWLYDVTXHSXGLHVHQH[LVWLUDQWHODUHDOL]DFLyQGHDOJ~QDFWRPpGLFR
TXHSUHVXSRQJDODSRVLELOLGDGGHXQGDxR
La obligación tácita de seguridad se da por
HOKHFKRGHTXHOD,QVWLWXFLyQGHEHWRPDUWRGRV
ORV UHFDXGRV \ SUHYHU WRGRV ORV ULHVJRV FRQVLGHUDQGRTXHODVSHUVRQDVTXHHQWUDQDHOODVRQ
HQIHUPDVHVGHFLUHVWiQHQPLQXVYDOtDGHFRQGLFLRQHV0XFKDMXULVSUXGHQFLDDFWXDOH[WLHQGH
VLQGXGDDOJXQDHVWDREOLJDFLyQDXQDORVLQGLYLGXRVQRHQIHUPRVTXHHQWUDQHQHOOD,JXDOPHQWH
VRQ UHVSRQVDEOHV SRU ORV REMHWRV R HTXLSRV GH
ORVTXHVHYDOHQEDVDGRVHQORVULHVJRVFUHDGRV
por las cosas&&$UWYROYLHQGRDLQVLVWLU
HQTXHSXHGHH[LVWLUHOULHVJRpor la cosa en sí
XQDFDPLOODTXHSRUIDOWDGHPDQWHQLPLHQWRVH
FDLJD\OHVLRQHDXQSDFLHQWH FRPRpor el uso
de la cosa HOPDOHVWDGRGHXQHTXLSRGHHOHFWURFRDJXODFLyQTXHDOXWLOL]DUORSURYRTXHGDxRV
DOSDFLHQWH Las falencias en la administración del sisWHPDWDPELpQHQWUDQGHQWURGHODVUHVSRQVDbilidades de los entes de salud, por ejemplo la
PDODSURJUDPDFLyQGHJXDUGLDVPpGLFDVRGH
RWURWLSR\TXHDQWHXQDVLWXDFLyQGHXUJHQFLD
QRSXHGDORFDOL]DUVHDOSURIHVLRQDOTXHGHELHUDKDFHUVHFDUJRGHOFDVR
b) La admisión de menores (de 21 años) o declarados incapaces por demencia debe ser consentida
SRUSDGUHPDGUHRWXWRU\GHEHindefectiblemente
constar en la historia clínica el consentimiento esFULWRVDOYRTXHVHDGHXUJHQFLDRHPHUJHQFLDGRQGHGHEHUiVHUOHSUHVWDGDODDWHQFLyQTXHUHTXLHUD\
WUDWDUGHORFDOL]DUDORVUHVSRQVDEOHVOHJDOHVRHQ
FDVRGHQRKDOODUORVFXUVDUODQRWL¿FDFLyQDO-XH]
FRQFRPSHWHQFLDHQODPDWHULD([LVWHRWURSXQWR
VREUH WRGR HQ HVWDEOHFLPLHQWRV SULYDGRV ¢TXLpQ
DXWRUL]DODLQWHUQDFLyQ"/RVTXHWLHQHQREOLJDFLyQ
GHSURYHHUDVLVWHQFLD\JDVWRV(QHOFDVRGHKLMRV
GHSDGUHVGLYRUFLDGRVDXWRUL]DODLQWHUQDFLyQ\R
WUDWDPLHQWRVTXLHQHMHUFHODSDWULDSRWHVWDGHVGHFLUTXLHQWLHQHODWHQHQFLDDeben implementarse
normas internas para este ítem que deben estar escritas y ser accesibles en la Institución o Guardia.
Con respecto a los dementes debe recordarse
TXHSXHGHQVHULQWHUQDGRVSRUHOKHFKRRUD]yQ
GHVXGHPHQFLDRSRUSDWRORJtDVDMHQDVDODPLVPD\FRPXQHVDFXDOTXLHUSHUVRQDSRUHMHPSOR
XQD DSHQGLFLWLV DJXGD (O$UW GHO && HVWDEOHFH TXH QDGLH VHUi WHQLGR SRU GHPHQWH VLQ
TXH PHGLH GHFODUDFLyQ GH WDO SRU XQ -XH] 6RQ
GHPHQWHVDFRUGHDGLFKRDUWtFXORDTXHOORVque
no tienen aptitud de dirigir su persona o administrar sus bienes. Sus representantes son los
curadores designados por el Juez.
Pueden ser ingresados:
Autorizaciones para prácticas
o ingresos a internación
En pacientes capaces jurídicamente:
‡(OSUHVXSXHVWREiVLFR\HVHQFLDOHVODDXWRULzación del paciente.
‡ /OHYD LPSOtFLWD OD REOLJDFLyQ GH UHVSHWDU OD
YROXQWDG\DXWRQRPtDGHOPLVPR
‡ 3DUDFRQVXOWDV(;7(51$6\H[iPHQHVFOtQLFRVKDELWXDOHVSRUORJHQHUDOHVWiFLWD
En actos que impliquen un riesgo o alteración potencial física o psíquica:
a) Toda admisión de un individuo adulto y
capaz presupone una autorización del mismo.
6LHQGRO~FLGRVGHEHQ¿UPDUOD'HQRVDEHUHVFULELUR¿UPDUSRGUiSHGLUDXQWHUFHURTXH¿UPH
SRUpOGHODQWHGHXQDDXWRULGDGKRVSLWDODULD(V
un documento básico y como tal debe estar arFKLYDGR\IROLDGRGHQWURGHOD+LVWRULD&OtQLFD
I) Por su demencia:$FRUGHDO$UW&&HO
GHPHQWHQRSXHGHVHUSULYDGRGHVXOLEHUWDG
VDOYRFXDQGRDFULWHULRGHOPpGLFRRGHODDXWRULGDGSROLFLDOVHLQWHUSUHWHTXHVXFRQGXFta pueda ser peligrosa para sí mismo o para
ORV GHPiV /D /H\ GH ,QWHUQDFLyQ
3VLTXLiWULFDUHJXODHVWRVDVSHFWRV
9 - Gestión jurídico legal en organizaciones de atención de la salud / 249
El Juez podrá ordenar la internación psiquiátrica a pedido del:
‡(VSRVRDQRVHSDUDGR
‡/RVSDULHQWHV
‡(O0LQLVWHULRGH0HQRUHVRHO
‡&yQVXOVLIXHUDH[WUDQMHUR
‡ &XDOTXLHU SHUVRQD GHO SXHEOR FXDQGR HO
demente fuera furioso o incomodara a sus
YHFLQRV $UW&&
II) Por otras patologíasVyORVHUHTXLHUHODDXtorización del curador o familiar responsable
para realizar las prácticas o procedimientos.
(O FXUDGRU GHEH DFUHGLWDU VX FRQGLFLyQ
mediante testimonio judicial.
c) Menores emancipados: VRQ ! \ años emancipados por habilitación de edad y
WDPELpQ ORV PHQRUHV TXH KXELHUDQ FRQWUDtGR
PDWULPRQLR 3RVHHQ FDSDFLGDG FLYLO VLQ OLPLWDFLRQHVHQORTXHFRQFLHUQHDdirección y gobierno de su persona\WDPELpQGHVXVELHQHVFRQ
limitaciones impuestas por el Juez.
La autorización es válida si presentan:
‡/RVHPDQFLSDGRVSRUHGDG(VFULWXUD3~EOLFD
LQVFULSWDHQHO5HJLVWUR&LYLOGRQGHFRQVWHOD
PLVPD $UW&&
‡/RVHPDQFLSDGRVSRUPDWULPRQLR&HUWL¿FDGR
de matrimonio o libreta
WXDFLyQUHSXWDGDLQGLVSHQVDEOHSRGUiGHULYDUVH
HO SDFLHQWH D GRQGH FRUUHVSRQGLHVH R DFFLRQDU
SRUHOUHVDUFLPLHQWRFXDQGRH[LVWLHVHXQWHUFHUR
obligado a la cobertura (ver más adelante).
f) Conceptos supuestamente incompatibles:
‡2EOLJDFLyQGHUHVSHWDUODYROXQWDGGHOSDFLHQWHDGXOWR\FDSD]HQWRGRORTXHVHDQHJDWLYD
DWUDWDUVHRUHDOL]DUFXDOTXLHUSURFHGLPLHQWR
R WUDWDPLHQWR TXH HO SURIHVLRQDO OH LQGLTXH
(VGHFLUSULPDHOUHVSHWRDOOLEUHDOEHGUtR\
a la autonomía del paciente.
‡ 3RU RWUD SDUWH H[LVWH OD obligación jurídica de
obrar(VGHFLUHQFLHUWDVVLWXDFLRQHVFRQFUHWDV
HO PpGLFR \R ODV LQVWLWXFLRQHV GH VDOXG HVWiQ
REOLJDGRVDDFWXDU\DEULQGDUVXVVHUYLFLRV
$O UHVSHFWR SRGHPRV GHFLU TXH OD SULPHUD
FLUFXQVWDQFLDVHGDSRULPSHUDWLYRVELRpWLFRV
\DWUDYpVGHOD/H\$UW³UHVSHWDU
OD YROXQWDG GHO SDFLHQWH HQ FXDQWR VHD QHJDWLYDDWUDWDUVHRLQWHUQDUVH´ SHURTXH\D
WUDYpVGHOWH[WRTXHVLJXHVHVHxDODQWUHVH[FHSFLRQHV FODUDV ³VDOYR D LQFRQFLHQFLD
E DOLHQDFLyQ PHQWDO F OHVLRQDGRV JUDYHV
SRUFDXVDGHDFFLGHQWHVWHQWDWLYDVGHVXLFLGLR R GHOLWRV´(V GHFLU HQ HVRV FDVRV GHEH
DFWXDUVHDXQFRQWUDODYROXQWDGGHOSDFLHQWH
Obligación jurídica de obrar.
Admisión. Penalidades derivadas por mal accionar
$QWHODQHJDWLYDGHODLQVWLWXFLyQRSURIHVLRQDO
DEULQGDUDWHQFLyQSXHGHLQFXUULUVHHQOD¿JXUD
de abandono de persona DFRUGH D OD VHJXQGD
SDUWHGHO$UW&3VHH[SUHVD³$VLVWLUDORV
HQIHUPRV FXDQGR OD JUDYHGDG GH VX HVWDGR DVt
ORLPSRQJD\KDVWDWDQWRHQFDVRGHGHFLGLUOD
QRSURVHFXFLyQGHODDVLVWHQFLDVHDSRVLEOHGHOHJDUODHQRWURSURIHVLRQDORHQHOVHUYLFLRS~EOLFRFRUUHVSRQGLHQWH´3RURWUDSDUWHHO&yGLJR
Penal, Art. 106H[SUHVDVHUiSHQDGR³HOTXH
SXVLHUHHQSHOLJURODYLGDRVDOXGGHRWURVHDFRORFiQGRORHQVLWXDFLyQGHGHVDPSDURVHDDEDQdonándolo a su suerte a una persona incapaz de
YDOHUVH\DODTXHVHGHEDPDQWHQHURFXLGDU´
A todo paciente HQJUDYHHVWDGRRTXHVH
e) Admisión de pacientes inconscientes, he- SUHVXPDHQpOGHEHQEULQGiUVHOHWRGRVORVFXLridos o víctimas de un delito con lesiones graves GDGRVEiVLFRVTXHHOSURIHVLRQDO\ODLQVWLWXFLyQ
o gravísimas: deben ser recibidos y debe actuar- puedan brindarKDVWDSRGHUGHOHJDUHQRWUDLQVse de acuerdo a las posibilidades y disponibili- titución o profesional competente tal obligación.
GDGHV OR TXH VH FRQRFH FRPR obligación jurí- /D/H\QRSLGHDFWXDFLyQHVSHFt¿FDVLQRVHWLHdica de obrar EDMR SHQD GH VHU HQFXDGUDGR HO QH OD FRPSHWHQFLD GH XQD HVSHFLDOLGDG ([LJH
binomio Médico-Institución en la categoría de acompañar al paciente en estado de necesidad
abandono de persona. Sólo a posteriori de la ac- hasta ponerlo en manos capaces acorde al pro-
d) Admisión de alcohólicos crónicos, toxicómanosRSDFLHQWHVFRQSDWRORJtDPHQWDOSHUR
TXHQRDOFDQ]DQDPHUHFHUHOUyWXORMXUtGLFRGH
'(0(17(6(OArt. 152 bis del CC los menFLRQD\VRQLQKDELOLWDGRVDWUDYpVGHXQSURFHVR
MXGLFLDOSHURFRPRQRVRQGHPHQWHVHQVHQWLGR
HVWULFWR SXHGHQ UHDOL]DU FLHUWRV DFWRV R DGPLQLVWUDFLRQHV TXH QR HVWpQ H[SUHVDPHQWH PHQcionados en su inhabilitación. Las autoridades
SROLFLDOHV SXHGHQ GLVSRQHU VX LQWHUQDFLyQ SUHYLR FHUWL¿FDGR GH PpGLFR GH SROLFtD X R¿FLDO
cuando puedan ser peligrosos para sí o para los
GHPiV(OHVWDEOHFLPLHQWRGHEHDYLVDUGHLQPHdiato al Juez &&$UW .
250 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
EOHPDTXHSDGH]FD(VWRGHEHTXHGDUELHQFODUR
$VLVWLUHVHWLPROyJLFDPHQWHestar al lado. No
VHSUHWHQGHGHPRGRDOJXQRTXHHOSURIHVLRQDO
SRUHOPHURKHFKRGHVHUORHMHFXWHSUiFWLFDVR
WpFQLFDVSDUDODVTXHQRHVWiKDELOLWDGRRQRWLHne competencia.
(QGH¿QLWLYD\HQODXUJHQFLDexiste obligación de atender al paciente siempre y cuando
se disponga de recursos técnicos y físicos. Pero
en caso de no haberlos, igual debe aceptárselo, brindándole los cuidados básicos posibles,
hasta poder delegar en otro establecimiento que
pueda hacerse cargo y, en caso de derivarlos, lo
hará siempre a través de una ambulancia bajo
el control de un médico. Queda sobreentendido
TXHVLHQODJXDUGLDSXHGHQEULQGiUVHOHFXLGDGRV
HVSHFLDOHVRHVSHFLDOL]DGRV\H[LVWHSURIHVLRQDO
FRPSHWHQWH GHEHQ GiUVHOH PiV DOOi GHO KHFKR
GH TXH QR VHD D¿OLDGR VRFLR R TXH FDUH]FD GH
dinero. El principio ético y jurídico es el riesgo
GH YLGD FX\D SRQGHUDFLyQ UHJLUi OD FRQGXFWD D
tomar.
Libro de Derivaciones de Pacientes: datos
SHUVRQDOHVFXDGURFOtQLFRPRWLYRGHODGHULYDFLyQTXLpQODUHDOL]D\QRPEUHGHOPpGLFRTXH
DFRPSDxDDOSDFLHQWHIHFKD\KRUDGHVDOLGD
Libro de Novedades de Guardia: a llenar
SRU HO -HIH GH JXDUGLD DO LQJUHVR \ HQWUHJD GH
OD JXDUGLD GHWDOODQGR QRYHGDGHV \ QyPLQD GH
DTXHOORVSDFLHQWHVTXHTXHGDQHQHVWDGRGHJUDYHGDG
Libro de Cirugía Mayor: si la Guardia tieQHTXLUyIDQRSURSLRGHEHQDVHQWDUVHFRQVXPR
FXLGDGRWRGRVORVGDWRVGHODLQWHUYHQFLyQHIHFWXDGDFRQIHFKDKRUDSURFHGLPLHQWRUHDOL]DGR
ELRSVLDVLFRUUHVSRQGHQyPLQDGHOHTXLSR¿Uma y sello del cirujano actuante.
Libro o Cuaderno de Enfermería: donde ésWDVDQRWDQODVQRYHGDGHV\SURFHGLPLHQWRVUHDOL]DGRVDORVSDFLHQWHVDWHQGLGRVFRQIHFKDKRUD
\¿UPDDFODUDGD
Libro o Cuaderno de Alcaloides: la enfermera deberá asentar datos personales del paciente
DTXLHQVHOHDSOLFDQDOFDORLGHVVHxDODQGRTXp
SURIHVLRQDOORLQGLFyQRPEUHGHODOFDORLGHGRVLV\YtDIHFKD\KRUD¿UPDQGR\DFODUDQGR
Área o Departamento de Urgencia
'H FRQWDU OD *XDUGLD FRQ VHUYLFLRV DX[LOLDJurisdicción dentro de una estructura hospita- UHV SURSLRV /DERUDWRULR 5D\RV +HPRWHUDSLD
ODULD R VDQDWRULDO FODUDPHQWH LGHQWL¿FDGD TXH 0DWHUQLGDGHWF GHEHQOOHYDUVHORVFRUUHVSRQUHFLEH SDFLHQWHV H[WHUQRV FRQ FXDGURV GH ur- GLHQWHV OLEURV TXH SRU QRUPDWLYD OHJDO FRUUHVgencias o emergenciasSXGLHQGRFXPSOLUWDP- ponda.
ELpQODDWHQFLyQGHLQWHUQDGRVTXHHYROXFLRQHQ
de forma abrupta con cuadros de las siguientes Aspectos generales de todos los libros de Guardia
/RVOLEURVGHEHQVHUGHWDSDVGXUDVUXEULFDGRV
características.
foliados y llenados sin dejar espacios en blanco
Debe contar con:
RFXDQGRHVWRVH[LVWDQDQXODGRVPHGLDQWHXQD
‡DGHFXDGDHVWUXFWXUDItVLFD
‡UHFXUVRVKXPDQRVSUHSDUDGRVHQHPHUJHQWR- OtQHD7RGDVODVFRUUHFFLRQHVRWDFKDGXUDVGHEHUiQ VHU VDOYDGDV \ ¿UPDGDV SRU HO UHVSRQVDEOH
ORJtD\
‡DGHFXDGDQRUPDWL]DFLyQGHWRGRVORVSURFH- del asiento. No pueden arrancarse hojas ni salGLPLHQWRV DFRUGH D ORV UHJODPHQWRV HQ YL- WHDUVHIROLRV7RGRDVLHQWRSRUSURIHVLRQDOGHEH
OOHYDUIHFKDKRUD\DFODUDFLyQPDQXVFULWDRSRU
gencia
sello. El Jefe de Guardia es responsable de su
custodia.
Pautas o criterios básicos que deben cumplirse
&HUWL¿FDGRV: son analizados en dicho acápite.
Libros básicos que deben existir en una Guardia
Secuestros de documentación: En caso de
Libro de Atenciones Realizadas: a llenar con los
GDWRVGHWRGDSHUVRQDDODTXHVHKD\DSUHVWDGR secuestro de documentación ordenado por Juez
FXLGDGRVIHFKD\KRUDGHODDWHQFLyQFRQ¿UPD\ competente:
‡ Si es documentación de Guardia: Si es hosello del médico. En caso del ingreso de una perUDULR HQ TXH QR KD\ DXWRULGDGHV GHQWUR GH
sona muerta deberá detallarse tal circunstancia.
OD ,QVWLWXFLyQ HO -HIH GH *XDUGLD DVXPH OD
Libro de Accidentes de Tránsito y de Accidentes
UHVSRQVDELOLGDG GH OHYDQWDU XQ DFWD GRQGH
de Trabajo:VHDVLHQWDQWRGRVDTXHOORVOHVLRQDGRV
TXHGHFRQVWDQFLD\VHLQFRUSRUHODRUGHQGHO
JUDYHV R JUDYtVLPRV GHWDOODQGR IHFKD KRUD OH-XH]-X]JDGRTXHFRUUHVSRQGD\6HFUHWDUtD
VLRQHVVXIULGDV\GDWRVSHUVRQDOHV(OSROLFtDTXH
GH TXLHQ HV HO 2¿FLDO GH -XVWLFLD R HQFDUUHFLEHODGHQXQFLDGHEH¿UPDUDFODUDQGRQRPEUH
JDGR GHO VHFXHVWUR PDWHULDO TXH VH HQWUHJD
chapa y rango.
9 - Gestión jurídico legal en organizaciones de atención de la salud / 251
PHGLDQWH IRWRFRSLD IROLDGD \ ¿UPDGD GHO
RULJLQDO6LODRUGHQH[SUHVDentregar documentación originalFRQVHUYDUiODIRWRFRSLD
OHJDOL]DGDPHGLDQWHVX¿UPD\ODGHO2¿FLDO
de Justicia actuante.
Guardia deberá comunicar a la autoridad del
establecimiento todo lo actuado –DEBEN EXISTIR NORMAS ESCRITAS.
G (Q HO FDVR GH FRPSOLFDFLRQHV TXH SRQJDQ
HQSHOLJURODYLGDGHODPXMHUGHEHUiLJXDOmente hacerse la denuncia de lesiones gravísimas con prescindencia de si el aborto fue
Internación de pacientes menores
accidental o intencional.
D 6L HV OOHYDGR GH XUJHQFLD DO +RVSLWDO \ QR
De todo ello debe quedar completa constanVHHQFXHQWUDDFRPSDxDGRGHSDGUHVRWXWRU
deberán agotarse los medios de localizar a cia en la Historia Clínica.
éstos.
E 0LHQWUDV VH GHEH SUHVWDU OD DWHQFLyQ TXH Admisión de lesionados
médicamente corresponda. Ni la Institución (QFDVRGHOHVLRQHVJUDYHVRJUDYtVLPDVLQPHQLHO0pGLFRSRGUiQVHUGHPDQGDGRVDFRU- GLDWD GHQXQFLD D OD DXWRULGDG SROLFLDO TXH GHGHDODVJHQHUDOLGDGHVGHOD/H\\DO berá QRWL¿FDUVHGHMDQGRFRQVWDQFLDGHTXLpQOD
CC Art. 269TXHH[SUHVDQTXHODVVXPLQLV- realizó.
WUDFLRQHVTXHVHKDJDQDOPHQRUIXHUDGHOD
(QDTXHOORVFDVRVHQTXHVLQQLQJXQDGXGD
casa de sus padres y en situación de urgente las lesiones puedan haber sido causadas acciQHFHVLGDGVHMX]JDUiQKHFKDVFRQDXWRUL]D- GHQWDOPHQWH HV GHFLU VLQ GROR SRGUi RPLWLUVH
FLyQ GH DTXHOORVF /D OH\ REOLJD D TXH DO OD GHQXQFLD$QWH OD GXGD GHQXQFLDU (Q FXDOPHQRU GH DxRV TXH VH SUHVXPD SHUGLGR TXLHUFDVRGHMDUVHQWDGRHQOD+LVWRULD&OtQLFD
RGHVDPSDUDGRGHEHUiEULQGiUVHOHHODX[LOLR HOSURFHGHU\ODVUD]RQHV'HEHUHFRUGDUVHTXH
QHFHVDULRFXDQGRSXGLHUDKDFHUVHVLQULHVJR DORV¿QHVOHJDOHVHO&3DWUDYpVGHORV$UW
personal y dando cuenta de inmediato a la \ LQGLUHFWDPHQWH ODV FODVL¿FD HQ OHYHV
DXWRULGDG CP art. 108 'HEHUiHQWRQFHVHO JUDYHV\JUDYtVLPDV(QFXDQWRDODVJUDYtVLPDV
HVWDEOHFLPLHQWRVLQRKDSRGLGRGDUFRQORV VRQDTXHOODVTXH³«SURGXMHUHXQDHQIHUPHGDG
PHQWDO FLHUWD R SUREDEOHPHQWH LQFXUDEOH OD
SDGUHVRWXWRUHVSURFHGHUGHWDOPDQHUD
LQXWLOLGDGSHUPDQHQWHSDUDHOWUDEDMRODSpUGLGD
Deben existir normas escritas en la Guardia GHXQVHQWLGRGHXQyUJDQRGHXQPLHPEURGH
de todo lo referente a comunicación a niveles la palabra o de la incapacidad para engendrar o
superiores, oportunidad de aviso a la autori- FRQFHELU´
dad, requisitos, etc.
Admisión de presuntas violaciones
Admisión en caso de abortos
o lesiones por delitos contra la
(en curso o concretados)
integridad sexual (ambos sexos)
a. El hospital público no puede negar trataD (Q FDVR GH OHVLRQHV JUDYtVLPDV FRPR SUHVXQWRUHVXOWDGRGHXQGHOLWRGHHVWHWLSRVH
PLHQWR \R LQWHUQDFLyQ GH XUJHQFLD D XQD
denuncian las lesionesQRODcausa concrePXMHUTXHKDVXIULGRXQDERUWRRTXHORWLHQH
ta que las originó OD TXH QR HV FRPSHWHQHQFXUVREDMRHOSUHWH[WRGHTXHSXHGHVHU
cia del médico sino del titular del derecho
un delito.
acción por instancia privada, Art. 72 CP E8QD,QVWLWXFLyQSULYDGDDODTXHOOHJDXQD
&RQYLHQHUHFRUGDUTXHHQOD-XVWLFLDHOUySDFLHQWH GH HVWDV FDUDFWHUtVWLFDV \ TXH QR
WXORGHDFFHVRFDUQDODEXVLYRRYLRODFLyQOR
SHUWHQH]FD DO VLVWHPD GHEHUi EULQGDUOH ODV
SRQHHO-XH] (QHVWRVFDVRVGHEHQQRUPDDWHQFLRQHVTXHODXUJHQFLDLQGLTXHGHULYiQtizarse como reglas internas de la Guardia las
GROD OXHJR GRQGH FRUUHVSRQGD FREHUWXUD
IRUPDOLGDGHV SDUD UHDOL]DU HO H[DPHQ JLQHSURSLDRVHUYLFLRS~EOLFR FROyJLFRDFRUGHDFLHUWRVSULQFLSLRVH[DPHQ
F 6L GHO LQWHUURJDWRULR R HO H[DPHQ VXUJH HO
GHODQWHGHRWURPpGLFRRHQIHUPHUD\VDOYR
FRQYHQFLPLHQWRGHTXHHODERUWRQRIXHHVSRQWiQHR GHEHUi UHDOL]DUVH OD FRUUHVSRQHYLGHQFLDV GH OHVLRQHV LQWHUQDV QR UHDOL]DU
GLHQWH GHQXQFLD DQWH OD DXWRULGDG SROLFLDO
PDQLREUDV WiFWLOHV LQWUDYDJLQDOHV QL LQWURductorias de ningún instrumental.
debiendo ésta concurrir personalmente a
E(QFDVRGHOHVLRQHVH[WHUQDVOHYHV impronWRPDU FRQRFLPLHQWR ¿UPDQGR OD FRQVWDQcia de haber recibido la denuncia. El Jefe de
tas ungueales, hematomas en muslo, ex-
252 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
coriaciones, etc.) detallarlas en el Libro de
$WHQFLRQHVGH*XDUGLDVLQKDFHUPHQFLyQD
ODFDXVDTXHODVSXGRSURGXFLU
F 3XHGH H[WHQGHUVH XQ FHUWL¿FDGR PpGLFR D
SHGLGRFRQWDOHVKDOOD]JRV\VLQFRPHQWDULR
alguno con respecto a su probable causa o a
ODVUD]RQHVTXHSXHGHDGXFLUODSDFLHQWH
d. Reitero. No se denuncia el presunto delito
sexual HVWR FRUUHVSRQGH DO GDPQL¿FDGR R D
VXSDGUHWXWRURHQFDUJDGR
e. Única excepción en este acápite: Cuando el
SUHVXQWR DEXVDGRD HV PHQRU R LQFDSD] \ VH
VRVSHFKDTXHODGHQXQFLDTXHGHEHVHUUHDOL]DGDSRUSDGUHVWXWRUHVRHQFDUJDGRVQRVHKDUi
SRUHVWDUTXL]iLQYROXFUDGRVHQHOKHFKRGHEHUiGHQXQFLDUVHWDOVRVSHFKDSHURQRDOD3ROLFtD
VLQRDO-XH]FRQFRPSHWHQFLDHQ)DPLOLD/H\
\GHQWURGHODVKV 'HFUHWR
Resumen: El supuesto de presunto delito
QR LQYDOLGD HQ DEVROXWR OD REOLJDFLyQ GH XQD
,QVWLWXFLyQ TXH UHFLEH D XQ SDFLHQWH HQ FRQGLFLRQHVJUDYHVGHEULQGDUOHDVLVWHQFLDGHQWURGH
sus posibilidades tanto humanas como técnicas.
'HQRSRVHHUODVGDUiORVFXLGDGRVHVHQFLDOHVR
EiVLFRVGHTXHGLVSRQJD\GHEHUiDUELWUDUWRGRV
ORV PHGLRV SDUD REWHQHU VX GHULYDFLyQ /R TXH
GHEH GHPRVWUDUVH DQWH FXDOTXLHU GHQXQFLD HV
TXHVHREUyFRUUHFWDPHQWH\VHUHVSHWyDODSHUVRQDFRPRWDO7RGRHOORGHEHTXHGDUDVHQWDGR
SRUHVFULWRSDUDHYLWDUVHUFXOSDGRVGHFRPSOLFDciones no deseadas o del óbito.
Addenda para servicios de UTI
0XHUWH FHUHEUDO'XUDQWH VLJORV OD PXHUWH WXYR
XQDFRQQRWDFLyQ\H[SUHVLyQFODUD\FRQWXQGHQWH\
TXHIXHSHUIHFWDPHQWHGH¿QLGDSRUHMHPSORFRPR
³HOFHVHGHODVIXQFLRQHVQHUYLRVDFLUFXODWRULDUHVSLUDWRULD\WHUPRUUHJXODGRUD´ Pero fue menester
OOHJDUDORVDxRVFRQWRGRVORVPpWRGRVGHUHDQLPDFLyQ \ PDQWHQLPLHQWR DUWL¿FLDO GH OD YLGD
DXQDGRV D OD WpFQLFD GH ORV WUDQVSODQWHV FXDQGR
HVWHOtPLWH¿QGHOSURFHVRmorir y consolidación
GHODPXHUWHFRPHQ]yDVHULPSUHFLVR\ERUURVR
Si ya siglos atrás Ambrosio Pare había dicho: ríen
n’est plus sûr que la mort, rien n’est moins sûr que
son heure QDGDHVPiVVHJXURTXHODPXHUWHQDGD
HVPHQRVVHJXURTXHVXKRUD FLWDGRSRU%RQQHW
HVWDPi[LPDFREUyDPSOLDPHQWHYLJHQFLD3RUTXH
FRQ ODV WpFQLFDV GH VRSRUWH PHFiQLFR GH OD YLGD
¢FXiQGRGHEH¿MDUVHHVHOtPLWH"/DQHXUR¿VLRORJtD
YLQR±UHODWLYDPHQWH±HQD\XGDSDUDHQIUHQWDUHVWH
GLOHPD<DVtVHFRQVLGHUyTXHFXDQGRODDFWLYLGDG
de todaODFRUWH]DFHUHEUDOHVWXYLHVHGHVDSDUHFLGD
y a ello se agregare la destrucción de las estructuUDVGHOWURQFRFHUHEUDO\HOSDFLHQWHVyORSXGLHVH
VREUHYLYLU PHGLDQWH HO DSR\R UHVSLUDWRULR PHFiQLFR\HVWRFRPRHVREYLRSHUIHFWDPHQWHFRPSUREDGRPHGLDQWHHVWXGLRVFRPSOHPHQWDULRVmás
XQULJXURVRH[DPHQQHXUROyJLFRmásXQD¿QDGR
MXLFLRFOtQLFRSRGUtDFRQVLGHUDUVHTXHHVHSDFLHQWH
VH KDOOD HQ HO HVWDGR TXH KR\ VH UHFRQRFH FRPR
muerte cerebral o muerte encefálica HQWHQGLHQdo como encefálica la suma de ambas estructuras
HQXQFLDGDVFRUWH]DFHUHEUDO\WURQFRHQFHIiOLFR \
TXHOD/H\ /H\GH7UDQVSODQWHV OHJLWLPy
H[SUHVDQGRHQVX$UW³(OIDOOHFLPLHQWRGHXQD
SHUVRQDVHFRQVLGHUDUiWDOFXDQGRVHYHUL¿TXHQGH
PRGRDFXPXODWLYRORVVLJXLHQWHVVLJQRVTXHGHEHUiQSHUVLVWLULQLQWHUUXPSLGDPHQWHVHLV KRUDV
GHVSXpV GH OD FRQVWDWDFLyQ FRQMXQWD D DXVHQFLD
LUUHYHUVLEOH GH OD UHVSXHVWD FHUHEUDO FRQ SpUGLGD
DEVROXWDGHFRQFLHQFLDE DXVHQFLDGHUHVSLUDFLyQ
HVSRQWiQHD F DXVHQFLD GH UHÀHMRV FHIiOLFRV \
FRQVWDWDFLyQGHSXSLODV¿MDVQRUHDFWLYDVG LQDFWLYLGDGHQFHIiOLFDFRUURERUDGDSRUPHGLRVWpFQLFRV
\RLQVWUXPHQWDOHVDGHFXDGRVDODVGLYHUVDVVLWXDFLRQHVFOtQLFDVODYHUL¿FDFLyQGHORVUHIHULGRVHQ
HOLQFLVRG QRVHUiQHFHVDULDHQFDVRGHSDURFDUGLRUUHVSLUDWRULRWRWDOHLUUHYHUVLEOH´
&RQYLHQHUHPDUFDUTXHHQODDFWXDOLGDGHVWD
aceptación de la muerte cerebral como criteULRGHPXHUWHVyORULJHDORV¿QHVGHODOH\GH
WUDQVSODQWHV OR TXH QR REVWD D TXH H[LVWD XQD
FRUULHQWHTXHHQWLHQGDTXHHVWHFULWHULRGHEHVHU
H[WHQVLEOH D WRGR HO PDUFR MXUtGLFR DUJHQWLQR
7DPELpQFRQYLHQHGHVWDFDUHQIRUPDSUHSRQGHUDQWHTXHHVWRVFULWHULRVGHPXHUWHFHUHEUDOGHEHUiQVHUDFRPSDxDGRVGHXQDULJXURVDHYDOXDFLyQFOtQLFDGHWRGRHOFXDGURJHQHUDOGHELHQGR
DGHPiV VHU FRQVWDWDGRV SRU WUHV SURIHVLRQDOHV
de los cuales uno debe ser o médico neurólogo
RQHXURFLUXMDQR8QDFXLGDGRVDJXtDPHWRGROyJLFD HGLWDGD SRU HO ,1&8&$, HVSHFL¿FD FyPR
GHEHUiQ UHDOL]DUVH ODV SUXHEDV \ SRU FLHUWR HV
y será actualizada de forma permanente acorde
DODVPHMRUHVWpFQLFDVGLDJQyVWLFDVTXHSXHGHQ
surgir en relaciones a progresos técnicos.
/DFDVVDJQH$Precís de Médicine Legale3DULV&LWDGRSRU1HLUR5RMDVMedicina Legal. Bs. As.: El
(GLWRULDO$WHQHR
9 - Gestión jurídico legal en organizaciones de atención de la salud / 253
1RHVWiGHPiVUHFDOFDUTXHTXHGDQIXHUDGH
HVWDGH¿QLFLyQORVFXDGURVGHORVHVWDGRVYHJHWDWLYRV FUyQLFRV WUDWDGRV HQ RWUD SDUWH GH HVWH
FDStWXOR \ TXH UHSUHVHQWDQ VyOR XQ HVWDGR GH
desaparición de la corteza cerebral a causa de
XQDVHULHGHSRVLEOHVSDWRORJtDVSHURFRQFRQVHUYDFLyQ GH ODV IXQFLRQHV GHO WURQFR FHUHEUDO
HVWDGRGHQRPLQDGRHQIRUPDHUUyQHD\FRQIXVD
como muerte cortical. Quedan también fuera de
ODGH¿QLFLyQ¿MDGDDOFRPLHQ]RGHHVWHDSDUWDGRDTXHOORVFDVRVOODPDGRVGHsíndrome de enclaustramiento o locked-in syndromeTXHWLHQHQ
por etiología la destrucción de las estructuras del
WURQFR FHUHEUDO YtDV ODUJDV LQFOXLGDV \ TXH GD
SRUUHVXOWDGRXQDFXDGULSOHMLDWRWDOFRQVHUYDQGRVyORORVPRYLPLHQWRVRFXODUHVH[WHUQRVSHUR
FRQ SOHQD FRQVHUYDFLyQ GH ODV IXQFLRQHV FHUHbrales superiores.
Ley de Protección contra violencia familiar
LEY 24417
Art. 1: Toda persona que sufriese lesiones o
maltrato físico o psíquico por parte de alguno
de los integrantes del grupo familiar podrá denunciar estos hechos... ante el Juez con competencia en asuntos de familia.
Art. 2: &XDQGRORVGDPQL¿FDGRVIXHVHQPHnores o incapaces, ancianos o discapacitados,
los hechos deberán ser denunciados por sus representantes legales y/o el Ministerio Público.
También están obligados a efectuar la denuncia
los servicios asistenciales sociales o educativos,
públicos o privados, los profesionales de la salud y todo funcionario público en razón de su
labor...
Egresos
D1LQJ~QLQWHUQDGRDGXOWRHQXVRGHVXVIDFXOWDGHVPHQWDOHV\HQGRQGHQRH[LVWDLQWHUYHQFLyQSROLFLDOSRGUiVHUREOLJDGRDSHUPDQHFHULQWHUQDGRFRQWUDVXYROXQWDG7DOKHFKR
VLJQL¿FDUtDXQGHOLWRFRQWUDODOLEHUWDG
E 3HUR DWHQWR D TXH XQ DOWD SUHPDWXUD SXHGH
DJUDYDUHOFXDGURGHEHUiWUDWDUGHGLVXDGLUOR 'H QR FRQVHJXLUOR VH OH KDUi ¿UPDU HQ
la Historia Clínica una declaración de egreso
SRUVXSURSLDYROXQWDGUHVSRQVDELOL]iQGROR
de las consecuencias.
F(QFDVRGHQHJDUVHDHVFULELUWDOGHFODUDFLyQ
se dejará constancia de todo lo actuado ante
GHVHUSRVLEOH XQRRGRVWHVWLJRV PpGLFRV
HQIHUPHUDV HWF DVHQWDQGR WRGR HOOR HQ OD
+LVWRULD&OtQLFD\¿UPDQGRHOSURIHVLRQDO\
los testigos.
d. La petición de alta de incapaces deberá ser
¿UPDGD HQ ODV PLVPDV FRQGLFLRQHV SRU ODV
SHUVRQDVTXHYiOLGDPHQWHSXGLHURQDXWRUL]DU
su ingreso.
H (Q FDVR GH SDFLHQWHV LQFRQVFLHQWHV SRU
DTXHOORVTXLHQHVOHJDOPHQWHFRPSHWDFXPpliendo las mismas formalidades y asumiendo todas las responsabilidades emergentes.
I /RV SDFLHQWHV TXH VH KDOODQ EDMR DFWXDFLyQ
SROLFLDOHVGHFLUEDMRODUHVSRQVDELOLGDGGHO
-XH]VyORSRGUiQVHUGDGRVGHDOWDFRQWUDOD
HQWUHJD GHO R¿FLR -XGLFLDO TXH DXWRULFH WDO
KHFKR(QFDVRGHIXJDGHHVWRVSDFLHQWHVOD
responsabilidad recae sobre los encargados
GHODFXVWRGLD habitualmente la policía \QR
sobre los profesionales o la Institución donde
se hallaban internados. De ninguna manera
el médico podrá autorizar altas transitorias o
GH¿QLWLYDVGHHVWRVSDFLHQWHV
J 3RU ¿QDOL]DFLyQ GH EHQH¿FLR en caso de
FHVHGHOEHQH¿FLRGHLQWHUQDFLyQDWUDYpVGH
XQ VLVWHPD SULYDGR R GH REUDV VRFLDOHV SRU
haberse agotado el tiempo de cobertura auWRUL]DGRGHEHUiQDUELWUDUVHORVPHGLRVSDUD
un traspaso ordenado hacia un prestador púEOLFR HQ HO FDVR TXH VH UHTXLULHUD OD FRQWLQXLGDGGHODDVLVWHQFLD&XDQGRREWHQLGDOD
GHULYDFLyQ HO SDFLHQWH QR GHVHD LQJUHVDU DO
KRVSLWDO DVLJQDGR VLQR TXH LQWHUUXPSH YROXQWDULDPHQWHVXWUDWDPLHQWRFHVDODUHVSRQsabilidad de ambas instituciones por negatiYDGHOSDFLHQWHDVHULQWHUQDGR'HEHGHMDUVH
cuidadosa constancia de todo en Historia
Clínica.
h. Por no contar el establecimiento con los medios técnicos y/o humanos necesarios
Deben también arbitrarse los medios de hacer
XQWUDVSDVRRGHULYDFLyQRUGHQDGDKDFLDXQD
,QVWLWXFLyQTXHVtORVSRVHDGHMDQGRGHELGD
constancia en la Historia Clínica. Cuando el
SDFLHQWHHVWiEDMRXQDFREHUWXUDREOLJDWRULD
SRUOH\RSRUFRQWUDWRGHEHUiQUHVSHWDUVHODV
LQVWDQFLDV FRUUHVSRQGLHQWHV VDOYR FDVRV GH
JUDYHGDGRXUJHQFLDPDQL¿HVWD
L 'HEHUi HYLWDUVH FDHU HQ HO OXJDU FRP~Q GH
GHFLU R HVFULELU TXH XQ SDFLHQWH DGXOWR FDSD]\FX\DLQWHUQDFLyQQRIXHRUGHQDGDSRU
XQ-XH]³VHIXJy´6HIXJDQORVTXHSRUREOLgación deben permanecer internados por me-
254 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
QRUHVRSRUPDQGDWRGHMXH]'HORFRQWUDULR Ley 24540 (mod. 24884).
el paciente se retiró por su voluntad y sin Régimen identificación recién nacido
‡ )XQGDPHQWR FRQVHUYDFLyQ GH LGHQWLGDG GHO
dar aviso.
binomio madre-hijo
‡7RGRUHFLpQQDFLGRYLYRRPXHUWRGHEHVHU
Servicio de Hemoterapia
LGHQWL¿FDGR
‡)XQGDPHQWRVHQOD/H\GHVDQJUH /H\ ‡ 'HEHQ LGHQWL¿FDUVH PDGUH \ QLxR DQWHV GHO
corte del cordón.
\'HFUHWRB3(1
‡ $ FDUJR GH 0pGLFR (VSHFLDOLVWD HQ ‡,GHQWL¿FDFLyQHQ¿FKD~QLFDQXPHUDGDSRUHO
Reg. Nac. de las Personas por triplicado
Hemoterapia
‡ /DV SUiFWLFDV SRGUiQ VHU HIHFWXDGDV SRU ‡ ,GHQWL¿FDFLyQ GH OD PDGUH DQWHV GH HJUHVR
6LQRVHSXGRGHMDUFRQVWDQFLDGHWDOLPSR7pFQLFRV KDELOLWDGRV EDMR HO FRQWURO GHO
sibilidad.
+HPRWHUDSHXWDHPSHURTXHGDHQFDEH]DGH
pVWH \ GH OD ,QVWLWXFLyQ OD UHVSRQVDELOLGDG ‡ 0HQRU HPEDUD]DGD VROWHUD VLQ '1, \R UHSUHVHQWDQWHVOHJDOHVVHGHEHGDUDYLVRDODVHprimaria.
sor de menores competente por parte de las
‡ $UFKLYR GH ORV &HUWL¿FDGRV GH SHGLGRV GH
autoridades de la Institución.
transfusión de médicos tratantes en formula‡ 6L VH UHWLUD HO QLxR VLQ OD PDGUH LGHQWL¿FDrios ad hoc $UWž'HFUHWR
FLyQ IHKDFLHQWH \ KXHOODV GLJLWDOHV GH TXLHQ
‡/LEURUHJLVWURGH7UDQVIXVLRQHVIROLDGRHQORUHWLUDËGHPVLHVXQQDFLGRPXHUWRSUHYLD
FXDGHUQDGR\¿UPDGRSRUHOUHVSRQVDEOH
autorización médica.
Maternidad
‡1DFLPLHQWR
‡'HIXQFLRQHV
‡ 0RGHORV QRUPDWL]DGRV SRU ORV KRVSLWDOHV
Municipales para Nacidos muertos¿UPDGRV
y aclarados por el profesional actuante.
‡ 6L QDFLy YLYR \ YLYLy DXQTXH VHD XQRV LQVWDQWHV FRUUHVSRQGHQ DPERV FHUWL¿FDGRV GH
Nacimiento y de Defunción
‡ 6L QDFLy PXHUWR &HUWL¿FDGR GH 'HIXQFLyQ
Fetal
‡/DVSHQDOLGDGHVSRUFHUWL¿FDGRVIDOVRVHQWUDQ
GHQWURGHO&3$UW\
(O REMHWR GH LGHQWL¿FDU FODUDPHQWH VL QDFLy
PXHUWRRQDFLyYLYLyXQRVLQVWDQWHV±RPiV±\
IDOOHFLyHVWiPX\UHODFLRQDGRFRQDVSHFWRVTXH
QRUPD HO &yGLJR &LYLO (O Art. 70 H[SUHVD
“Desde la concepción en el seno materno coPLHQ]DODH[LVWHQFLDGHODVSHUVRQDV\DQWHVGH
VXQDFLPLHQWRSXHGHQDGTXLULUDOJXQRVGHUHFKRV
FRPRVL\DKXELHUDQQDFLGR(VRVGHUHFKRVTXHGDQLUUHYRFDEOHPHQWHDGTXLULGRVVLORVFRQFHELGRVHQHOVHQRPDWHUQRQDFLHUHQFRQYLGDDXQTXH
fuera por instantes después de estar separado de
ODPDGUH´&RPRVHYHSDUDODOH\DUJHQWLQDOD
YLGDKXPDQDHVXQELHQMXUtGLFRSURWHJLGRDSDUtir de la concepción –dentro o fuera del seno maWHUQR± GHQRPLQiQGRVHOD persona por nacer 3RU WDQWR OD VXSUHVLyQ GH HVD YLGD HQ HO VHQR
PDWHUQR SDUDODOH\DUJHQWLQDHVGHOLWR
Morgue
‡7RGRLQJUHVDGRDJXDUGLDTXHIDOOHFHDFDXVDGHSUHVXQWRVGHOLWRV\RDFFLGHQWHVGHEH
VHUGHQXQFLDGRHQVHGHSROLFLDOSLGLHQGRVX
LQWHUYHQFLyQ
‡)DOOHFLGRVHQLQWHUQDFLyQ\FRQGXGDVGLDJQyVWLFDV GHEH UHDOL]DUVH DXWRSVLD (O $QiWRPR
3DWyORJR ¿UPDUi HO &HUWL¿FDGR 6L ORV IDPLOLDUHVQRDXWRUL]DQODDXWRSVLD\H[LVWHQGXGDV
VREUH OD PLVPD HO PpGLFR GHEH H[WHQGHU HO
&HUWL¿FDGRGH'HIXQFLyQSRQLHQGRHQFDXVD
GHPXHUWH³PXHUWHGHFDXVDGXGRVD´3RUIDYRUHYLWDUODIUDVH³PXHUWHGXGRVD´/DPXHUte nunca es dudosa. Diagnosticada correctamente es el único hecho biológico irrebatiblemente cierto en un ciento por ciento.
‡ 6L GXUDQWH XQD QHFURSVLD VXUJHQ VLJQRV TXH
VXSRQHQODH[LVWHQFLDGHXQKHFKRGXGRVRVH
suspende y se hace denuncia policial.
‡(QWRGRFDGiYHUEDMRLQWHUYHQFLyQSROLFLDOno
puede ser realizada la necropsia hospitalaria
QLHQWUHJDUVHHOFDGiYHUDORVIDPLOLDUHVVLQ
la autorización del Juez competente.
‡ 'HPiV VLWXDFLRQHV DWHQHUVH D QRUPDWLYDV
SURSLDV GHO HVWDEOHFLPLHQWR 6L QR H[LVWHQ
¡CREARLAS!
‡(Q0RUJXHQRVHUHFLEHQQLVHHQWUHJDQFDGiYHUHVVLQODFRUUHVSRQGLHQWHDXWRUL]DFLyQ
¿UPDGD SRU HO -HIH GH 6HUYLFLR R -HIH GH
Guardia.
9 - Gestión jurídico legal en organizaciones de atención de la salud / 255
‡5HDOL]DULGHQWL¿FDFLyQSUHFLVDGHTXLHQORUHWLra. Responsabilidad del personal de morgue
‡'HEHQH[LVWLU)RUPXODULRVGH(QWUHJDGHFDGiYHUHVQXPHUDGRV\SRUWULSOLFDGR FXDQGR
se mandan de sala a morgue ‡ 'HEHQ H[LVWLU )RUPXODULRV GH 2UGHQ GH
(QWUHJDGHFDGiYHUHVQXPHUDGRVFRQFRSLD
retiro de cadáveres de la morgue ‡ (Q 0RUJXH /LEUR 5HJLVWUR GH 5HFHSFLyQ \
(QWUHJDGHFDGiYHUHV
‡ 1RUPDWLYDV HQ FDGD HVWDEOHFLPLHQWR LGHQWL¿FDQGR TXLpQ DXWRUL]D HVWRV PRYLPLHQWRV
0X\LPSRUWDQWHDORV¿QHVGHUHVSRQVDELOLdad institucional.
Ley de SIDA Nº 23798
$UWžHO3RGHU(MHFXWLYRGLFWDUiODV1RUPDV
de Bioseguridad
$UWžORVSURIHVLRQDOHVTXHDWLHQGDQDSHUVRQDVLQWHJUDQWHVGHJUXSRVHQULHVJRGHDGTXLULU
HOVtQGURPHGHLQPXQRGH¿FLHQFLDHVWiQobligados a prescribir las pruebas diagnósticas.
$UWžREOLJDDODGHWHFFLyQGHOYLUXV\VXV
anticuerpos en sangre humana destinada a transIXVLyQ HODERUDFLyQ GH SODVPD HWF 7DPELpQ
obligatoria la detección para donantes de órgaQRVWUDQVSODQWHVHWF
$UWžORVPpGLFRVWUDWDQWHVTXHGHWHFWHQHO
YLUXV +,9 RWHQJDQIXQGDGDVSUHVXQFLRQHVGH
TXHXQLQGLYLGXRHVSRUWDGRUGHEHUiQLQIRUPDUle sobre el carácter infectocontagioso del misPR PHFDQLVPR GH WUDQVPLVLyQ \ VX GHUHFKR D
recibir asistencia adecuada.
$UWžQRWL¿FDFLyQGHHQIHUPRVFRQ6,'$
VHUi SUDFWLFDGD GHQWUR GH ODV KV DFRUGH D
OD /H\ GH QRWL¿FDFLyQ GH HQI LQIHFF Igualmente la muerte de un enfermo.
Art. 11 Las autoridades sanitarias mantenGUiQORVUHJLVWURV/RVPLVPRVFRPRODVGHQXQFLDVGHEHQVHUFRGL¿FDGRVVLQLQGLYLGXDOL]DUDO
SDFLHQWH\DORV¿QHVHSLGHPLROyJLFRV
$UWžVHHVWDEOHFHUiQQRUPDVGH%LRVHJXULGDG
SDUDPDWHULDOGHVFDUWDEOHRQR(OLQFXPSOLPLHQWR
GHHVWDVQRUPDVVHUiFRQVLGHUDGRIDOWDJUDYtVLPD
\ODUHVSRQVDELOLGDGFDHUiVREUHHOSHUVRQDOTXHOR
PDQLSXOHFRPRVREUHORVSURSLHWDULRV\ODGLUHFción técnica del establecimiento. Ley de vigencia
nacional.
FLyQWRPHFRQRFLPLHQWRGHTXHXQDSHUVRQDVH
HQFXHQWUDLQIHFWDGDSRUHOYLUXV+,9RVHKDOOD
HQIHUPDGH6,'$WLHQHSURKLELGRUHYHODUGLFKD
información y no pueden ser obligados a sumiQLVWUDUODsalvo:
1. A la persona infectada o enferma o a su representante en caso de incapaz
$RWURSHUVRQDOPpGLFRFXDQGRVHDQHFHVDrio para su cuidado o tratamiento
$ORVHQWHVGHO6LVWHPD1DFLRQDOGH6DQJUH
FUHDGRVSRU$UW/H\
$O'LUHFWRUGHOD,QVWLWXFLyQKRVSLWDODULDR
HQVXFDVRDOGLUHFWRUGHORVVHUYLFLRVGHKHPRWHUDSLDFXDQGRUHVXOWHQHFHVDULRSDUDVX
tratamiento
$ ORV -XHFHV HQ YLUWXG GH DXWR MXGLFLDO HQ
causas criminales o en asuntos de familia
6. A los establecimientos mencionados en la
Ley de Adopción. La información sólo pueGH VHU WUDQVPLWLGD D ORV SDGUHV VXVWLWXWRV
guardadores o tutores adoptantes
%DMRODUHVSRQVDELOLGDGGHOPpGLFRDTXLHQ
RTXLHQHVGHEHQWHQHUHVDLQIRUPDFLyQSDUD
HYLWDUXQPDOPD\RU
Art. 6º el profesional médico tratante deterPLQDUiODVPHGLGDVGHGLDJQyVWLFRSUHYLRFRQVHQWLPLHQWRGHpVWH/HDVHJXUDUiODFRQ¿GHQFLDOLGDG\SUHYLDFRQ¿UPDFLyQGHORVUHVXOWDGRVOR
asesorará debidamente. De ello se dejará consWDQFLDHQHOIRUPXODULRTXHDHVHHIHFWRDSUXHEH
el Ministerio de Salud.
$UWž/DLQIRUPDFLyQH[LJLGDVHHIHFWXDUi
SRUQRWL¿FDFLyQIHKDFLHQWH6HH[WHQGHUiHQRULginal y duplicado y se entregará personalmente
DOSRUWDGRUGHOYLUXVeVWHGHYROYHUiODFRSLD¿UPDGDTXHVHUiDUFKLYDGDSRUHOPpGLFRWUDWDQWH
CONFLICTOS ÉTICO LEGALES AL FIN DE LA VIDA
Eutanasia
$ WUDYpV GHO WLHPSR \ ODV GHIRUPLGDGHV LQWHUSUHWDWLYDVODSDODEUDHXWDQDVLDIXHDGTXLULHQGR
GLYHUVRV PDWLFHV WRUQiQGRVH XQ YRFDEOR FDVL
LPSRVLEOH GH GH¿QLU \ UHSUHVHQWDQGR HQ SDODEUDV GH 9HUVSLHUHQ XQ SDUDGLJPD GH OD
DPELJHGDGVHPiQWLFD%XVFDQGRODHWLPRORJtD
~QLFD IRUPD GH UHFXSHUDU VX VHQWLGR SULPLWLYR
HOWpUPLQRH[SUHVDHQVXDFHSFLyQGHULYDGDGHO
Decreto reglamentario
griego buena muerte. En consecuencia coincido
$UW ž inciso c): /RV SURIHVLRQDOHV PpGLFRV FRQHO'U1LxR op. cit. HQDWULEXLUWDOVHQWLGR
DVt FRPR WRGD RWUD SHUVRQD TXH SRU VX RFXSD- al término. Sin entrar a detallar la cantidad de
256 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
GH¿QLFLRQHV\GLYHUVDVFDWHJRUtDVQDFLGDVGHOD
SDODEUD HXWDQDVLD \ TXH SRU FLHUWR GL¿HUHQ GH
DXWRUHQDXWRUGLJDPRVTXHFRPRPpGLFRVGHbemos no ubicarnos conceptualmente interpreWDQGRTXHGLFKRWpUPLQRHQJOREDDTXHOODVLWXDFLyQHQTXHODPXHUWHVHSURGXFHQDWXUDOPHQWH
VLQVXIULPLHQWRVDORVTXHHOPXULHQWHRXQWHUcero contribuye con medios inocuos e incapaces
GHDFHOHUDUHOFXUVRYLWDOSHURTXHSURFXUDQDOLYLRDQDOJHVLDRFRQIRUW(VWRSRGUtDFRQVLGHUDUse como una forma natural de eutanasia.
3HURDOODGRGHpVWDH[LVWHQRWUDVPRGDOLGDGHVHQODVTXHGHEHQGLIHUHQFLDUVHGRVIDFWRUHV
IXQGDPHQWDOHV D HO DXWRU \ E OD DFWLWXG TXH
DGRSWDpVWHHQUHODFLyQDOFXUVRYLWDOLQH[RUDEOHHVGHFLUVLHVFDSD]GHDFRUWDURQRHOFXUVR
YLWDO &XDQGR HO PpGLFR DGRSWD XQD FRQGXFWD
DFWLYD DOLYLDQGR VXIULPLHQWRV \ GRORUHV D~Q
FRQ FRQGXFWDV PRGHUDGDPHQWH DJUHVLYDV SHUR
VLQDFRUWDUHOFXUVRYLWDOHVSHUDGRHVGHFLUVLQ
DFHOHUDUHVWHGHFXUVRQRVKDOODPRVHQUHDOLGDG
frente a una obligación ética y moral del méGLFR TXH QR HV SDVLEOH GH UHSURFKH DOJXQR \
TXHQLVLTXLHUDGHEHFRQVLGHUDUVH3HURDOODGR
GHHVWDFRQGXFWDH[LVWHXQDFFLRQDU±RSRUHO
FRQWUDULRXQDRPLVLyQ±GHODFRQGXFWDTXH±\
siempre teniendo en cuenta el respeto sagrado
DO SDFLHQWH EiVLFDPHQWH VX DXWRQRPtD \ VXV
GHUHFKRVSUHYLRFRQVHQWLPLHQWRGHpVWH RHQ
FDVRGHLQFRPSHWHQFLDGHVXVIDPLOLDUHVGLUHFWRV ±SURGXFHXQDFRUWDPLHQWRRVXSULPHHVWH
GHFXUVRYLWDO(VORTXH1LxROODPDeutanasia
resolutivaODTXHDVXYH]SXHGHVHUKHWHUyQRPDRDXWyQRPD VHJ~QTXLHQDFW~H \DFWLYDR
SDVLYDVHJ~QVHDSRUDFFLyQRSRURPLVLyQ'H
VXVGLYHUVDVFRPELQDFLRQHVQDFHODWLSL¿FDFLyQ
GHHVWDVFRQGXFWDVTXHQRVHWUDWDUiQHQGHWDOOH
DTXt\DTXHHOREMHWRGHHVWHWUDEDMRHVVLPSOHPHQWH RIUHFHU XQ VRPHUR ERVTXHMR UHFRPHQGDQGRDOOHFWRULQWHUHVDGRORVWH[WRVPHQFLRQDdos en la bibliografía como AconsejadosSDUD
profundizar los conocimientos.
/RTXHVtLQWHUHVDDFiHVPHQFLRQDUTXHWRGD
decisión tomada en estos casos por el médico
deberá considerar:
‡4XHODSDWRORJtDVHDYHUGDGHUDPHQWHWHUPLQDO
e incurable con los métodos disponibles
‡ 4XH VHDQ UHVSHWDGDV GH PRGR LUUHVWULFWR OD
autonomía del enfermo y su independencia
\ VREUH WRGR TXH HO PpGLFR GHPXHVWUH XQ
UHVSHWRUHYHUHQFLDOSRUODYLGDORTXHQRLPpide –y en circunstancias perfectamente pautadas– las conductas eutanásicas.
‡1RGHEHDWHQGHUVHVyORDORVGHVHRVGHOSDFLHQWHQLGHVXVIDPLOLDUHVVLQRHQHVSHFLDO
DODSDWRORJtDGHEDVH WHUPLQDOHLQFXUDEOH
FRPRVHGLMR \DTXHUHDOPHQWHUHSUHVHQWH
un deterioro inadmisible con la dignidad del
hombre.
‡ (Q FDVR GH SDFLHQWHV LQFRPSHWHQWHV FRPD
SURIXQGR R GHWHULRUR PHQWDO LUUHYHUVLEOH \
GH¿QLWLYR ±GHPHQFLD GHEHUi SODQWHDUVH OD
VLWXDFLyQ D OD IDPLOLD TXLHQ VHUi HQ GH¿QLWLYDODTXHGHFLGLUi(VGHFLUHOPpGLFRVROR
obrará por su cuenta cuando no se dé ninguna
GHODGRVDOWHUQDWLYDVROLEUHFRQVHQWLPLHQWR
del paciente o de los familiares directos o representantes legales.
‡/DDWHQFLyQDOPRULEXQGRGHEHUiVHUFRQWRGRV
ORV PHGLRV GH TXH VH GLVSRQJD DWHQGLHQGR
HQFDVRGHQRVHUSRVLEOHRDFRQVHMDEOHWUDWDmientos encuadrables dentro de los llamados
de medicina paliativa(VWRLQFOX\HVLQOXJDU
DGXGDVDOLYLDUHOGRORUFRQODVDUPDVTXHVH
SRVHDDXQTXHVXXVRUHSUHVHQWHRVLJQL¿TXH
ODDEUHYLDFLyQGHOFXUVRYLWDO'HEHUiPHQFLRQDUVHHQHVSHFLDOTXHDWHQGLHQGRDODOLEHUWDG
GHOLQGLYLGXRVLpVWHHQXVRGHUD]yQSUH¿HUH
SRUUD]RQHV¿ORVy¿FDVRUHOLJLRVDVPRULUFRQ
OXFLGH]DXQDULHVJRGHVXIULUHOGRORUGHEHUi
UHVSHWDUVHDXOWUDQ]DGLFKDRSFLyQ\DTXHIRUma parte de su derecho inalienable a elegir su
forma de morir ante el trance ineludible.
‡ 5HFRQRFHU TXH HV pWLFR VXPLQLVWUDU D HQIHUPRV WHUPLQDOHV DTXHOORV SURFHGLPLHQWRV R
técnicas llamados genéricamente proporcionados y no los desproporcionados HQtendiéndoselos no como realizados por o a
WUDYpVGHWpFQLFDVFRPSOHMDVVLQRPiVELHQ
en relación a su probable acción real sobre el
SDFLHQWH\VXVREUHYLGDHQHVWHFRQWH[WRHVWR
HVTXHJXDUGHQXQDUHODFLyQFRVWREHQH¿FLR
MXVWL¿FDEOH
2WUDV VLWXDFLRQHV VRQ PRWLYR GH DUGXRV GHEDWHV\GHFLVLRQHVGHVXPDWUDVFHQGHQFLDWDOHV
como los pedidos de suicidios asistidos en caso
GH SDWRORJtDV LQFXUDEOHV HQ SDFLHQWHV VHYHUDPHQWH GLVFDSDFLWDGRV SRU HMHPSOR FXDGULSOpMLFRVFRQDVLVWHQFLDUHVSLUDWRULD RHOFDVRGHORV
FRPDVYHJHWDWLYRV6yORGLUHPRVDFiTXHDOPDUJHQGHODVGLVTXLVLFLRQHVPRUDOHV\ROHJDOHVHVWRVFDVRVWHUPLQDQPXFKDVYHFHVUHVROYLpQGRVH
frente a un tribunal.
7DPELpQ GHEH DFODUDUVH TXH SDUD OD PD\RUtD GH ORV MXULVWDV ODV HXWDQDVLDV HXJHQpVLFDV
o las piadosas son rotundamente homicidios
9 - Gestión jurídico legal en organizaciones de atención de la salud / 257
FDOL¿FDGRV DO LJXDO TXH ORV FDVRV VLPLODUHV DO
GHO'U.HYRUNLDQ HOGRFWRUmuerte TXHHQOD
Argentina serían probablemente incluidos en tal
FDWHJRUtDRFRPRD\XGDDOVXLFLGD\VRQSXQLbles en nuestro ordenamiento jurídico.
Se entiende por ortotanasia el derecho a moULUGLJQDPHQWH3RUWDQWRVHLQFOX\HGHQWURGHO
PLVPR OD FDWHJRUtD GH HXWDQDVLD \ FRPSUHQGH
ODHXWDQDVLDVLQDFRUWDPLHQWRGHOFXUVRYLWDOGHO
PXULHQWHODVDFFLRQHVDFWLYDVTXHLPSOLTXHXQ
acortamiento de dicho período pero en las siWXDFLRQHVTXHVHUHVSHWHQPX\SXQWXDOPHQWHODV
condiciones enumeradas y en especial las situaciones de antidistanasia WpUPLQR TXH D FRQWLQXDFLyQVHH[SOLFDUi
(ODYDVDOODQWHHPSXMHGHODDSDUDWRORJtD\VX
LPSHUDWLYR LQWUtQVHFR GH XVR LPSHUDWLYR IRJRneado por sus fabricantes e impulsado asimismo por los médicos y los propios pacientes o
IDPLOLDUHV KD GHVHPERFDGR HQ FXDGURV SDWpWLcos y de absoluto menosprecio por la dignidad
GHOSDFLHQWHWHUPLQDODOLHQDGRQRSRUYLUWXGGH
su patología sino por una tecnologización de la
PXHUWHTXHORVFRQYLHUWHHQSDWpWLFRPXHVWUDULR
de la deshumanización de la ciencia.
Vale transcribir un párrafo de la mencionada
REUDGH1LxR ³DPSDUDUDOPRULEXQGR
QRVLJQL¿FDFXEULUORWHUDSpXWLFDPHQWHVDWXUDUOR
GHWpFQLFDPpGLFD&DVLSRUHOFRQWUDULRHQORV
SDtVHVGHVDUUROODGRVGHOPXQGRFRQWHPSRUiQHR
DKtWRV GH DGHODQWRV WHFQROyJLFRV HO SDUDGLJPD
del desamparo suele darse en esos pacientes criEDGRV SRU HO VXHUR LQWXEDGRV ÀDQTXHDGRV SRU
HO GHV¿EULODGRU FDUGtDFR \ HO SXOPyQ DUWL¿FLDO
SULYDGRVGHODSUHVHQFLDGHVXVVHUHVTXHULGRV
apagándose sordamente en el anonimato aséptiFRGHXQDFDPDGHODVDODGHWHUDSLDLQWHQVLYD(O
HPSOHRGHWDOHVWpFQLFDVDJUHVLYDVFXULRVDPHQWH
denominadas heroicas KD SUHFLSLWDGR OD WUDQVformación de los enfermos terminales en una
VXHUWHGHUHKHQHV\DFHQWHVVREUHFX\RVFXHUSRV
se celebra un ajetreado ritual de la profanación
HQKRPHQDMHDODFLHQFLD\WpFQLFDPpGLFD´
< HVWR GHVFULEH GH IRUPD PDJLVWUDO OR TXH
se entiende en la actualidad por diastanasia o
encarnizamiento terapéuticoTXHUHFRQRFHYDULDVUD]RQHV\YHUWLHQWHVHQWUHODVTXHORVMXULVWDV
TXHWUDWDQHOWHPDPHQFLRQDQHOWHPRULQIXQGDGRSRUFLHUWRGHOPpGLFRDVHUGHPDQGDGRSRU
SUHVXQWDPDODSUD[LVSRUQRKDEHUKHFKRWRGR
cuando en realidad dichos procedimientos –la
GLDVWDQDVLD±VRQORTXHFRQ¿JXUDQ
'HEHPRV DJUHJDU DGHPiV GH WDOHV PRWLYRV
TXHVLQGXGDLQFLGHQHQHVWDFRQGXFWDHOKHFKRGH
TXHODPD\RUtDGHORVPpGLFRVGHWHUDSLDLQWHQVLYD
–imbuidos de cierta omnipotencia y con complicaGRVDOJRULWPRVPDWHPiWLFRVVREUHDOWHUQDWLYDVGHO
PHGLRLQWHUQRFRQIyUPXODVDODTXHUHGXFHQWRGD
ODELRORJtDGHOVHUKXPDQRTXHQRSRUVHUFLHUWDV
GLVWDQGHVHUDEVROXWDVFDUHQWHVSRUORJHQHUDOGH
XQDYLVLyQHQODTXHSULPHHOFULWHULR\HOUHVSHWRSRUHOPXULHQWH±VHHPSHxD±SRUTXHDVtVHOR
enseñaron en toda su formación– en derrotar a la
PXHUWHel gran enemigoDOTXHDPDQHUDGHépico
combate deben imponerseVRSHQDGHVHQWLUVHvencidos(VGHFLUSODQWHDUWRGRHOWHPDGHODPXHUWH
LQVHUWRHQHVDQHJDWLYDGHDSUHFLDUODUHDOLGDG\VX
FXUVRLQH[RUDEOH DOTXHQRVUHIHULPRVDOFRPLHQ]R FRPRXQFRPEDWHHQTXHVHMXHJDHOSUHVWLJLR
GHODFLHQFLD\±SRUTXpQR±HOSURSLR
3RU ~OWLPR \ HPSDUHQWDGR FRQ HO WHPD GH
WRGRV ORV DFWRUHV TXH RSLQDQ HQ HVWD GHOLFDGD
FXHVWLyQXQDIUDVHGH0DQ]LQL: “... no tenemos
SRUTXpDFHSWDUGH¿QLFLRQHVGHELRHWLFLVWDVTXH
SRUQRWHQHUH[SHULHQFLDFOtQLFDQRSXHGHQUHFRQRFHUORVSHTXHxRVPDWLFHVHQWUHVLWXDFLRQHVTXH
pueden dar lugar a tomas de posición muy difeUHQWHV´ SDODEUDVTXHGHEHPRVDFHSWDUFRPRXQ
GHVDItRSDUDUHWRPDU±ORVPpGLFRV±HOSDSHOTXH
debemos en el debate de estas candentes cuestioQHV$ULHVJRGHSHUPLWLUTXHVHDQRWURVORVTXHODV
WRPHQSRUQRVRWURV3DUD¿QDOL]DUHVWHPX\EUHYH
SDQWDOOD]RVREUHHOWHPDODUJR\FRPSOHMRVLORV
KD\WUDQVFULELUHPRVORH[SUHVDGRHQXQDUWtFXOR
GH&)HUQiQGH] HQHOTXHFRQVLGHUDTXH
“el derecho a morir es una garantía implícita en el
WH[WRFRQVWLWXFLRQDO´6REUHHVWH~OWLPRSXQWR\
en la obra del Dr. LorenzettiHODXWRUVHxDODTXH
³ODpWLFDPpGLFDYDSHU¿OiQGRVHKDFLDODDGPLVLyQGHDOJXQDVSDXWDVIDYRUDEOHVDODHXWDQDVLD
SDVLYDEDVDGRVHQORVLJXLHQWH
‡ 6L HO SDFLHQWH H[SUHVD OLEUHPHQWH TXH QR
TXLHUHHPSH]DURGHWHQHUXQWUDWDPLHQWRHO
médico debe hacerle caso.
‡'HEHHPSH]DUVHXQWUDWDPLHQWRSDUDDOLYLDUHO
GRORUGHXQHQIHUPRDXQFXDQGRHVWRDFHOHUH
su muerte.
0DQ]LQL-%LRpWLFD3DOLDWLYD/D3ODWD(GLWRULDO4XLUyQ
/RUHQ]HWWL5/Responsabilidad civil de los Médicos7%XHQRV$LUHV5XELQ]DO&XO]RQL
258 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
‡'HKHFKRHVPX\IUHFXHQWHTXHHOPpGLFRVXPLQLVWUHWUDWDPLHQWRV\IiUPDFRVTXHDOLYLDQ
HO GRORU SHUR TXH WLHQHQ XQ HIHFWR GDxRVR
LPSRUWDQWH\TXHSXHGHQDFRUWDUODYLGDSRU
ejemplo en los casos de cáncer.
‡(OSUREOHPDFHQWUDOQRHVHQWUHODYLGD\OD
PXHUWH(VWHFRQÀLFWRVXUJHFODUDPHQWHHQOD
HXWDQDVLD DFWLYD \ HO VXLFLGLR TXH HVFDSD D
QXHVWURHQIRTXHDFWXDO
‡(OGHEDWHGHEHJLUDUVREUHODFDOLGDGGHYLGD
Decisión de mantener o finalizar un
tratamiento en pacientes con enfermedades
neurológicas irreversibles.
Implicancias legales
(QDOJXQRVFDVRVFRPRORVHVWDGLRV¿QDOHVGH
ODHVFOHURVLVODWHUDODPLRWUy¿FDFRQFRPSURPLVR
UHVSLUDWRULRRHQRWURVQRWHUPLQDOHVSHURFRQ
VHYHUDDIHFWDFLyQQHXUROyJLFDFRPRODVOHVLRQHV
HVSLQDOHV FHUYLFDOHV HO QHXUyORJR VH HQIUHQWD
con la difícil situación de un paciente en pleno
XVRGHVXVIDFXOWDGHVPHQWDOHVTXHVROLFLWDVHOH
permita morir.
El caso más común es el del paciente enferPRGHHVFOHURVLVODWHUDODPLRWUy¿FDXQDHQIHUPHGDG QHXUROyJLFD LUUHYHUVLEOH VHFXQGDULD D OD
afectación de la neurona motora del asta anteULRUPHGXODU\ODVYtDVFyUWLFRHVSLQDOHVTXHWUDH
DSDUHMDGDGHELOLGDGPXVFXODUSURJUHVLYDVLHQGR
ODV FRPSOLFDFLRQHV UHVSLUDWRULDV SDUiOLVLV UHVSLUDWRULD ODSULQFLSDOFDXVDGHPXHUWHGHHVWRV
enfermos.
En los estadios terminales surge entonces el
FXHVWLRQDPLHQWR GH OD YHQWLODFLyQ DVLVWLGD \ OD
SRVLELOLGDG GH TXH HVWH SDFLHQWH GHSHQGLHQWH
GHXQUHVSLUDGRUSRUHOUHVWRGHVXYLGDVROLFLWH
VXH[WXEDFLyQ(OHMHPSORHVH[WHQVLYRDORVSDcientes con enfermedades neuromusculares proJUHVLYDVFRQFRQVHUYDFLyQGHOLQWHOHFWR
(OFRQÀLFWRVXUJHHQWRQFHVHQWUHHOGHUHFKR
del paciente a elegir –y en este tipo de casos– el
momento de su muerte y la obligación del méGLFRGHFRQVHUYDUODYLGDHQXQSDFLHQWHVLQQLQJ~QSURQyVWLFRGHPHMRUtD6HSODQWHDQDTXtFRQÀLFWRVpWLFRVSRUHMHPSORFRQODRSLQLyQGHOD
,JOHVLDFDWyOLFDVREUHQRMXVWL¿FDUODH[WXEDFLyQ
de un paciente aun a sabiendas de su muerte inPLQHQWH2WURVFUHHQVLQHPEDUJRTXHHQHVWRV
FDVRVpVWDHVODRSFLyQpWLFDPHQWHYiOLGDFXDQdo el paciente en correcto uso de sus facultades
PHQWDOHVDVtORGHFLGH(QHVWHFDVRORVPpGLFRV
tendrían la obligación de seguir los deseos racio-
QDOHVGHORVSDFLHQWHVFRPSHWHQWHVDYDODGRVHQ
OD GRFWULQD GHO FRQVHQWLPLHQWR YiOLGR (O WHPD
HQVtDFHUFDGHODVGLYHUVDVRSFLRQHVHVWiWUDWDGRDPSOLDPHQWHHQHOtWHPGHHXWDQDVLDDVSHFWR
VLPLODUDODGHFLVLyQGHXWLOL]DUODPRU¿QD\ODV
EHQ]RGLDFHSLQDVHQODH[WXEDFLyQSDUDDOLYLDUHO
SURFHVRGHODPXHUWHSRUDV¿[LD(QWRGRFDVR
la intención es en pos de un perjuicio menor al
TXH UHVXOWDUtD GHO SURFHVR PLVPR GH OD PXHUWH
natural.
2WURFDVRHVHOGHDTXHOORVSDFLHQWHVMyYHQHV
cuadripléjicos por lesiones medulares altas no
WHUPLQDOHV TXH VH KDOODQ FRQGHQDGRV D GHSHQGHUGHXQYHQWLODGRUHOUHVWRGHVXYLGD(QHVWRV
SDFLHQWHV HVWDEOHV QHXUROyJLFDPHQWH HV GLItFLO
distinguir entre su derecho a rechazar el trataPLHQWR\ODVROLFLWXGSDUDOHODDORDQWHULRUGHOD
GHVFRQH[LyQGHODPiTXLQD
&RPR VH KD GLFKR HQ HVWD FLUFXQVWDQFLD HO
médico no tiene la obligación ética de asistir al
SDFLHQWHHQXQDFWRGHHXWDQDVLDDFWLYD %HUQDW
JL et al.American Academy of Neurology
Ethic and HumanitiesAmerican Medical
Association Council 'DGRTXHODGHFLVLyQGH¿QDOL]DURQRUHDOL]DU XQ GHWHUPLQDGR WUDWDPLHQWR WUDH DSDUHMDGD
HQIRUPDHUUyQHDODVHQVDFLyQGHDEDQGRQRGHO
SDFLHQWHHVQHFHVDULRDFODUDUTXHHOPpGLFRGHEH
FXLGDUHQIRUPDSHUPDQHQWHGHVXSDFLHQWHLPplicando este concepto la obligación de decidir
HQ FDGD PRPHQWR HO JUDGR GH DJUHVLYLGDG GHO
WUDWDPLHQWR SRU UHDOL]DU VX GXUDFLyQ \ ORV EHQH¿FLRVSUREDEOHV7RGDVHVWDVLQVWDQFLDVGHEHQ
HVWDUDVXYH]GHELGDPHQWHMXVWL¿FDGDV\DVHD
SDUD LQLFLDU OD WHUDSpXWLFD R SDUD ¿QDOL]DUOD HQ
FDVRGHTXHQRFXPSOLHUDGHIRUPDVDWLVIDFWRULD
FRQODH[SHFWDWLYDSUHYLVWD
El paciente competente puede aceptar o reFKD]DUODWHUDSpXWLFDTXHHOPpGLFROHKD\DSURSXHVWR\TXHDVXFULWHULRVHDODPHMRUSDUDHVH
FDVRHQSDUWLFXODUSRULQWHUPHGLRGHOFRQVHQWLmiento o rechazo informado. Éste tiene su base
HQODUHJODPRUDOGHQRSULYDUGHOLEHUWDG\SRUOR
WDQWRWRPDYDORUQRVyORGHVGHHOSXQWRGHYLVWD
legal sino también del ético.
(QORVSDFLHQWHVQRFRPSHWHQWHVHVWDGHFLsión debiera ser tomada a priori por medio de
XQGRFXPHQWRH[WHQGLGRHQFDVRGHWDOHYHQWXDOLGDG(Q((88H[LVWHXQGRFXPHQWRGHQRPLQDGR7HVWDPHQWRGH9LGDFRQYDORUOHJDOSDUD
WDO HIHFWR TXH GD GLUHFWLYDV SDUD SURWHJHU ORV
GHUHFKRV GH XQ IXWXUR SDFLHQWH LQFRPSHWHQWH
a elegir rechazar las medidas de mantenimien-
9 - Gestión jurídico legal en organizaciones de atención de la salud / 259
WRHQHOFDVRTXHVHKDOOHHQHVWDGRWHUPLQDOR
VLQH[SHFWDWLYDVGHUHFXSHUDFLyQUD]RQDEOH6LQ
HPEDUJRVXXVRKDVLGRHQJHQHUDOUHHPSOD]DGR
SRURWURGRFXPHQWRPiVFRPSOHWRHQHOTXHVH
designa a un apoderado en el cuidado de la salud
y se lo autoriza a tomar decisiones médicas en
caso de incompetencia por parte del paciente. El
DSRGHUDGRGHEHFRQRFHUSUHYLDPHQWHORVGHVHRV
\YDORUHVGHOSDFLHQWHFRQHO¿QGHHOHJLUDTXHOOR
más acorde a sus preferencias..
(O SDVR VLJXLHQWH HQ FDVR GH IDOWDU HVWDV
GLUHFWLYDV HV OD WRPD GH GHFLVLyQ GHO SDULHQWH
más cercano en línea directa; cuando al médico
OHVXJLHUDXQFRQÀLFWRGHLQWHUHVHVHQFXELHUWRV
GHEHUiSHGLUODLQWHUYHQFLyQGHXQ-XH]SDUDOD
toma de decisión adecuada.
(QDTXHOODHYHQWXDOLGDGGHQRFRQWDUFRQQDGLHTXHDFW~HFRPRVXEURJDQWHHOPpGLFRGHEH
actuar según la doctrina del mejor interés para el
SDFLHQWHWHQLHQGRHQFRQVLGHUDFLyQHODOLYLRGHO
VXIULPLHQWRODFDOLGDGGHYLGDGHOSDFLHQWHFRQ
RVLQWUDWDPLHQWR\HOHQWRUQRVRFLRHFRQyPLFR
pero siempre teniendo como meta el bienestar y
el respeto al ser humano.
(QODDFWXDOLGDGODWHQGHQFLDHVTXHORVPpdicos fomenten en sus pacientes la opción por alJXQDGHHVWDVYDULDQWHVHVSHFL¿FDQGRTXpWLSRGH
WUDWDPLHQWRGHVHDUtDQ\FXiOHVQRSHURDOFRPLHQzo de una enfermedad considerada como progreVLYD LQYDOLGDQWH \ GH¿QLWLYD HV GHFLU FXDQGR
WRGDYtDVHORVSXHGDFRQVLGHUDUFRPSHWHQWHVFRQ
FDSDFLGDGGHGHFLGLUDQWHODSURJUHVLyQLUUHYHUVLble de la enfermedad. Si bien ello se compadece
con la autonomía y la necesidad de ser sinceros
FRQHOSDFLHQWHHOMXLFLRVRFULWHULRGHOPpGLFROH
GLUi HQ FDGD FDVR HQ SDUWLFXODU FXiQWR \ KDVWD
GyQGH GHEHUi LQIRUPDU \D TXH WDPELpQ HV XQD
YHUGDGPXFKDVYHFHVYLVWDODGHOSDFLHQWHTXHQR
TXLHUH±\H[SOtFLWDPHQWHVHORKDFHVDEHUDOPpGLco– conocer el pronóstico de la enfermedad. Con
ORTXHSULPDUtDHQHVWHFDVRHOGHUHFKRDODEHQH¿FHQFLDHVGHFLUUHVSHWDUHOGHUHFKRGHOSDFLHQWH
DQRVDEHUSRUORTXHWDOKHFKRUHSUHVHQWDUtDGH
sufrimiento moral o psicológico. Debe recordarVHTXHPXFKDVGHODVRSFLRQHVGHQWURGHODpWLFD
VHPXHYHQDYHFHVHQWUHGHUHFKRVDSULPHUDYLVWD
incompatibles o incongruentes.
5HVSHFWRGHOWHPDTXHSXQWXDOPHQWHQRVDWDxHODMXVWL¿FDFLyQSDUDFRQWLQXDUXQWUDWDPLHQWR
GHEHSURFHGHUGHODPLVPDTXHPRWLYyVLLQLFLR
(VWRHVVHFRPLHQ]DXQWUDWDPLHQWREDVDGRVRODPHQWHHQVXSRWHQFLDOEHQH¿FLR\HOFRQVHQWLPLHQWRGHOSDFLHQWH6LHOEHQH¿FLRGHOPRPHQWR
HVPXFKRPHQRUDOSUHYLVWRRORVULHVJRVPXFKR
PD\RUHVTXHORDQWLFLSDGR\RHOSDFLHQWHORUHFKD]DHOWUDWDPLHQWRGHEHGLVFRQWLQXDUVH
(VLPSRUWDQWHGHVWDFDUTXHGHVGHHOSXQWRGH
YLVWDpWLFRQRH[LVWHGLVWLQFLyQHQWUHVXVSHQGHU
XQWUDWDPLHQWRGHSHQGLHQGRGHTXHVHDSURSRUFLRQDGRRGHVSURSRUFLRQDGRGDGRTXHODFXDOLdad del tratamiento GHSHQGHGHOEHQH¿FLRQHWR
TXHOHRWRUJXHDFDGDSDFLHQWHHQSDUWLFXODU\
QRGHODWHFQRORJtDXWLOL]DGD. El mal uso de esWRVWpUPLQRVOOHYDDODFRQIXVLyQHQHOPRPHQWR
de decidir el tratamiento a seguir o al presentarle las opciones terapéuticas al paciente o a su
DSRGHUDGR(QRWUDVSDODEUDVHOWUDWDPLHQWRQR
debiera ser desproporcionado en relación a los
EHQH¿FLRVWHyULFRVTXHSXHGDDSRUWDU
En relación con la eutanasia se plantean otros
LQWHUURJDQWHV TXH GHEHQ UHVSRQGHUVH FRQ ORV
SULQFLSLRV DQWHGLFKRV 8Q SDFLHQWH FRPSHWHQWH
tiene derecho a rechazar un determinado trataPLHQWRDXQTXHHVHUHFKD]RUHVXOWHHQVXPXHUWH
6X UHFKD]R UDFLRQDO HV YiOLGR SDUD GHWHUPLQDU
TXpWUDWDPLHQWRGHEHKDFpUVHOH\FXiOQR$VX
YH]HOSDFLHQWHSXHGHFRQVHQWLUXQWUDWDPLHQWR
TXH LPSOLTXH FRPR HIHFWR VHFXQGDULR OD DFHleración de su muerte. Es el caso del uso de la
PRU¿QDHQSDFLHQWHVWHUPLQDOHVFRQFXDGURVGRORURVRV6XXVRHVPRUDOPHQWHDFHSWDEOHDXQTXH
GLVFXWLGR GDGR TXH VH WUDWD GH XQ SDFLHQWH VLQ
SURQyVWLFR IDYRUDEOH FRQ GRORUHV LQFRHUFLEOHV
en donde consiente su uso conociendo sus riesJRV\VHXWLOL]DHQSRVGHHYLWDUXQVXIULPLHQWR\
no con intención de matar.
2WURHVHOFDVRGHOSDFLHQWHTXHVROLFLWDXQD
DFWLWXGDFWLYDGHSDUWHGHOPpGLFRD¿QGHDFHOHrar su deceso por medio de la inyección de una
GURJDOHWDO HXWDQDVLDDFWLYDYROXQWDULD $SHVDU GH TXH DOJXQRV FRQVLGHUDQ TXH VH WUDWD GH
XQDFWRGHDOWUXLVPRGHSDUWHGHOPpGLFRHQOD
DFWXDOLGDGH[LVWHQGLYHUVRVPHGLRVSDUDHOFRQtrol del dolor con el propósito de atenuar el suIULPLHQWRVLQODREOLJDFLyQGHTXHHOPpGLFRHQ
SRVGHUHVSHWDUORVGHVHRVGHOSDFLHQWHGHEDUHDOL]DUXQDFWRGHHXWDQDVLDDFWLYD/RVPpGLFRVQR
están moralmente obligados a satisfacer todos
1HOVRQ:$%HUQDW-/
1HOVRQ:$%HUQDW-/1LxR/)/XQD)6DOOHV$
260 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
los deseos del paciente si éstos incluyen actos
TXH FRQVLGHUDQ HUUyQHRV FRPR HV HO GH DSOLFDU
XQDLQ\HFFLyQOHWDOTXHSURYRTXHODPXHUWHFRQ
HODJUHJDGRGHTXHHQOD$UJHQWLQDHVXQGHOLWR
WLSL¿FDGRFRPRKRPLFLGLR(ver Eutanasia).
Estado vegetativo persistente
(OWpUPLQRHVWDGRYHJHWDWLYRSHUVLVWHQWHIXHSURSXHVWRSRU-HQQHW\3OXPHQSDUDGHVFULbir un tipo de paciente con falta de conciencia
GHVtPLVPRSHURFRQFLFORVGHYLJLOLDVXHxR\
UHDFFLyQGHOGHVSHUWDUFRQVHUYDGD
Según la Academia Americana de Neurología
HO HVWDGR YHJHWDWLYR SHUVLVWHQWH VH FDUDFWHUL]D
DGHPiVSRUODDXVHQFLDGHHYLGHQFLDFRQGXFWXDO
o metabólica cerebral de algún tipo de proceso
FRJQLWLYRVXPDGRDODLPSRVLELOLGDGGHUHVSRQGHUDORVHVWtPXORVH[WHUQRV
/DGH¿QLFLyQGHHVWDGRYHJHWDWLYRSHUVLVWHQWHUHTXLHUHGHFLHUWRVFULWHULRVTXHSHUPLWHQDO
neurólogo diagnosticar este estado con un alto
JUDGRGHFHUWH]D\TXHGHEHQH[WHQGHUVHSRUXQ
lapso mayor a un mes. Esto incluye:
‡ (O SDFLHQWH VH KDOOD SRVWUDGR FRQ ORV RMRV
abiertos espontáneamente o ante estímulos.
‡ ([LVWHQ PRYLPLHQWRV RFXODUHV HVSRQWiQHRV
SHURQRVHHYLGHQFLDVHJXLPLHQWRYLVXDOVRVtenido.
‡1RH[LVWHFDSDFLGDGGHUHVSXHVWDDyUGHQHV
‡ 1R KD\ HYLGHQFLDV GH UHVSXHVWD FRJQLWLYD D
ningún tipo de estímulo.
‡1RUHDOL]DDFWRVYROXQWDULRVRFRQGXFWXDOHV
‡1RH[LVWHOHQJXDMHUHFRQRFLEOHKDOOiQGRVHHQ
general en estado de mutismo.
‡/RVUHÀHMRVWURQFDOHV\ORVFLFORVGHYLJLOLD
sueño se hallan intactos.
‡ ([LVWH UHVSLUDFLyQ HVSRQWiQHD SHUR QR VRQ
posibles la masticación ni la deglución.
‡+D\LQFRQWLQHQFLDXULQDULD\IHFDO
Estos pacientes presentan una característica
UHDFFLyQGHOGHVSHUWDUSHURVLQFRQFLHQFLDGHVt
PLVPRV$SHVDUGHVXDSDULHQFLDQRH[LVWHFRQtenido de la conciencia; se encuentran en un esWDGRSHUPDQHQWHQRFRJQLWLYRTXHFRQOOHYDXQD
incapacidad para sentir física y emocionalmente
\ SDUD H[SHULPHQWDU VXIULPLHQWR GH FXDOTXLHU
WLSR(VWRVHKDOODDYDODGRSRUGLYHUVRVHVWXGLRV
post mortem TXH GHPXHVWUDQ XQ GDxR FRUWLFDO
WDQGLIXVR\SURIXQGRTXHUHVXOWDLQFRPSDWLEOH
FRQODFRQFLHQFLD\ODVIXQFLRQHVFRJQLWLYDVGH
WRGRVHUKXPDQRTXHVRQXQSUHUUHTXLVLWRSDUD
VHU FDSDFHV GH H[SHULPHQWDU VXIULPLHQWR 3RU
RWUD SDUWH ORV HVWXGLRV QHXURIXQFLRQDOHV FRPR
la tomografía por emisión de positrones muesWUDQXQDUHGXFFLyQHQORVQLYHOHVGHFRQVXPRGH
JOXFRVDDQLYHOFHUHEUDOVLPLODUDOGHORVSDFLHQtes en estado de coma profundo.
La anatomía patológica en los casos debidos
DLQMXULDLVTXpPLFRKLSy[LFDGLIXVDSRVWHULRUD
SDURFDUGLRUUHVSLUDWRULRPXHVWUDGDxRQHXURQDO
de la corteza cerebral en forma difusa con resSHFWRDODVHVWUXFWXUDVGHOWURQFRHQFHIiOLFRTXH
se hallan respetadas.
&XDQGR QRV UHIHULPRV D HVWDGR YHJHWDWLYR
SHUVLVWHQWHTXHUHPRVVLJQL¿FDUTXHGLFKRHVWDdo se prolonga más allá de un mes. Los pacientes
con las características antes enunciadas pueden
HYROXFLRQDUDODUHFXSHUDFLyQGHODFRQFLHQFLDR
DVXGHWHULRURFRQGLYHUVDVFRPSOLFDFLRQHVTXH
WHUPLQDQFRQHOIDOOHFLPLHQWRGHOSDFLHQWH\HVH
ODSVRVHUWUDQVLWRULRRPD\RUDXQPHVFRQVLGHrándolo entonces como persistente. Este último
término no hace por sí mismo alusión al pronósWLFRGHOSDFLHQWHTXHGHSHQGHUiSULQFLSDOPHQWH
de su patogenia.
/RVFXLGDGRVUHTXHULGRVSRUHVWRVSDFLHQWHV
VRQDVXYH]VLPLODUHVDORVGHORVSDFLHQWHVFRmatosos e incluyen la alimentación por gastrosWRPtDODWUDTXHRVWRPtDFXLGDGRGHODSLHO\GH
ODYHMLJDHQIRUPDFRWLGLDQDDVtFRPRHMHUFLFLRV
GHPRYLOL]DFLyQGLDULRV&RQQXWULFLyQDGHFXDGD
\ ORV FXLGDGRV GH HQIHUPHUtD DQWHGLFKRV HVWRV
SDFLHQWHVSXHGHQPDQWHQHUVHYLYRVSRUPXFKRV
DxRV(OFDVRPiVODUJRGHVREUHYLGDOOHJyDORV
DxRVSRUORTXHFRPRGLMLPRVFRQDQWHULRULGDGXQSDFLHQWHHQHVWDGRYHJHWDWLYRSHUVLVWHQWH
no puede considerarse terminal según la acepción habitual del término.
El pronóstico de estos pacientes en relación
a la recuperación del estado de conciencia deSHQGHHQJUDQPHGLGDGHODFDXVDTXHSURYRFy
VXSUREOHPD/RVSDFLHQWHVHQHVWDGRYHJHWDWLYR
SHUVLVWHQWH GHELGR D GDxR QHXURQDO SRU LQMXULD
KLSy[LFRLVTXpPLFD VHFXQGDULD D SDUR FDUGLRUUHVSLUDWRULRVRQDTXHOORVGHSHRUSURQyVWLFR6L
HOSDFLHQWHSHUPDQHFHHQHVWDGRYHJHWDWLYRSRU
PiVGHXQPHVVLQHYLGHQFLDGHIDFWRUHVHQFH-
3OXP)3RVQHU-%
%HUQDW-/7D\ORU50&KLOGV1/0HUFHU:1
9 - Gestión jurídico legal en organizaciones de atención de la salud / 261
IDORSiWLFRV GH RULJHQ PHWDEyOLFR DG\XYDQWH OD
SRVLELOLGDGGHUHFXSHUDFLyQHVUHPRWDFRQLQGHSHQGHQFLDGHODDJUHVLYLGDGGHOWUDWDPLHQWR
Los casos secundarios a traumatismo de cráneo tienen mejores posibilidades de recuperaFLyQQRDVtORVGHELGRVDDFFLGHQWHVFHUHEURYDVFXODUHV HQ ORV TXH HO SURQyVWLFR HV LQWHUPHGLR
entre el traumatismo de cráneo y los cuadros
KLSy[LFRLVTXpPLFRV
&XDQGRHOHVWDGRYHJHWDWLYRHVODHYROXFLyQ
GHXQFXDGURGHJHQHUDWLYRGHPHQFLDOHOSURQyVtico es nulo.
/D GHFLVLyQ GHO JUDGR GH DJUHVLYLGDG HQ HO
tratamiento de estos pacientes debe ser por ende
la resultante de un diagnóstico adecuado y del
FRQRFLPLHQWRGHVXSURQyVWLFR(VHOFDVRSRU
HMHPSOR GH XQ SDFLHQWH MRYHQ HQ HVWDGR YHJHWDWLYRGHVHLVVHPDQDVGHHYROXFLyQVHFXQGDULR
DXQWUDXPDWLVPRGHFUiQHRFHUUDGRTXHQRVH
halla complicado por hipertensión endocraneana
RKHPRUUDJLDHQHOTXHQRVHSODQWHDOD¿QDOL]DFLyQGHOWUDWDPLHQWRGDGRTXHGLFKRSDFLHQWH
tiene posibilidades de recuperarse con una buena función neurológica. No resulta así cuando
HOFXDGURVHGHEHDXQSDURFDUGLRUUHVSLUDWRULR
dado el pobre pronóstico con alto grado de cerWH]DTXHWLHQHQHVWRVSDFLHQWHV(QHVWRVFDVRV
ODHOHFFLyQGHOJUDGRGHDJUHVLYLGDGHQHOWUDWDPLHQWRVHEDVDHQODHYDOXDFLyQQHXUROyJLFDIUHFXHQWH6LGHQWURGHODVSULPHUDVKRUDVHOSDFLHQWHQRSUHVHQWDFRQVHUYDGRVORVUHÀHMRVTXH
LQYROXFUDQHOWURQFRFHUHEUDO UHÀHMRVSXSLODUHV
FRUQHDQRV\yFXORYHVWLEXODUHV HOSURQyVWLFRHV
SREUH6LSRUHOFRQWUDULRVHKDOODQSUHVHQWHV
HQWRQFHVHOSURQyVWLFRHVWDUiGDGRSRUHOQLYHO
de conciencia.
(Q DTXHOORV FDVRV HQ ORV TXH HO SURQyVWLFR
HV GXGRVR UHVXOWD SUHPDWXUD OD FRQVLGHUDFLyQ
GHWHUPLQDUHOWUDWDPLHQWRPiVD~QVLFRQVLGHUDPRVTXHHVIUHFXHQWHTXHDGHPiVGHODLQMXULD KLSy[LFDLVTXpPLFD HVWRV SDFLHQWHV WHQJDQ
asociada una encefalopatía metabólica potenFLDOPHQWHUHYHUVLEOHTXHGHEHVHUWUDWDGD\TXH
SXHGH LPSOLFDU YDULDV VHPDQDV GH WUDWDPLHQWR
American Academy of Neurology (QJHQHUDOFXDQWRPiVVHSURORQJDHOHVWDGR
YHJHWDWLYRPHQRUHVODSRVLELOLGDGGHUHFXSHUDUOD
FRQFLHQFLDPiVD~QFXDQGRHVHWLHPSRH[FHGHHO
DxRHQFX\RFDVRHOSURQyVWLFRHVPX\SREUHFRQ
LQGHSHQGHQFLDGHODFDXVDTXHORPRWLYy
%HUQDW-/7D\ORU50
(OQLYHOGHFRPSOHMLGDGHQHOWUDWDPLHQWRGHSHQGHUi DGHPiV HQ WRGRV ORV FDVRV GHO GHVHR
GHOSDFLHQWHSUHYLDPHQWHH[SUHVDGRRGHODVDOWHUQDWLYDVH[SOLFDGDVFRQDQWHULRULGDG
&UDQIRUG LGHQWL¿Fy FXDWUR QLYHOHV GH WUDWDmiento en estos pacientes:
WHFQROyJLFRTXHLQFOX\HUHVSLUDGRUHVPDUFDSDVR GLiOLVLV \ PiTXLQDV GH by-pass cardiopulmonar
PHGLFDPHQWRVR
GHKLGUDWDFLyQ\QXWULFLyQ
GHPDQWHQLPLHQWRTXHLQFOX\HODVPHGLGDV
WHQGLHQWHV D EULQGDU FRQIRUW KLJLHQH \ GLJQLGDG TXH VH GHEHQ PDQWHQHU HQ WRGRV ORV
casos.
'DGRTXHODFRQVLJQDGHQRUHVXFLWDUDXQSDciente sólo implica no acceder a parte del primer
QLYHOFRPRGHV¿EULODGRUHVRUHVSLUDGRUHVHQWUH
RWURVODHOHFFLyQGHOJUDGRGHFRPSOHMLGDGDVHguir debe estar perfectamente estipulada.
En la decisión de suspender la hidratación y
ODQXWULFLyQGHEHWHQHUVHHQFXHQWDTXHPXFKDV
YHFHV HVWH ~QLFR WUDWDPLHQWR HV VX¿FLHQWH SDUD
PDQWHQHUYLYRVDORVSDFLHQWHVPpGLFDPHQWHHVWDEOHV\TXHQRHVWiH[HQWRGHPHGLGDVLQYDVLYDV
GDGRTXHSRUORJHQHUDOUHTXLHUHODUHDOL]DFLyQ
de una gastrostomía. Si el mantenimiento de esWDVPHGLGDVQRDSRUWDQLQJ~QEHQH¿FLRDXQSDFLHQWHHQHVWDGRYHJHWDWLYRVLQSURQyVWLFRSUREDEOH\SRUHOSULQFLSLRGHDXWRQRPtDGHFDGD
LQGLYLGXRGHEHUHVSHWDUVHVXUHFKD]RH[SUHVDGR
DSULRULSRUGLUHFWLYDVSURSLDVGHOSDFLHQWHRGH
VX VXEURJDQWH 3RU HO FRQWUDULR HO QLYHO FXDWUR
GHEH PDQWHQHUVH HQ WRGRV ORV FDVRV VLQ H[FHSción debiendo primar las medidas tendientes al
FRQIRUW GHO SDFLHQWH R D HYLWDU HO GLVFRQIRUW HQ
XQSDFLHQWHTXHQRWLHQHSRVLELOLGDGHVUDFLRQDOHVGHHYROXFLRQDUGHPRGRIDYRUDEOH
'DGDODGL¿FXOWDGGHEDVDUVHHQIDFWRUHVSUHGLFWRUHV D ¿Q GH GHFLGLU XQ GHWHUPLQDGR WUDWDPLHQWRHQJHQHUDOVHDFRQVHMD VHJ~QHOestándar de duda razonable PDQWHQHUODVPHGLGDVGH
VRVWpQDOUHGHGRUGHWUHVPHVHVSDUDDTXHOORVSDcientes con causas no traumáticas y hasta un año
HQORVGHHWLRORJtDWUDXPiWLFD(VWR~OWLPRSRU
VXSXHVWRGHSHQGHUiGHTXHKD\DRQRFRQVHQWLPLHQWRSUHYLRGHOSDFLHQWHRGHVXDSRGHUDGR
SDUD WDOHV PHGLGDV TXH WHQGUi PD\RU R PHQRU
YDORUVHJ~QORVRUGHQDPLHQWRVMXUtGLFRVGHOSDtV
HQTXHVHHQFXHQWUH
262 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
'HEHPRV FRQVLGHUDU TXH OD VXVSHQVLyQ GH
ODVPHGLGDVWHQGLHQWHVDSURORQJDUODYLGDWUDH
DSDUHMDGD FRPR FRQVHFXHQFLD GH OD HYROXFLyQ
QDWXUDOGHOFXDGURODPXHUWH3RUHQGHODVXVpensión de dichas medidas implica permitir la
HYROXFLyQHVSRQWiQHDGHDTXHOORTXHLQWHUUXPpimos al resucitar a un paciente. Los médicos
somos directamente responsables entonces del
HVWDGR SRVWHULRU GHO LQGLYLGXR HV SRU HVR TXH
WHQHPRVODREOLJDFLyQPRUDOHQWRGRPRPHQWR
GHFXPSOLUFRQORVGHVHRVGHODSHUVRQDLQYROXcrada o su subrogante.
(Q UHIHUHQFLD DO WHPD TXH QRV DWDxH HV QHFHVDULR D~Q DFODUDU DOJXQRV SXQWRV TXH KDFHQ
DODVRFLHGDGFRPRXQWRGR\TXHLPSOLFDQORV
aspectos económicos del tratamiento de estos
pacientes. En muchos casos el principio ético de
justicia en un caso en particular y su respectiYRJDVWRGHPDQWHQLPLHQWRHVGLItFLOGHFRPSDWLELOL]DU FRQ HO GH OD VDOXG S~EOLFD HQ JHQHUDO
QRH[LVWLHQGRFRQVHQVRWRGDYtDUHVSHFWRGHORV
gastos en salud y su duración para pacientes en
HVWDGRYHJHWDWLYRSHUVLVWHQWH
(QXQDHQFXHVWDUHDOL]DGDDQLYHOQDFLRQDOHQ
ORV((88UHVSHFWRGHODDFWLWXGGHORVPpGLFRV
DQWH XQ SDFLHQWH FRQ HVWDGR YHJHWDWLYR SHUVLVWHQWHHOFRQVLGHUDEDpWLFRGLVFRQWLQXDUHO
QLYHO GH WUDWDPLHQWR HO HO QLYHO \ HO
HOQLYHOSDUDWRGRVDTXHOORVSDFLHQWHVTXH
KD\DQVREUHSDVDGRHODxRGHHYROXFLyQ
(O SULQFLSDO FRQÀLFWR VXUJH FXDQGR QRV HQfrentamos a casos con daño encefálico menos
VHYHUR QR YHJHWDWLYRV FRPR HV HO FDVR GH ODV
GHPHQFLDVGHJHQHUDWLYDVHLUUHYHUVLEOHV
(VRSRUWXQRHOPRPHQWRSDUDGHMDUHQFODUR
GDGRTXHDFiHQWUDUtDQHQMXHJRORVFULWHULRVGH
DVLJQDFLyQUDFLRQDOGHUHFXUVRVTXHQLHOPpGLFR
auditor ni médico alguno podrá pasar por sobre
ODDXWRULGDGGHORVPpGLFRVWUDWDQWHV\RGHORV
IDPLOLDUHV GHO SDFLHQWH WHUPLQDO R VHYHUDPHQWH
GDxDGR HQ OR QHXUROyJLFR GHFLGLHQGR ¿QDOL]DU
el tratamiento o sacar al paciente de la sala de
FXLGDGRVLQWHQVLYRV1RFDEHGXGDGHTXHHVWDV
decisiones hacen profundamente a la ética de
la relación o del binomio médico-paciente y tal
LQJHUHQFLDQRWLHQHVXVWHQWRQLDYDOpWLFRMXUtGLFRRDGPLQLVWUDWLYRDXQTXHHOPpGLFRDXGLWRU
considere –y puede asistirle la mayor de las ra5DVNLQG0
6DFKHV*$&DVVHO&.
(LVGRUIHU&2OVHQ(-
]RQHV±TXHQRHVMXVWL¿FDEOHGHVGHOD0HGLFLQD
HQFDVRVFRPRORVDUULEDGHVFULWRVFRQWLQXDUR
PDQWHQHUXQDWHUDSLDGHPDQWHQLPLHQWRDUWL¿FLDO
TXHSXHGHVHUWLOGDGDGHencarnizamiento terapéutico(OPpGLFRDXGLWRUSRGUiFRQYHUVDUFRQ
HO WUDWDQWH LQWHUFDPELDQGR LGHDV R FULWHULRV R
H[SRQLHQGRVXUD]RQDPLHQWR3HURHOUHVSRQVDEOHPpGLFRpWLFR\OHJDOGHOSDFLHQWHWHUPLQDOHV
HOWUDWDQWH0XFKRPHQRV\FRQVLGHUDQGRHOFULWHULRDFWXDOGHODMXULVSUXGHQFLDSUHSRQGHUDQWH
SRGUiGHFLGLUVHXQDPHGLGDDGPLQLVWUDWLYDTXH
indirectamente pueda afectar el tratamiento en
FXUVR v.g VXVSHQGHU OD FREHUWXUD 0iV VREUH
este tópico en el ítem Eutanasia.
Demencia
La demencia es una de las enfermedades más
comunes y discapacitantes en los ancianos.
$IHFWD HQ IRUPD VHYHUD D FDVL XQ GH ORV
LQGLYLGXRV PD\RUHV GH \ KDVWD XQ GH
ellos en sus formas moderadas. Dadas sus caUDFWHUtVWLFDV UHSUHVHQWD XQ VLJQL¿FDWLYR FRVWR
SVLFROyJLFR\HFRQyPLFRWDQWRSDUDHOSDFLHQWH
FRPRSDUDVXIDPLOLDWHQLHQGRXQDOWRLPSDFWR
económico en los recursos de la salud pública.0iVD~QVLWHQHPRVHQFXHQWDTXHODGHPHQFLDGHELGRDODPD\RUH[SHFWDWLYDGHYLGD
DFWXDOHVSRUOHMRVPXFKRPiVIUHFXHQWHTXH
ORV HVWDGRV YHJHWDWLYRV SHUVLVWHQWHV GH GRQGH
ODGHFLVLyQGH¿QDOL]DUXQWUDWDPLHQWRHQHVWRV
SDFLHQWHVHVXQRGHORVFRQÀLFWRVPiVIUHFXHQtes en la especialidad.
$PHGLGDTXHODSREODFLyQPXQGLDOHQYHMHFH FDGD YH] HV PD\RU OD SUHYDOHQFLD GH OD GHmencia de Alzheimer o la multinfarto. Pocas
HQIHUPHGDGHVUHTXLHUHQGLFKDDWHQFLyQ\SODQWHDQ WDO FRQÀLFWLYD IDPLOLDU FRPR OD GHPHQFLD
El principal dilema ético reside en mantener un
cuidado digno y humano en el paciente demente
HQODFRQÀLFWLYDVRFLDODFWXDO
La demencia incluye un deterioro global de
ODVIXQFLRQHVFRJQLWLYDVTXHVHFDUDFWHUL]DLQLcialmente por trastornos mnésicos y gradualPHQWH GH ODV RWUDV IXQFLRQHV LQWHOHFWXDOHV HO
MXLFLRODFDSDFLGDGGHDEVWUDFFLyQHWF\SULQFLSDOPHQWH OD GL¿FXOWDG HQ OD YLGD GH UHODFLyQ
GHOSDFLHQWHGHELHQGRWRGRVHVWRVFDPELRVVHU
HYDOXDGRVHQHOFRQWH[WRSUHYLRGHOSDFLHQWH
9 - Gestión jurídico legal en organizaciones de atención de la salud / 263
&RPR HQ WRGR OR SODQWHDGR HO SULQFLSLR GH
la autonomía es prioritario a la hora de tomar
una decisión y deben seguirse las instancias anWHULRUPHQWHH[SXHVWDVHQFDVRGHTXHQRH[LVWDQ
GLUHFWLYDV SUHYLDV GHO SDFLHQWH (Q HVWRV FDVRV
SULPD HO SULQFLSLR GH QR PDOH¿FLHQFLD VLHQGR
ODIDPLOLDFRQHODVHVRUDPLHQWRGHOPpGLFROD
HQFDUJDGDGHHOHJLUXQDRSFLyQHTXLOLEUDGDHQWUHORVEHQH¿FLRVTXHVHSUHWHQGHQEULQGDU\ORV
WUDVWRUQRV TXH HVH WUDWDPLHQWR LPSOLFD SDUD HO
paciente. Esto último se denomina doctrina del
mejor interés y resulta en algunos casos difícil
GHDSOLFDUGDGRTXHSDUDHOORWDQWRORVIDPLOLDUHV FRPR HO PpGLFR GHEHQ GHFLGLU DTXHOOR TXH
hubiere preferido el paciente como opción apropiada de tratamiento.
(VLPSRUWDQWHHQORVHVWDGLRVLQLFLDOHVUHDOL]DUXQFRUUHFWRGLDJQyVWLFRFRQHO¿QGHGHVFDUWDURWURVFXDGURVFRPRODGHSUHVLyQFRP~QD
HVWDHGDG\HOGHOLULRDVtFRPRRWUDVFDXVDVGH
GHPHQFLDVRGHWHULRURFRJQLWLYRWUDWDEOHV(QWUH
estas últimas se deben considerar las causas horPRQDOHV PHWDEyOLFDV QXWULFLRQDOHV Wy[LFDV R
infecciosas capaces de manifestarse clínicamenWHFRPRXQFXDGURGHPHQFLDODQWHVGHGLDJQRVWLFDUXQDGHPHQFLDGH¿QLWLYDHLUUHYHUVLEOH
/DV FXHVWLRQHV pWLFDV TXH VXUJHQ GHO PDQHMRGHOSDFLHQWHGHPHQWHYDUtDQVHJ~QHOHVWDGLR
HYROXWLYR GH OD HQIHUPHGDG (O HVWDGLR LQLFLDO
GHODHQIHUPHGDGHVTXL]iVHOPRPHQWRDGHFXDGRVLQRIXHKHFKRSUHYLDPHQWHGHGHFLGLUODV
FRQGXFWDVIXWXUDVFXDQGRWRGDYtDHOSDFLHQWHHV
capaz de entender y el médico aún puede tener
XQDLGHDJOREDOGHORVYDORUHVGHOSDFLHQWH\VXV
SUHIHUHQFLDV WHUDSpXWLFDV R HO WUDWDPLHQWR TXH
FRQVLGHUD PiV DGHFXDGR 0XFKDV YHFHV HVWDV
GHFLVLRQHVH[FHGHQHOSODQRPHUDPHQWHPpGLFR
H[WHQGLpQGRVH D DFFLRQHV GH OD YLGD FRWLGLDQD
FRPRHOPDQHMRGHXQDXWRPyYLORGHOGLQHUR
(VDOPpGLFRDTXLHQOHFRUUHVSRQGHLUSUHSDUDQGRDOSDFLHQWH\DODIDPLOLDTXLHQHVHVSHUDQXQD
respuesta y orientación de su parte para poder
HQIUHQWDU GLFKDV LQVWDQFLDV WHQLHQGR HQ FXHQWD
OD HYROXFLyQ JUDGXDO KDFLD HO GHWHULRUR GH HVWD
enfermedad.
Para la mayoría de los pacientes dementes
ODV PHGLGDV TXH VH FRQVLGHUDQ PiV DSURSLDGDV
VRQ DTXHOODV WHQGLHQWHV D FXLGDU VXL VDOXG PiV
TXHDFXUDUOD0LHQWUDVTXHDOJXQRVFDVRVGHGHPHQFLDV UHYHUVLEOHV WLHQHQ WUDWDPLHQWR OD JUDQ
PD\RUtD VRQ LUUHYHUVLEOHV \ VXV FXLGDGRV HVWiQ
UHODFLRQDGRV FRQ DTXHOODV PHGLGDV TXH HQ ORV
estadios iniciales y medios de la enfermedad
LQFOX\HQ HO FXLGDGR GH HQIHUPHGDGHV PHGLFDPHQWRV \ FDPELRV HQ HO HQWRUQR TXH SXHGDQ
acelerar el deterioro. Esto incluye el tratamiento
de las complicaciones frecuentes en estos paFLHQWHVFRPRODLQFRQWLQHQFLDHOLQVRPQLR\ORV
HSLVRGLRVGHH[FLWDFLyQSVLFRPRWUL] American
Academy of Neurology
/RVSUREOHPDVpWLFRVPiVUHOHYDQWHVVXUJHQ
HQORVFDVRVDYDQ]DGRVGRQGHVHSODQWHDODQR
realización o la suspensión de un determinado
WUDWDPLHQWR\ODDSOLFDFLyQHQIRUPDH[FOXVLYD
GH FXLGDGRV SDOLDWLYRV (V HO FDVR GH ORV SDFLHQWHVLQVWLWXFLRQDOL]DGRVFRQGHPHQFLDDYDQ]DGD TXH GHVDUUROODQ XQD LQIHFFLyQ LQWHUFXUUHQWHRUHTXLHUHQDOLPHQWDFLyQHQWHUDO([LVWH
cierto consenso entre los médicos y la sociedad
respecto de la elección de los cuidados paliatiYRVHQHVWRVFDVRV'LFKRVFXLGDGRVGHEHQVHU
ordenados por un médico con objeto de lograr
GRV REMHWLYRV SULPRUGLDOHV QR WUDWDU ODV FRPSOLFDFLRQHV TXH QR SURGX]FDQ GLVFRQIRUW DO
SDFLHQWH \ Vt DTXpOODV TXH OR SURGXFHQ (QWUH
estas indicaciones se destaca la de no resucitar
a un paciente demente y no internarlo a menos
TXH HVWR FRQWULEX\D D VX FRQIRUW 6H HQWLHQGH
FRPRFRQIRUWWRGRDTXHOORTXHKDFHHQSULPHU
OXJDUDODKLJLHQH\GLJQLGDGGHOSDFLHQWHDGPLQLVWUDFLyQGHR[tJHQRSDUDORVTXHSDGHFHQ
GLVQHD HMHUFLFLRV GH PRYLOL]DFLyQ \ URWDFLyQ
IUHFXHQWH\QXWULFLyQDGHFXDGDDPHQRVTXHHO
paciente se retire la sonda de forma permanenWH(VWDVGLUHFWLYDVGHEHQVHUH[SOLFLWDGDVHQOD
historia clínica en presencia del representante
OHJDOGHOHQIHUPR\GHOSODQWHOPpGLFR\DTXH
FRPRGLMLPRVFRQUHIHUHQFLDDOHVWDGRYHJHWDWLYRSHUVLVWHQWHODFRQVLJQDGHQRUHVXFLWDUQR
VyORLPSOLFDHOQRXVRGHUHVSLUDGRUVLQRWRGD
XQDVHULHGHDFFLRQHVTXHWLHQGHQDLQWHUUXPSLU
HO FXUVR QDWXUDO GH OD HQIHUPHGDG American
Academy of Neurology ÉTICA Y COSTES FRENTE A LA MUERTE
&RPRFRURODULRGHORH[SXHVWR\HQHOFRQWH[WR
VRFLRHFRQyPLFRDFWXDOGRQGHODMXVWDGLVWULEXción de los recursos en época de escasez se torna
GL¿FXOWRVDHODQiOLVLVGHORVFRVWRVHQVDOXGUHVXOWDGHPi[LPDUHOHYDQFLD
Analizando los gastos sanitarios de una poEODFLyQSRGHPRVREVHUYDUTXHHOFRVWRTXHFRQOOHYDHOSURFHVRGHODPXHUWHFRQFHQWUDXQDDOWD
proporción de éstos en un número reducido de
264 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
personas.$HVWHSXQWRVHDUULED\DVHDSRUOD
UHDOL]DFLyQGHFXLGDGRVKHURLFRVFRPRWDPELpQ
por la prestación de cuidados mínimos durante
un tiempo prolongado. Ambas opciones se han
esbozado a lo largo del capítulo.
6L ELHQ ORV DYDQFHV GH ORV FXLGDGRV LQWHQVLYRV KDQ SHUPLWLGR TXH XQD JUDQ FDQWLGDG GH
SDFLHQWHV JUDYHV WHQJD KR\ PiV SRVLELOLGDGHV
GHVXSHUYLYHQFLDWDPELpQKDHQIUHQWDGRDODVRFLHGDGSRULQWHUPHGLRGHVXVUHSUHVHQWDQWHVVDQLWDULRVDGH¿QLUORVFULWHULRVGHLQFOXVLyQSDUD
JR]DUGHVXVEHQH¿FLRV
< HV HQWRQFHV GRQGH VXUJH HO FRQÀLFWR pWLFR DFWXDO HQ FXDQWR D FRUUHFWD DVLJQDFLyQ GH
UHFXUVRV TXp SDFLHQWHV GHEHQ DFFHGHU D HVWRV
FXLGDGRVGXUDQWHFXiQWRWLHPSR\DTXpFRVWR
6LFRQVLGHUDPRVORVSULQFLSLRVpWLFRVTXHULJHQ
HODFFLRQDUPpGLFRHOGHODMXVWLFLDGLVWULEXWLYD
resulta preponderante a la hora de tomar estas
GHFLVLRQHV PiV D~Q HQ ORV SDtVHV VXEGHVDUUROODGRVHQTXHODVQHFHVLGDGHVSULPDULDVVRQWDQ
SULRULWDULDVTXHODPD\RUtDQRWLHQHDFFHVRDOD
alta tecnología.
'HEHPRV WHQHU HQ FXHQWD TXH ORV HVIXHU]RV
terapéuticos pueden limitarse no sólo por el rechazo por parte del enfermo o por su contrainGLFDFLyQ VLQR WDPELpQ SRUTXH ORV UHFXUVRV VRQ
escasos y deben racionarse. No cabe al médico
VHUHOTXHGHFLGDODPDQHUDDGHFXDGDGHUDFLRQDUORV 3DUD HVR H[LVWHQ ODV DXWRULGDGHV DGPLQLVWUDWLYDV VDQLWDULDV TXH GHEHQ GDU ODV QRUPDV
TXH OXHJR VH DSOLFDUiQ D WRGRV SRU LJXDO (VWH
UDFLRQDPLHQWR HTXLWDWLYR LPSRQH XQD JHVWLyQ
H¿FD] \ H¿FLHQWH TXH HV REOLJDWRULD FXDQGR VH
debe hacer justicia sobre los recursos públicos.
3DUDHOORHVFRQGLFLyQQHFHVDULDTXHODHIHFWLYLdad de los procedimientos esté comprobada de
modo fehaciente.
'HORDQWHULRUGHGXFLPRVTXHHOSULQFLSLRGH
justicia debiese ser crítico a la hora de decidir
%RKLJDV/O
*DUFtD'
los cuidados heroicos en pacientes terminales
o sin ningún pronóstico. El principio ético de
KDFHUORSRVLEOHSRUVDOYDUODYLGDGHOHQIHUPR
FXDQGRKD\XQDH[SHFWDWLYDUD]RQDEOHFRQWUDVWD
con el encarnizamiento terapéutico en pacientes
VLQSRVLELOLGDGHVGHUHFXSHUDFLyQHQTXLHQHVUHsultaría moralmente más aceptable ayudar a un
buen morir.
$SHVDUGHORGLItFLOTXHHQHVHFRQWH[WRHVGHFLGLUTXpFRQGXFWDHVVRFLDOPHQWHPiVMXVWDFDGD
FDVRGHEHVHUUHYLVWRHQSDUWLFXODUFRQLQGHSHQdencia de las presiones e intereses económicos en
MXHJRTXHHQVXDIiQGHRSWLPL]DUODUHQWDELOLGDG
GHOVLVWHPDRDORV¿QHVGHGLVPLQXLUORVFRVWRV
SXHGHQ UDFLRQDU SUHVWDFLRQHV H¿FDFHV SRUTXH
TXL]iV VX LQGLFDFLyQ QR HVWp HVWULFWDPHQWH DFODUDGD &RPR VDEHPRV HQ OD SUiFWLFD GLDULD VXUgen a menudo dudas respecto de si el tratamiento
VHUiRQRH¿FD]\DYHFHVVyORVXXVRQRVGDXQD
UHVSXHVWD(QHVWRVFDVRVHOEXHQFULWHULRPpGLFR
GHEHSULPDUSRUVREUHFXDOTXLHURWUR
COLOFÓN
1RFDEHGXGDGHTXHSULPDHQHVWHHQIRTXHXQ
criterio de tipo jurídico. Los médicos debemos
DFRVWXPEUDUQRV D TXH PiV DOOi GH QXHVWUD IRUPDFLyQ\OD¿ORVRItDVXE\DFHQWHHQQXHVWUDVDFFLRQHVVRPRVPHUDVSHUVRQDV±VXMHWRVGHGHUHFKR DO TXH GHEHPRV DGDSWDUQRV± \ UHFRUGDQGR
VLHPSUHTXHHQFDVRGHFRQÀLFWRMXGLFLDOQRVHUi
XQPpGLFRTXLHQQRVMX]JDUiVLQRXQSURIHVLRnal del derecho –el juez– imbuido de una conFHSFLyQ ¿ORVy¿FD TXH PXFKDV YHFHV FROLVLRQD
FRQQXHVWURGLVFXUVRLQWHUSUHWDWLYR
Debe recuperarse el sentido ético de la profesión y asumir en todo momento la conducta
FRUUHFWD ±OR TXH GHEH KDFHUVH lex-artis ± TXH
UHSUHVHQWDUiODPHMRUSUHYHQFLyQ
10
GESTIÓN DE RECURSOS HUMANOS E INCENTIVOS
EN LA ORGANIZACIÓN DE SALUD
INTRODUCCIÓN
$OFRQVLGHUDUODVGLYHUVDVFDWHJRUtDVGHDFWRUHVVRFLDOHVTXHHVWiQLQYROXFUDGRVHQHOSURFHVRGHVDOXG FRQMXQWRV\PRYLPLHQWRVVRFLDOHVHO(VWDGR
ODV2UJDQL]DFLRQHVGH6DOXG QRSXHGHGHMDUVHGH
ODGRDORVUHFXUVRVKXPDQRVGHOVHFWRUHVWRHVORV
WUDEDMDGRUHVGHVDOXG(QSULPHUOXJDUSRUWUDWDUVH
de un sector en donde la cuestión de los trabajaGRUHVDGTXLHUHJUDQLPSRUWDQFLDHQVXVDVSHFWRV
WDQWRGHIRUPDFLyQ\GHXWLOL]DFLyQFRPRGHVXRUJDQL]DFLyQFRUSRUDWLYD(QVHJXQGROXJDUSRUTXH
DXQTXHVHUHFRQR]FDHOSDSHOUHOHYDQWHTXHOHFRrresponde jugar a los conjuntos y actores sociales
GHODVRFLHGDGFLYLOHVLQQHJDEOHTXHVRQORVWUDEDMDGRUHVORVSULQFLSDOHVUHVSRQVDEOHVHQJHQHUDUORV
espacios necesarios para la participación social en
la transformación de los sistemas de salud.
6HJ~QOD236ORVVHUYLFLRVGHVDOXGVRQLQVWLWXFLRQHVFRPSOHMDVXQWLSRHVSHFLDOGHRUJDQL]DFLRQHV
SURIHVLRQDOHVTXHDOJXQRVHFRQRPLVWDVOODPDQservicios mano de obra intensivos y algunos sociólogos
people processing organizations RUJDQL]DFLRQHVGH
SURFHVRKXPDQR (QHVWDVRUJDQL]DFLRQHVODSURGXFFLyQGHVHUYLFLRVGHSHQGHGHODFRQWULEXFLyQWpFQLFD\GHOFRPSRUWDPLHQWRGHORVWUDEDMDGRUHVVREUH
TXLHQHVLQÀX\HQFRPSOHMRVSURFHVRVGHSURIHVLRQDOL]DFLyQHOFRQWH[WRGHODRUJDQL]DFLyQ\ORVUHFXUVRV GLVSRQLEOHV ([LVWH WDPELpQ XQ IDFWRU FXOWXUDO
modelador del comportamiento de los trabajadores
\GHVXUHODFLyQFRQORVXVXDULRVPX\LPSRUWDQWHD
ODKRUDGHGH¿QLUFRQGLFLRQHVGHWUDEDMRHIHFWLYDV
HQ HVRV VHUYLFLRV 6H KDFH QHFHVDULR SRU HOOR XQD
ySWLPDJHVWLyQGHORVUHFXUVRVKXPDQRVHVSHFLDOPHQWHVLVHWLHQHHQFXHQWDTXHORVKRVSLWDOHVSRU
HMHPSORVRQXQDGHODVLQVWLWXFLRQHVVRFLDOHVPiV
FRPSOHMDV\FRQÀLFWLYDV\TXHHOJDVWRHQSHUVRQDO
HQFXDOTXLHUDGHHOORVHQ$PpULFD/DWLQDQREDMDGHO
HQWUH\HQQXHVWURPHGLR (VSRUHOORTXHODJHVWLyQGHUHFXUVRVKXPDQRVDGTXLHUHXQDDOWDLPSRUWDQFLDHVWUDWpJLFDHQ
VDOXGS~EOLFDKDFLpQGRVHQHFHVDULD
‡ 8QD YLQFXODFLyQ PiV HVWUHFKD FRQ OD SODQL¿FDFLyQ HVWUDWpJLFD GH ODV LQVWLWXFLRQHV GH
VDOXG'HORVREMHWLYRVGHORVKRVSLWDOHVSRU
HMHPSORVXUJHQORVFRQRFLPLHQWRVKDELOLGDGHV QHFHVDULDV QXHYDV IRUPDV GH SUR\HFWDU
el papel de las personas en el ambiente de
WUDEDMRFULWHULRVGHFRQWULEXFLyQUHWULEXFLyQ
y posibilidades de progreso de su personal.
‡8QDPDUFDGDGHVFHQWUDOL]DFLyQGHOPDQHMRGHORV
UHFXUVRVKXPDQRVHQWDQWRODVYDULDFLRQHVHQOD
WHFQRORJtD LGHQWL¿FDFLyQ GH OD FREHUWXUD HWF
QHFHVLWDQ GH XQD DGDSWDFLyQ FRQVWDQWH \ SRU
HQGHHVWDUPiVFHUFDGHORVOXJDUHVGHDFFLyQ
‡8QDYLVLyQPiVFHUFDQDGHORVFDPELRVHQODV
IXHU]DV GH WUDEDMR HQ HVSHFLDO HQ OD LQFRUSRUDFLyQODDGTXLVLFLyQGHHQWUHQDPLHQWR\
H[SHULHQFLD\HQVXSURPRFLyQ
&XDQGRVHUH¿HUHDOUHFXUVRKXPDQRVHSLHQVD
en sujetos estratégicos capaces de actuar de maQHUDFRPSOHMD 0DWXVGLUtDDFWRUHVHQVLWXDFLyQ
HVWRHVTXHHVWiQVLWXDGRVHQXQSDSHOSURWDJyQLFRQRVLHQGRVLPSOHVREVHUYDGRUHV1 TXHDMXVWDQ
9pDVH0DWXV&Teoría del juego social%XHQRV$LUHV(G81/D
1
266 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
GHFRQWLQXRVXVSURSLDVPHWDVDODVGHOFRQWH[WR
HQTXHDFW~DQ\TXHSRUWDQWROHMRVGHVHUREMHWRV
GH LQWHUYHQFLyQ VRQ SURWDJRQLVWDV GH FXDOTXLHU
SURFHVR HQ TXH VH HQFXHQWUHQ LQPHUVRV HVWR HV
DVtIXQGDPHQWDOPHQWHGHELGRDTXHODVSHUVRQDV
SRVHHQUHFXUVRV\FDUDFWHUtVWLFDV FRQRFLPLHQWRV
FDSDFLGDGH[SHULHQFLD FRQODVTXHHQWUDQDHVWH
MXHJRHOjuego socialTXHDERQDQODLGHDGHTXH
TXLHQPDQHMDUHFXUVRVKXPDQRVKR\GtDHVWiHQ
UHDOLGDGDGPLQLVWUDQGRWDOHQWRVFRPSHWHQFLDV\
YDORUHV(QRWUDVSDODEUDVQRVRQODVLQVWLWXFLRQHVODVTXHWLHQHQSHUVRQDVVLQRODVSHUVRQDVODV
TXHKDFHQODVLQVWLWXFLRQHV
EL RECURSO HUMANO EN LOS PROCESOS
DE REFORMA DEL SECTOR
(VDPSOLDPHQWHUHFRQRFLGRTXHHQORVSURFHVRV
de reforma del sector salud el recurso humano
tiene una importancia estructural y se constitu\HHQIDFWRUFUtWLFRSDUDFXDOTXLHUFDPELRTXHVH
SURSRQJD/DFRPSOHMLGDGGHHVWHKHFKRDXPHQWD
D~QPiVHQODPHGLGDHQTXHHVHOSHUVRQDODFWXDO
GHO VHFWRU HO TXH SURWDJRQL]DUD VXV WUDQVIRUPDFLRQHVQHFHVDULDV'LFH$UWD]DTXHKR\SRUKR\
un hospital debe entenderse como un conjunto de
SHUVRQDVTXHVLUYHDSHUVRQDVORTXHLPSOLFDTXH
los complejos procesos tecnológicos y productiYRV TXH DOOt VH GHVDUUROODQ VH GHEHQ FRQWHPSODU
FRPRHOUHVXOWDGRGHODYROXQWDGODLQWHOLJHQFLD
HOFRQRFLPLHQWR\ODVHPRFLRQHVGHTXLHQHVSDUticipan en dichos procesos.
$HIHFWRVGHODJHVWLyQVHFRQVLGHUDQUHFXUsos humanos del hospital al conjunto de personas
TXHWUDEDMDQRSUHVWDQVHUYLFLRVSDUDpOLQFOXLGDV
DGHPiV GH ORV HPSOHDGRV ¿MRV WRGDV DTXHOODV
FRQWUDWDGDV FRPR WHUFHURV VXEFRQWUDWDGDV R ODV
VXMHWDV D OD FRPSUD RFDVLRQDO GH VHUYLFLRV /RV
recursos humanos de un hospital tienen simultáneamente una doble dimensión: como factor
HVWUXFWXUDO \ FRPR IDFWRU SURGXFWLYR (O IDFWRU
HVWUXFWXUDO GH ORV UHFXUVRV KXPDQRV YLHQH GDGR
SRU VX FDUiFWHU GH VXMHWRV SHQVDQWHV \ DFWLYRV
TXH FRQIRUPDQ ODV SUiFWLFDV HVWDEOHFHQ ODV IRUPDV GH UHODFLyQ GH¿QHQ YDORUHV \ RUJDQL]DQ \
desarrollan el proceso de trabajo; al gestionarse
SURFHVRVGHFDPELRLQVWLWXFLRQDOODPRYLOL]DFLyQ
GH YROXQWDGHV HV XQ UHTXLVLWR EiVLFR SDUD LQWURGXFLU PRGL¿FDFLRQHV HQ ODV UHODFLRQHV KXPDQDV
\HQODVFRQGXFWDV\SUiFWLFDVGHOWUDEDMRVLHQGR
HVWRSRVLEOHSRUTXHHOUHFXUVRKXPDQRIXQFLRQD
como un sistema abierto capaz de aprender y reorganizarse –hologramáticamente en el sentido
GH0RUJDQ3RUVXSDUWHODGLPHQVLyQGHOUHFXUVR
KXPDQRFRPRIDFWRUSURGXFWLYRSURFHGHGHOKHFKRGHTXHVHDUWLFXODFRQORVUHVWDQWHVIDFWRUHV
SDUDSURYHHUVHUYLFLRVGHVDOXG\GHTXHTXL]iV
constituye el principal recurso de este proceso
SURGXFWLYRVHJ~QGLMLPRV
(QORSXQWXDOHOSDSHOTXHGHVHPSHxDHOPpGLFRHQODGLQiPLFDGHOPHUFDGRGHVHUYLFLRVGH
VDOXG\SRUHQGHHQHOSURFHVRGHSURGXFFLyQ
HVIXQGDPHQWDOSXHVHVTXLHQGH¿QHRDOPHQRV
ERVTXHMD HO SURGXFWR ¿QDO TXLHQ DFW~D FRPR
apoderado de las decisiones del usuario –en la
OODPDGD UHODFLyQ GH DJHQFLD± HV XQ DVDODULDGR
GHOKRVSLWDOXQFOLHQWHpOPLVPRGHRWURVVHUYLFLRVJHQHUDGRVSRUHOKRVSLWDOXQSURYHHGRUGH
VHUYLFLRV GHPDQGDGRV \ XQ JHQHUDGRU VLPXOWiQHRGHGHPDQGD\GHRIHUWDVLHQGRpVWHXQRGH
ORVHOHPHQWRVGHORVSURFHVRVGHSURGXFFLyQTXH
PiVGL¿FXOWDGHVDxDGHDODQiOLVLVGHORVKRVSLWDles y su administración.
$XQTXHSRGUiGHFLUVHTXHODJHVWLyQGHUHFXUVRVKXPDQRVGHOKRVSLWDOVHUH¿HUHDODFDSDFLGDG
de tomar decisiones y desarrollar acciones concreWDV\FRWLGLDQDVTXHSHUPLWHQVXIXQFLRQDPLHQWR
DGHFXDGRHVQHFHVDULRSXQWXDOL]DUTXHDODYH]
esas decisiones se enmarcan en la dimensión políWLFDGHODRUJDQL]DFLyQSXHVWLHQHQTXHYHUGLUHFtamente con las diferentes instituciones del Estado
\ODVRFLHGDGTXHUHJXODQODIRUPDFLyQHOPHUFDGR
ODERUDOODOHJLVODFLyQODERUDORHOFRQÀLFWRIUHQWHD
ODVH[LJHQFLDVVRFLDOHV/DJHVWLyQGHOUHFXUVRKXmano del hospital tiene un doble carácter; por un
ODGRHOGHODRSHUDFLyQGLDULDFX\RVUHVXOWDGRVVH
PLGHQDFRUWRSOD]R\SRURWURHOGHODSODQL¿FDFLyQ\ODQHJRFLDFLyQHVWUDWpJLFDLQWHUQD\H[WHUQD
DVSHFWRVTXHVHSRQHQGHPDQL¿HVWRDPHGLDQR\
ODUJRSOD]R(VQRWRULRHOUHTXHULPLHQWRGHDQDOL]DU ODV JUDQGHV WHQGHQFLDV TXH HQ HVWH PRPHQWR
caracterizan la situación del recurso humano en la
Región. En el marco de la corriente llamada modernización estatal\GHODVUHIRUPDVVHFWRULDOHV
ODVWHQGHQFLDVTXHPD\RULPSDFWRKDQWHQLGRHQOD
0DWXV&ibídem.
(OORH[SOLFDTXHHOFRVWRGHORVUHFXUVRVKXPDQRVSRUORJHQHUDODOFDQFHHORPiVGHOSUHVXSXHVWRJOREDOGH
ORVKRVSLWDOHVHQFDVLWRGRHOPXQGRRFFLGHQWDOFRPRKHPRV\DPHQFLRQDGR
10 - Gestión de recursos humanos e incentivos en la organización de Salud / 267
JHVWLyQGHOUHFXUVRKXPDQRVRQODÀH[LELOL]DFLyQ
la descentralización y la autonomía de gestión.
/RVSURFHVRVGHDMXVWHHFRQyPLFR\ODFULVLV¿VFDO
HQORVSDtVHVGHOD5HJLyQDVtFRPRORVLQWHQWRV
GHFRQ¿JXUDUHFRQRPtDVDELHUWDVKDQSURSLFLDGR
transformaciones en la dinámica de los mercados
GHWUDEDMRHQJHQHUDO\HQSDUWLFXODUHQODVSURfesiones del campo de la salud. En el sector de la
VDOXGVHREVHUYDXQFDPELRFXDOLWDWLYRHQHOSHU¿O
GHHPSOHRGHELGRSRUXQODGRDODXPHQWRGHOD
participación de personal con mayor formación en
iUHDVGHJHUHQFLD\DODE~VTXHGDGHPHFDQLVPRV
de contención de costos y de mejora de la productiYLGDG\ODH¿FLHQFLD3RURWURODGRKDQDXPHQWDGR
ODVH[LJHQFLDVSDUDHOLQJUHVRGHSHUVRQDO SULQFLSDOPHQWHHOGHDSR\R DVRFLDGRFRQORVSURFHVRV
GHWHUFHUL]DFLyQORTXHUHGXFHODVRSRUWXQLGDGHV
GH HPSOHR GH ORV WUDEDMDGRUHV FRQ PHQRU QLYHO
HGXFDWLYR SHUVRQDO GH OLPSLH]D DOLPHQWDFLyQ H
LQFOXVRDX[LOLDUHVGHHQIHUPHUtDRTXLUyIDQRHWF TENDENCIAS EN EL MERCADO DE TRABAJO
8QDREVHUYDFLyQDFWXDOGHORVSURFHVRVGHWUDQVIRUPDFLyQ SURGXFWLYD \ ODV UHIRUPDV ODERUDOHV
SHUPLWH LGHQWL¿FDU ODV VLJXLHQWHV WHQGHQFLDV HQ
el mercado de trabajo:
‡ &DPELRV HQ ORV VLVWHPDV GH FDUUHUDV HQ HO
iUHD GH VDOXG WUDGLFLRQDOPHQWH EDVDGDV HQ
ODDQWLJHGDGHQHOFDUJRKDFLDVLVWHPDVEDVDGRV HQ OD HYDOXDFLyQ GHO GHVHPSHxR \ OD
FDSDFLWDFLyQHQWUHRWURVFULWHULRV
‡eQIDVLVHQORVSURFHVRVGHSURIHVLRQDOL]DFLyQ
como base de acreditación y de competencia
en los mercados laborales
‡&DPELRVHQORVUHJtPHQHVODERUDOHVHQIDWL]DQGRODÀH[LELOLGDGWDQWRGHOHPSOHRDQWH
ODVÀXFWXDFLRQHVGHORVPHUFDGRVGHWUDEDMR
H[WHUQD FRPRODOODPDGDWHFQRRUJDQL]DWLYD LQWHUQD TXHH[LJHXQDPD\RUDGDSWDELOLdad del personal a los cambios tecnológicos
en los procesos de producción
‡&DPELRVHQORVUHJtPHQHVVDODULDOHVHQIDWL]DQGRORVVLVWHPDVGHLQFHQWLYRVSRUSURGXFWLYLGDG\GHVHPSHxR
‡ &DPELRV HQ ORV PDUFRV UHJXODWRULRV GH ORV
PHUFDGRVGHWUDEDMRFRQWHQGHQFLDKDFLDOD
desregulación.
Otro fenómeno es la generalización de los
mecanismos de tercerización de la fuerza de traEDMRHQVDOXGLQFOXLGRVHQDOJ~QFDVRORVVHUYL-
cios profesionales; si bien se centraba al princiSLRHQVHUYLFLRVJHQHUDOHV OLPSLH]DYLJLODQFLD
DOLPHQWDFLyQRPDQWHQLPLHQWR HQODDFWXDOLGDG
LQFOX\HHQDOJXQRVSDtVHVODFRQWUDWDFLyQGHVHUYLFLRVSURIHVLRQDOHVWDOHVFRPRORVTXHRIUHFHQ
FRRSHUDWLYDVPpGLFDVRUJDQL]DFLRQHVGHHQIHUmería para la atención domiciliaria o la rehabilitación. Esto genera problemas no menores: por
XQODGRODRSRVLFLyQGHORVJUHPLRVDQWHORTXH
SHUFLEHQDFHUWDGDPHQWHRQRFRPRDPHQD]DVD
ODIXHQWHGHWUDEDMR\SRURWURHOGHVSURSyVLWR
UHDO\FRQFUHWRGHDxDGLUFDSDVHVWUDWL¿FDGDVGH
SHUVRQDOLQH¿FLHQWHFRPRPtQLPRRGHEXVFDU
VROXFLRQHVDOWHUQDWLYDVIXHUDGHOVLVWHPDSRUOR
JHQHUDO D FRVWD GH JUDQ HURJDFLyQ FRQVLJXLpQGRVH XQD JUDQ PDVD GH SHUVRQDO LQH¿FD] \ OD
SURYLVLyQFDUDGHVHUYLFLRVTXHGHELHUDQHQFRQtrarse en el propio sistema –usualmente de tercer
QLYHORGHODUJDHVWDQFLD
Otra tendencia asociada con los procesos
de desconcentración y descentralización es el
cambio producido en la distribución de las oporWXQLGDGHV GH HPSOHR KDFLD QLYHOHV GHVFHQWUDOL]DGRV OR TXH SDUD DOJXQRV SDtVHV UHSUHVHQWD
XQDPRGL¿FDFLyQGHODRIHUWDGHHPSOHRSRUOR
general restringida a las grandes ciudades. Esta
WHQGHQFLD TXH WDPELpQ VDWXUD ORV PHUFDGRV GH
WUDEDMR PRGL¿FD HQ FLHUWR PRGR OD WUDGLFLRQDO
concentración de profesionales de grandes centros urbanos y establecimientos hospitalarios en
GHWULPHQWRGHORVGHiUHDVUXUDOHV\VHUYLFLRVGH
atención ambulatoria.
(Q HO FRQWH[WR GH OD UHIRUPD HVWDWDO \ VHFWRULDO HQ HO TXH VH FRQVLGHUD OD ULJLGH] GH ORV
sistemas como el mayor obstáculo para la transIRUPDFLyQODÀH[LELOL]DFLyQDSDUHFHFRPRXQD
de las posibilidades para las gerencias de garanWL]DU OD YLDELOLGDG GH ORV FDPELRV UHTXHULGRV
No obstante estos conceptos deben tomarse con
SLQ]DV\VDOYHGDGHVHQQXHVWURPHGLRHQHOTXH
VH DGPLWH TXH VREUH XQD SREODFLyQ HFRQyPLFDPHQWH DFWLYD GH PLOORQHV GH SHUVRQDV ±D
PHGLDGRVGH±KD\PLOORQHVTXHWLHQHQ
SUREOHPDV ODERUDOHV HVWi GHVRFXSDGR \ HO
UHVWDQWH HV VXERFXSDGR DTXpO TXH WUDEDMD
PHQRVFDQWLGDGGHKRUDVGHORTXHGHVHDUtDSDUD
PDQWHQHUVH 8QWHUFLRGHHVRVGHVRFXSDGRVVRQ
MyYHQHV\HOGHORVMyYHQHVTXHWUDEDMDQHVWiQHQQHJUR/DWDVDGHOGHVHPSOHRMXYHQLOHV
GHO\HQWUHODVPXMHUHVWUHSDDO(VWRV
GDWRV QR WRPDQ HQ FXHQWD D TXLHQHV FREUDQ XQ
SODQ VRFLDO \D TXH OD HVWDGtVWLFD ORV FRQVLGHUD
FRPR RFXSDGRV 6L VH ORV LQFOX\HUD OD WDVD GH
268 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
GHVHPSOHR VXELUtD D VHJ~Q FLIUDV R¿FLDOHV(QHVWHFRQWH[WRPXFKDVYHFHVÀH[LELOL]Dción es sinónimo de precarización4 HVWR HV VH
IDYRUHFHQ ODV IRUPDV SUHFDULDV GH FRQWUDWDFLyQ
y se supedita el bienestar del trabajador a criteULRV GH UHQGLPLHQWR \ SURGXFWLYLGDG /D WHRUtD
TXHVXE\DFHDHVWDVD¿UPDFLRQHVHVTXHQLQJXQD
PHGLGDDGRSWDGDSDUDFXPSOLUORVREMHWLYRVLQVtitucionales debería atentar contra la estabilidad
o seguridad laboral del personal. Los principios
GH ÀH[LELOL]DFLyQ ODERUDO LQFOX\HQ HQ WHRUtD HO
cambio de paradigmas aparentemente incuestioQDEOHV FRPR HO WUDEDMR YDORUDGR SRU WLHPSR \
QRSRUSURGXFFLyQHOHPSOHRYLWDOLFLRDOPDUJHQ
GHOPpULWRODSURWHFFLyQGHOHPSOHDGRVLQHYDOXDUVXGHVHPSHxRODLPSRVLELOLGDGGHDFFHGHU
DRWURVLQJUHVRV HVWtPXORVLQFHQWLYRVWUDEDMRV
SRUSURGXFWR FXDQGRVHWLHQHXQFDUJRHVWDWDO
HOFRQWUROGHORVQLYHOHVVDODULDOHVGHVGHODOHJDOLGDGSXEOLFDHWF(VWRVFDPELRVFRUUHVSRQGHQD
PRGL¿FDFLRQHVJHQHUDOHVGHODVUHJXODFLRQHVHVWDWDOHV\VXDSOLFDFLyQLQVWLWXFLRQDOSRUHOORHO
JUDGR GH ÀH[LELOL]DFLyQ DOFDQ]DGR HQ GLVWLQWRV
SDtVHVYDUtDHQIXQFLyQGHODHYROXFLyQGHOVLVWHPDVDQLWDULR\GHOQLYHOGHSDUWLFLSDFLyQSROtWLFD
del sector salud en las decisiones estatales.
(QHOFDVRGHODVDOXGHVQHFHVDULRUHFRUGDU
TXHHOREMHWLYRGHSURGXFWLYLGDG\FRPSHWLWLYLGDGTXHVHEXVFDQRUHVSRQGHDXQDOyJLFDDXWRPDWL]DGDGHSURGXFFLyQHQFDGHQDGHVHUYLFLRV
GH EDMR FRVWR \ GLULJLGD D PHUFDGRV PDVLYRV
FX\RQLYHOGHFRQVXPRSHUPLWDDEVWUDHUHOUHQGLPLHQWRGHOFDSLWDOLQYHUWLGRVLQRTXHODUHODción personalizada constituye la esencia del producto y la garantía de su calidad. Esto imprime
XQFDUiFWHUGLVWLQWLYRDOSURFHVRGHSURGXFFLyQ
GHVHUYLFLRVGHVDOXGTXHGHEHVHUFRQVLGHUDGR
FXDQGRVHPRGL¿FDQORVSURFHVRVGHWUDEDMR
La última década ha permitido aprender
OHFFLRQHV VREUH OD ÀH[LELOLGDG HQ OD JHVWLyQ GH
VHUYLFLRVGHVDOXG(QHOiPELWRUHJLRQDOODLQtroducción de estas medidas no ha podido superar las limitaciones estructurales propias de
ORV SDtVHV GH OD 5HJLyQ \ HQ DOJXQRV FDVRV OD
ÀH[LELOLGDG H[WHUQD KD SURGXFLGR FRPR VHFXHOD OD LQHVWDELOLGDG ODERUDO OD SUHFDULHGDG HQ
las condiciones de trabajo y el deterioro de las
FRQGLFLRQHVEiVLFDVSDUDHOGHVHPSHxRTXHKDQ
DJUDYDGRORVSUREOHPDVH[LVWHQWHVFRPRKHPRV
comentado párrafos arriba.
En el marco de los procesos actuales del secWRUVDOXGVHREVHUYDXQDSURIXQGDPRGL¿FDFLyQ
de las relaciones y las condiciones laborales. En
GLFKD WUDQVIRUPDFLyQ ORV FRQÀLFWRV ODERUDOHV
DGTXLHUHQ UHOHYDQFLD \ DXPHQWDQ VX FRPSOHMLGDGDOWLHPSRTXHVXUJHQQXHYDVUHODFLRQHVGH
SRGHUHQHOVHQRGHXQFRQWH[WRDFRWDGRSRUOD
ÀH[LELOL]DFLyQODGHVFHQWUDOL]DFLyQ\ODDXWRQRPtDGHJHVWLyQRGHODRUJDQL]DFLyQGHVHUYLFLRV
RULHQWDGRV DO XVXDULR (Q JHQHUDO OD UHODFLyQ
entre empleados y empleadores se ha caracteri]DGRSRUWHQVLRQHVYHUWHEUDGDVHQWUHVGLPHQVLRQHVHVSHFt¿FDV
‡(FRQyPLFDRGHLQWHUFDPELRGHWUDEDMRSRU
un salario
‡3ROtWLFRLGHROyJLFDTXHLQFOX\HUHODFLRQHVGH
SRGHUTXHVHH[SUHVDQHQODFRQFHSFLyQGHOD
VDOXG\FRQÀLFWRGHLQWHUHVHVHQWUHHOWUDEDMDGRUODLQVWLWXFLyQ\ORVXVXDULRV
‡(QODRUJDQL]DFLyQGHODSURGXFFLyQGHVHUYLFLRV GHULYDGD GH OD GLYLVLyQ WpFQLFD GHO
trabajo.
/DVUHIRUPDVVHFWRULDOHVVXJLHUHQTXHODVPRGL¿FDFLRQHVTXHFRQOOHYDQKDQGHSURGXFLUVHHQ
HVWDV WUHV GLPHQVLRQHV FRPR SXHGH LQIHULUVH DO
DQDOL]DUORVWLSRVGHÀH[LELOL]DFLyQTXHVHDSOLFDQ
actualmente en las organizaciones sanitarias. Por
RWUR ODGR OD GHVFRQFHQWUDFLyQ \ OD GHVFHQWUDOL]DFLyQFUHFLHQWHGHORVVHUYLFLRVGHVDOXG\PiV
DXQODFRQVWLWXFLyQGHORVKRVSLWDOHVS~EOLFRVHQ
HPSUHVDVVRFLDOHVGHELOLWDQODVUHSUHVHQWDFLRQHV
FHQWUDOHV GH JUHPLRV \ VLQGLFDWRV \ H[LJHQ PiV
IRUWDOH]D D VXV UHSUHVHQWDFLRQHV ORFDOHV OR TXH
PRGL¿FDODQDWXUDOH]DGHODQHJRFLDFLyQODERUDO
Otro factor importante en el cambio de las
relaciones de negociación laboral es el establecimiento de sistemas de medición de indicadoUHV GH SURGXFWLYLGDG HQ IXQFLyQ GH ORV FRVWRV
del personal. Estos sistemas proporcionan inforPDFLyQ TXH SRQH HQ HQWUHGLFKR ODV H[LJHQFLDV
ODERUDOHV PXFKDV YHFHV LQFRPSDWLEOHV FRQ OD
EDMDSURGXFFLyQ\FDOLGDGGHORVVHUYLFLRV(VWRV
DUJXPHQWRVPRGL¿FDQODVFRQGLFLRQHVGHQHJRciación sobre las remuneraciones e introducen
SULQFLSLRVGHPHGLFLyQGHODSURGXFWLYLGDG\OD
calidad relacionados con la retribución.
6HJ~Q/XLV2YLHGR³/RVSUHFDUL]DGRVFREUDQVDODULRVLQIHULRUHV DYHFHVKDVWDXQ SRUODPLVPDWDUHDQR
WLHQHQMXELODFLyQ$57RVHJXURGHGHVHPSOHR\FRPRQRSXHGHQVLQGLFDOL]DUVHHVWiQVRPHWLGRVDMRUQDGDVPiV
ODUJDV\DULWPRVGHWUDEDMRPiVLQWHQVRVFRQVWLWX\HQGRODnueva clase de miserables´
4
10 - Gestión de recursos humanos e incentivos en la organización de Salud / 269
El gran cambio en el escenario actual es la
PRGL¿FDFLyQGHODFRQGLFLyQHVWDEOHGHOHPSOHR
FRPRGHUHFKRDGTXLULGR\ODLQWURGXFFLyQGHIRUPDVLQFLHUWDVGHYLQFXODFLyQDOPHUFDGRGHWUDEDMR/DVH[SHULHQFLDVGHOD5HJLyQDHVWHUHVSHFWR
VRQGHVLJXDOHVSHURHQJHQHUDOVLJXHQHVWDWHQdencia.
(QHOQXHYRHVFHQDULRODQHJRFLDFLyQGHODV
FRQGLFLRQHVGHWUDEDMRGHEHUiFRQYHUWLUVHHQXQ
PHFDQLVPRGHGLiORJRSHUPDQHQWHRULHQWDGRD
FRQVHJXLUEHQH¿FLRVSDUDHOWUDEDMDGRUODLQVWLWXFLyQ\SULQFLSDOPHQWHSDUDODSREODFLyQQR
HQXQVHQWLGRGHDVLVWHQFLDSXEOLFDVLQRFRPR
HOGHUHFKRGHXQDFLXGDGDQtDTXHGHEHHMHUFHUHO
FRQWUROVREUHODVSUHVWDFLRQHVTXHUHFLEH
La aceptación social de la salud como bien
S~EOLFRH[LJHFDGDYH]PiVTXHORVFLXGDGDQRV
GHORV(VWDGRVLQGLYLGXDOPHQWHRHQJUXSRVXERUGLQHQVXVLQWHUHVHVDORVGHODFROHFWLYLGDGOR
TXHPDUFDXQOtPLWHLQIUDQTXHDEOHTXHQRSXHGH
VHUVXSHUDGRSRUSDFWRVFROHFWLYRVGHWUDEDMRQL
SRU FXHUSRV QRUPDWLYRV GH ODV RUJDQL]DFLRQHV
gremiales.
6HJ~Q %RVFK HO VLVWHPD GH IRUPDFLyQ GH
recursos humanos debe ajustar su producción
FXDQWLWDWLYD \ FXDOLWDWLYD FRQ DUUHJOR D ODV H[Lgencias de la reforma sectorial. En la esfera de
OR FXDQWLWDWLYR GHEH LQWHQWDUVH SURGXFLU QL PiV
QLPHQRVTXHORTXHVHSUHYpTXHXWLOL]DUiHOVLVWHPD8QDSURGXFFLyQLQDGHFXDGDHVXQGHVSLOIDUURHFRQyPLFR\KXPDQRTXHSURGXFHGUDPDV
SHUVRQDOHV \ JHQHUD SHOLJURV VRFLDOHV WpFQLFRV
\HFRQyPLFRV/RVHUURUHVGHVREUHSURGXFFLyQ
TXHHQHVWHVLJORVHKDQFRPHWLGRHQFDVLWRGDV
SDUWHVVRQWDQHYLGHQWHV\HVWiQWDQELHQGRFXPHQWDGRVTXHQRPHUHFHQRWURFRPHQWDULRTXH
HOD¿UPDUTXHQDGLHSDUHFHKDEHUVHGDGRSRUHQWHUDGRSRUTXHFRQWLQ~DQSHUSHWXiQGRVH
(Q OD HVIHUD FXDOLWDWLYD HV IXQGDPHQWDO TXH
ORV IRUPDGRUHV VH DFHUTXHQ D OD UHDOLGDG VRFLDO
y sanitaria con objeto de superar los modelos
WUDGLFLRQDOHVTXHSULYLOHJLDQXQDIRUPDFLyQWHyULFD TXH QR ORJUD DIURQWDU OD FRPSOHMLGDG GH OD
realidad. El mayor desafío para la formación de
recursos humanos en salud es superar la cultura
MHUiUTXLFD \ FHUUDGD D OD UDFLRQDOLGDG FLHQWt¿FD
TXHGHVFRQRFHODGLYHUVLGDGTXHQRLQFRUSRUDOD
necesidad de subordinar el interés profesional al
EHQH¿FLRFROHFWLYR\TXHQRLGHQWL¿FDODGLIHUHQcia entre un paciente sumiso y un ciudadano.
$GHPiVORVVLVWHPDVGHVDOXGGHEHQDXPHQWDU VX SUHVHQFLD HQ ORV SURFHVRV HGXFDWLYRV GH
ORV SURIHVLRQDOHV GH OD VDOXG /RV VHUYLFLRV GH
salud están en su derecho y tienen la obligación
GHGHWHUPLQDUHOSHU¿OGHORVSURIHVLRQDOHVTXH
QHFHVLWDQ\SHGLUDOVLVWHPDHGXFDWLYRTXHRUJDnice su trabajo académico para obtener recursos
KXPDQRV IRUPDGRV FX\DV FDSDFLGDGHV FRLQFLGDQFRQHVWRVSHU¿OHV
EL PARTICULAR ESCENARIO HOSPITALARIO
(OKRVSLWDOKDHYROXFLRQDGRDORODUJRGHODKLVWRULD GHVGH FRQFHSFLRQHV DVLVWHQFLDOLVWDV UHOLJLRVDV HOpatio de atrás de la abadía \GHEHQH¿FHQFLDVRFLDO±H[SUHVLRQHVGHREOLJDFLyQGHO
(VWDGREHQHIDFWRU±KDVWDODDGRSFLyQSURJUHVLYD
GHIRUPDVRUJDQL]DWLYDVHPSUHVDULDOHVXQDHYROXFLyQTXHVHHVWiLPSRQLHQGRDQLYHOPXQGLDOD
SULQFLSLRVGHOVLJOR;;,
(QJHQHUDOVHSXHGHD¿UPDUTXHHOKRVSLWDO
se ha mantenido como una instancia aislada de
SURYLVLyQGHVHUYLFLRVGHSHQGLHQWHGHOPLQLVWHULRGHVDOXGODVHJXULGDGVRFLDORUJDQL]DFLRQHV
VRFLDOHVJRELHUQRVORFDOHV PXQLFLSLRV HLQVWLWXFLRQHVSULYDGDVFRQGLIHUHQWHVJUDGRVGHGHVDUUROOR\FREHUWXUD\HQPX\SRFRVSDtVHVRUganizado como parte de un sistema nacional de
VDOXG(QODDFWXDOLGDG\QRREVWDQWHODKHWHURJHQHLGDGFRQFHSWXDO\RUJDQL]DWLYDGHOKRVSLWDO
HQOD5HJLyQODWHQGHQFLDTXHSUHGRPLQDHVOD
de los hospitales públicos administrados direcWDPHQWHSRUHQWLGDGHVGHO(VWDGRTXHFRH[LVWHQ
FRQKRVSLWDOHVSULYDGRVFRQ\VLQ¿QHVGHOXFUR
'HVGH VXV LQLFLRV HO KRVSLWDO VH FRQFLEH
FRPRXQDXQLGDGGHRIHUWDDVLVWHQFLDOGHVHUYLFLRVHQODTXHVHDSUHFLDXQDGLYLVLyQGHOWUDEDMR
por tareas orientada en función de la curación de
HQIHUPHGDGHVFRQXQDDOWDWHQGHQFLDDODHVSHcialización de procedimientos y con una jerarTXL]DFLyQGHIXQFLRQHVEDVDGDHQODSUiFWLFDGH
ODPHGLFLQDORTXHVXSHGLWDDFULWHULRVPpGLFRV
ODUHODFLyQFRQRWUDVSURIHVLRQHV\GH¿QHHOFDrácter de las prácticas institucionales.
Las organizaciones en general y los hospiWDOHV HQ SDUWLFXODU VRQ HQ JHQHUDO UHJLGDV SRU
procedimientos; descripción estandarizada y en
PD\RUGHWDOOHGHXQDDFWLYLGDGXRSHUDFLyQ6RQ
las guías para la ejecución permanente de una
PLVPDWDUHDTXHSRUVXVFDUDFWHUtVWLFDVHVSHFLDOHV QHFHVLWDQ GH RWUDV H[SOLFDFLRQHV GH ³FyPR
HVKHFKRHQODSUiFWLFDGLDULD´
Los hospitales de la Región están afectados
SRU OD FULVLV JHQHUDO GHO VHFWRU S~EOLFR FDUDFterizada por una restricción presupuestaria om-
270 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
QLSUHVHQWH\FUHFLHQWH\VHYHUDVGHELOLGDGHVGH
RUJDQL]DFLyQ\JHVWLyQDVRFLDGDVFRQODGLVPLQXFLyQ GHO SRGHU DGTXLVLWLYR GH OD SREODFLyQ
+R\HOKRVSLWDOVHYHDERFDGRDPRGL¿FDUVXWUDdicional funcionamiento frente a una poderosa
WHQGHQFLDGHUHIRUPDVHFWRULDOTXHEXVFDDUWLFXODU PHFDQLVPRV SDUD XQLYHUVDOL]DU OD DWHQFLyQ
DSURYHFKDQGRODFDSDFLGDGLQVWDODGDWDQWRS~EOLFDFRPRSULYDGDVREUHODEDVHGHHVTXHPDV
GHDVHJXUDPLHQWRVLVWHPDVQDFLRQDOHVGHVDOXG
\VHSDUDFLyQGHIXQFLRQHVHQWUH¿QDQFLDPLHQWR
\ SURYLVLyQ IRQGRV QDFLRQDOHV R ORFDOHV SDUD
FRPSUDGHVHUYLFLRVDUHGHVGHDWHQFLyQ
7RGRVHVWRVFDPELRVFRQYLHUWHQDODDXWRQRPtDKRVSLWDODULDHQXQSDUDGLJPDTXHD\XGDDUHVponder a las necesidades de salud de los usuarios
y a facilitar la toma de decisiones en el hospital y
VXVUHODFLRQHVFRQHOHQWRUQR6LQHPEDUJRSRFRV
HTXLSRVKXPDQRV\PXFKRPHQRVORVGHOVHFWRU
S~EOLFRSXHGHQDOFDQ]DUVXDXWRQRPtDVLQSDVDU
antes por un doloroso proceso de cambio.
1 / .%!&*(!$)$''2!'*'($*"#$#!)' $
.'#%$('(,'$(!'*'($*"#$
.()'*)*'%'$($#!#*#5#!%!#"%'(
,!"$!$)#5#!$(%)!
.'$%*()(''$!!$'*'($(*"#$(
.(4$%'!(
.#2!((!$"%$(5#
!%'($#!
.!*)"#)$
.()'*5#,
)'#('#(
.!#5#
!(*(5#
.$#)')5#
. #*5#
1
(Q OD VLWXDFLyQ DFWXDO SUiFWLFDPHQWH WRGRV
los principios de organización hospitalaria coQRFLGRVGHEHQPRGL¿FDUVHHQUHVSXHVWDDODVVLguientes necesidades:
‡ 3UHVWDU VHUYLFLRV GH FDOLGDG \ RULHQWDGRV DO
usuario
‡ /RJUDU DXWRQRPtD UHVSRQVDELOLGDG \ FRPpromiso del profesional
‡&RQYHUWLUDORVMHIHVHQOtGHUHVIDFLOLWDGRUHV
‡'LVSRQHUGHHVWUXFWXUDVDSODQDGDV\iJLOHV
‡$OFDQ]DUXQHTXLOLEULRHQWUHODVSHUVSHFWLYDV
JHUHQFLDO\FOtQLFDSDUDFRQVLGHUDUDORVSURductos ofertados en el hospital no sólo desde
HOiPELWRGHODRIHUWDPpGLFDVLQRFRPRXQD
necesidad o no de la demanda
‡,QFRUSRUDUFULWHULRVGHFRVWRH¿FLHQFLDH¿FDFLDHIHFWLYLGDGHLPSDFWRHQHODQiOLVLVGH
las condiciones de salud
En muchos países se están elaborando propuestas para mejorar la capacidad de respuesta
de los hospitales como parte de políticas nacio-
.# $!$!!*'-)' $
.#5#!$((()"($"%#(5#
.!#5#%'(*%*()'!*'-)' $
1
0
1
1
.(4$(()"
"$#)$'$#$'"5#
%'+!*'("%4$
. '#!("%4$
.%!%$(
. ##)+$(
.)#$#(
.$#$#()' $
."#)!$'!
.$#( '3%'
'*5#,')'$
.'#(5#)'(!$
.'$($(%'5#
.(''$!!$%'($#!
,%'$($#!
.#)'#"#)$#
('+$
. /
. 1 0
. 1
Figura 10.2: Elementos de la gestión del RRHH en el hospital. Fuente: Price Waterhouse and Coopers.
Documento de Consultoría. Quito: Ministerio de Salud Pública; 1999; World Health Organization. Training manual on management of human resources for health. Geneva: WHO; 1993 (Document WHO/
EDUC/93.201, Elaboración: Fundación Ecuatoriana de la Salud, 2000)
10 - Gestión de recursos humanos e incentivos en la organización de Salud / 271
QDOHV H[SHULHQFLDV SDUWLFXODUHV \ DOWHUQDWLYDV
LQQRYDGRUDV$XQTXHODVSURSXHVWDVGHFDPELR
VRQVLPLODUHVDQLYHOPXQGLDOODHYROXFLyQGHVGHXQDJHVWLyQKRVSLWDODULDWUDGLFLRQDOKDFLDOR
TXH VH SRGUtD OODPDU HO KRVSLWDO GHO IXWXUR HV
muy heterogénea y depende de numerosos condicionantes de cada país.
La gestión del recurso humano está determiQDGD WDQWR SRU ODV H[SUHVLRQHV R IRUPDV RUJDQL]DWLYDV HVWUXFWXUDOHV \ IXQFLRQDOHV GHO KRVpital en su conjunto y su relación con el resto
GHO VLVWHPD GH VDOXG FRPR SRU ODV WHQGHQFLDV
YLJHQWHV VREUH ODV IRUPDV GH RUJDQL]DFLyQ VRFLDO HO SDSHO GHO (VWDGR \ ODV SRVLELOLGDGHV GH
H[SUHVLyQFLXGDGDQD(QHVWHVHQWLGRODJHVWLyQ
de los recursos humanos se ha desarrollado en
XQPDUFRJHQHUDOTXHPXHVWUDODVVLJXLHQWHVSDUticularidades:
‡$XVHQFLDGHOUHFXUVRKXPDQRHQODFRQGXFción de los procesos de cambio.
‡,QDGHFXDGDGLVWULEXFLyQHQHOKRVSLWDOVREUH
OD EDVH GH XQD RUJDQL]DFLyQ \ GLYLVLyQ GHO
trabajo fragmentada en función de la oferta
y organizada según las posibilidades de traEDMRGHOPHGLFRDVLVWHQFLDOTXHFRQYLYHFRQ
el trabajo liberal.
‡,QÀXHQFLDH[DJHUDGDGHOFULWHULRSURIHVLRQDO
HQ SDUWLFXODU PpGLFR HQ HO IXQFLRQDPLHQWR
GHOKRVSLWDOORTXHFRQGLFLRQDTXHFDGDSURfesional trabaje sobre la base de los conocimientos propios de su especialidad y desaUUROOHXQWUDEDMRGHDOWDFRPSOHMLGDGGLItFLO
GHVHUVXSHUYLVDGR\SURWRFROL]DGRFRQDOWR
grado de autonomía de los profesionales con
UHODFLyQDOSURFHVRSURGXFWLYR
‡ &RQGLFLRQHV MXUtGLFDV SDUD OD JHVWLyQ DGPLQLVWUDWLYD¿QDQFLHUD\GHUHFXUVRVKXPDQRV
UtJLGDV JHQHUDGDV IXHUD GHO KRVSLWDO \ SRU
WDQWRVLQFRQWUROSRUSDUWHGHOJHUHQWH
‡([FHVLYDFHQWUDOL]DFLyQGHODVGHFLVLRQHVHQ
materia de recursos humanos.
‡ 6LVWHPD LQFDSD] GH FRPSHWLU \ FRQ VHSDUDción total entre rendimiento en el puesto de
trabajo y retribución.
‡'pELOFRQWUROVRFLDOVREUHHOVHUYLFLRGHVDOXG
y la relación directa paciente-profesional de
la salud.
(O UHWR DFWXDO TXH DIURQWDQ ORV JHUHQWHV HV
DGPLQLVWUDUORVYDORUHV\ODVFDSDFLGDGHVGHODV
SHUVRQDV\DGDSWDUORVDODVH[LJHQFLDVGHODGHPDQGD HQ XQ FOLPD RUJDQL]DWLYR IDYRUDEOH (Q
HOFDVRGHOKRVSLWDOODJHVWLyQGHEHUHVSRQGHUD
XQDYLVLyQGHVHUYLFLRVRULHQWDGRVDLQWHUDFWXDU
con el usuario en la medida de lo posible.
La gestión global e integral de los recursos huPDQRVHVWiLQWHJUDGDSRUORVHOHPHQWRVTXHDSDUHFHQHQOD)LJXUDHQODTXHVHRIUHFHDGHPiV
XQDYLVLyQJHQHUDOGHODPXOWLSOLFLGDGGHDVSHFWRV
TXHVHGHEHQDERUGDUHQXQKRVSLWDO(VWDIXQFLyQ
H[LJHODDSOLFDFLyQGHFRQRFLPLHQWRVWpFQLFDVH
instrumentos y su aplicación abarca los campos
GHODSODQL¿FDFLyQ\ODSROtWLFDODGH¿QLFLyQ\HO
mantenimiento contingente de recursos humanos
VWDI¿QJODJHVWLyQGHOGHVHPSHxRODDGPLQLVWUDción del personal y la gestión de las relaciones de
WUDEDMRDVtFRPRODHGXFDFLyQGHOSHUVRQDO\HO
desarrollo de la capacidad de trabajo.
La política institucional de recursos humanos
se relaciona directamente con la política de deVDUUROORGHOKRVSLWDO\HQHVWHVHQWLGRHVWiVXERUGLQDGDDODRULHQWDFLyQTXHpVWHVHSURSRQJD\TXH
sólo podrá seguir si cuenta con recursos humanos
FDSDFHV\FRQYHQFLGRVGHDOFDQ]DUORVREMHWLYRV
SURSXHVWRV/DGH¿QLFLyQGHXQDSROtWLFDVHUH¿HUHDWRGDVODVGHFLVLRQHV\DFFLRQHVTXHLQÀX\HQ
HQODIRUPDGHVHOHFFLRQDUFRQWUDWDUGLVWULEXLU\
gestionar los recursos humanos de la institución.
$OGLVHxDUODVHGHEHUHDOL]DUXQDQiOLVLVHVWUDWpJLFRGHOOXJDUTXHRFXSDQHQHOKRVSLWDOVXVDFWRUHVDVtFRPRGHORVGHWHUPLQDQWHVH[WHUQRVGHOD
JHVWLyQGHUHFXUVRVKXPDQRV$OJXQDViUHDVTXH
tienen una clara incidencia en la gerencia de perVRQDOVRQODLQÀXHQFLDGHORVSURSLRVHPSOHDGRV
y trabajadores en las decisiones de personal –deOLPLWDGDSRUODVOH\HVORVHVWDWXWRV\ORVFRQWUDWRV
FROHFWLYRV±ODVIRUPDVGHWUDEDMR±TXHLQFOX\HQ
normas disciplinarias y el ejercicio adecuado de
GHUHFKRV±ODVUHPXQHUDFLRQHVHQHOFRQWH[WROHJDO\GHQWURGHODRUJDQL]DFLyQ\HOÀXMRLQWHUQR
GHLQJUHVRVSURPRFLRQHV\GHVSLGRV PERFILES PROFESIONALES
&RPR VH PHQFLRQy DQWHULRUPHQWH ORV SHU¿OHV
SURIHVLRQDOHV \ RFXSDFLRQDOHV UHTXHULGRV DO
PDUJHQGHTXHVHUH¿HUDQDLQGLYLGXRVRHPSUHVDV VHEDVDQHQODYLVLyQLQVWLWXFLRQDO\ODPLVLyQGHFDGDVHUYLFLR\GHSDUWDPHQWRDVtFRPR
HQORVSURGXFWRVFRQTXHVHSUHWHQGHREWHQHUORV
7DPELpQHVQHFHVDULRHVSHFL¿FDUODVFRPSHWHQFLDVGHORVUHFXUVRVKXPDQRVSXHVHOORSHUPLWH
FODUL¿FDU ORV UHTXLVLWRV TXH GHEH UHXQLU HO UHVponsable de desempeñar determinadas funcioQHV3RUDxDGLGXUDHVWHQLYHOGHGH¿QLFLyQID-
272 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
FLOLWDODHYDOXDFLyQGHOGHVHPSHxRGHHVHJUXSR
de recursos humanos.
&RQVWDDOPHQRVGHORVVLJXLHQWHVHOHPHQWRV
TXHGHEHQVHUGH¿QLGRVFRQFODULGDG
‡'HQRPLQDFLyQ¢&XiOHVODRFXSDFLyQIXQGDPHQWDOTXHWHQGUiHOWUDEDMDGRURODHPSUHVD
TXHVHFRQWUDWH"
‡ 'HSHQGHQFLD ¢&XiO HV OD OtQHD MHUiUTXLFD D
ODTXHUHVSRQGHHOWUDEDMDGRUODSUHQVD\ODV
SHUVRQDVFRQTXHVHFRRUGLQDSDUDWUDEDMDU"
‡'HVFULSFLyQGHFRPSHWHQFLDVQHFHVDULDVSDUD
HO GHVHPSHxR GH ODV IXQFLRQHV IRUPDFLyQ
SURIHVLRQDOLQGLYLGXDORGHHTXLSRH[SHULHQFLDHQWHPDVHVSHFt¿FRVGHVFULSFLyQFRQFLVD
GHIXQFLRQHV
‡'HVFULSFLyQGHSURGXFWRVTXHVHHVSHUDQGH
su trabajo
Para dotar de personal al hospital se dispone
GH YDULDV WpFQLFDV (Q JHQHUDO VH HVWLPD OD
dedicación profesional y no profesional en
KRUDVGHDFXHUGRFRQODGHPDQGD\ODSURGXFWLYLGDGGHODVGLIHUHQWHVXQLGDGHVRSHUDcionales de la institución. A pesar de las duGDVTXHH[LVWHQHQFXDQWRDODDSOLFDFLyQGH
QRUPDVGHGRWDFLyQHVLPSRUWDQWHVXEUD\DU
OD QHFHVLGDG GH GH¿QLU HQ HO KRVSLWDO \ FRQ
DUUHJORDVXVSHFXOLDULGDGHVXQUHIHUHQWHTXH
SHUPLWD HYDOXDU OD HVWUXFWXUD \ HO YROXPHQ
del personal.
‡ 6HUYLFLR LGHDO VXHOH EDVDUVH HQ LQGLFDGRUHV
ySWLPRV TXH VLUYHQ FRPR UHIHUHQWHV D ODUJR
SOD]R\SHUPLWHQUHDOL]DUDQiOLVLVGHDYDQFHV
‡3ROtWLFDLQVWLWXFLRQDOVHGH¿QHVHJ~QLQYHVWLJDFLRQHVGHSURGXFWLYLGDGEXHQDVSUiFWLFDV
JHUHQFLDOHV \ RSLQLRQHV GH H[SHUWRV HQ ORV
QLYHOHV GHVHDEOHV GH FRPSRVLFLyQ \ GLVWULbución del personal respecto del patrón de
VHUYLFLRVRIHUWDGRV
‡ (VWiQGDU PtQLPR DTXHOODV QHFHVLGDGHV Ptnimas para el funcionamiento de la institución.
‡ 1RUPD GH EXHQD SUiFWLFD VRQ ~WLOHV SDUD KDcer comparaciones y establecer referencias
benchmarking TXHFDPELDQFRQVWDQWHPHQWH
El establecimiento y el control de la compoVLFLyQGHOHTXLSRKXPDQRGHOKRVSLWDOHVXQD
WDUHDSHUPDQHQWHTXHGHEHSHUPLWLUKDFHUORV
DMXVWHVSHUWLQHQWHV3DUDHOORHV~WLOIRUPXlarse las siguientes preguntas:
‡ ¢6RQ FRUUHFWRV HO Q~PHUR \ OD FRPSRVLFLyQ
del personal actual?
‡¢4XpPRGL¿FDFLRQHVGHEHQKDFHUVHSDUDUHVponder a las demandas de la población adscrita al hospital?
‡¢4XpHVWUDWHJLDVJHUHQFLDOHVSXHGHQPHMRUDU
la organización y desempeño del recurso humano?
‡¢4XpLPSDFWRHQODFRPSRVLFLyQGHSHUVRQDO
SRGUtDWHQHUODLQQRYDFLyQWHFQROyJLFD"
'H¿QLGRVODFRPSRVLFLyQGHOHTXLSRKXPDQRGHOKRVSLWDO\ORVSHU¿OHVTXHVHEXVFDQVH
SXHGH SURFHGHU D OD VHOHFFLyQ FRQWUDWDFLyQ H
LQFRUSRUDFLyQGHOSHUVRQDOHQVXQXHYDIXQFLyQ
La selección del personal permite concretar la
elección adecuada de empleados para el hospital
FRQ HO ¿Q GH FRPSOHPHQWDU OD RIHUWD LQVWLWXFLRQDOGHVHUYLFLRVGHVDOXG3DUDOOHYDUODDFDERVH
KDEUiGHGHFLGLUTXpRSFLyQHVODPiVDGHFXDGD
VHOHFFLyQ LQWHUQD VHOHFFLyQ H[WHUQD R ELHQ OD
FRPSUDGHVHUYLFLRVDWHUFHURV3RURWUDSDUWHOD
selección puede efectuarse utilizando distintos
PHFDQLVPRVFDOL¿FDFLyQSRUODQRUPDWLYDYLJHQWHHQHOSDtV FROHJLRVSURIHVLRQDOHVLQVWLWXFLRQHV
S~EOLFDV YDORUDFLyQGHKRMDVGHYLGDRSRVLFLRQHVYDORUDFLyQFXDQWLWDWLYDGHODVVROLFLWXGHVGH
WUDEDMRHQWUHYLVWDVLQGLYLGXDOHVHWF
La selección es en muchos países una tarea
TXHFRUUHDFDUJRGHORVJUHPLRVSURIHVLRQDOHV
\TXHVHUHDOL]DFRQPX\SRFRRQLQJ~QFRQWURO
SRUSDUWHGHORVGLUHFWLYRVGHORVKRVSLWDOHV(VWR
GDRULJHQDGL¿FXOWDGHVDGLFLRQDOHV\FRQVWLWX\H
VLQOXJDUDGXGDVXQDVSHFWRTXHGHEHUiPRGL¿carse a mediano plazo mediante un serio proceso de negociación.
GESTIÓN DEL DESEMPEÑO
/DJHVWLyQGHOGHVHPSHxRSRUVXSDUWHHVODFDSDFLGDGGHPRYLOL]DUYROXQWDGHVFRPSHWHQFLDV\
YDORUHV HQ IXQFLyQ GH UHVXOWDGRV LQVWLWXFLRQDOHV
SHUVRQDOHV\GHVHUYLFLRDODFRPXQLGDG/DJHVWLyQGHOGHVHPSHxRGHXQDEXURFUDFLDSURIHVLRQDO
FRPRODTXHFDUDFWHUL]DDOKRVSLWDOH[LJHUHDOL]DU
un importante esfuerzo de normalización de habilidades y conocimientos en la asistencia directa.
Esta línea de acción corresponde a la denominada
gestión clínica (véase el capítulo respectivo en esta
obra) WpFQLFD JHUHQFLDO DSOLFDGD HQ RUJDQL]DFLRQHVGHVDOXGTXHSDUWHGHSURFHVRVSDUWLFLSDWLYRV
GHSURWRFROL]DFLyQE~VTXHGDGHFRQVHQVR\QXHYDVIRUPDVGHFRPXQLFDFLyQLQWHUQDTXHSHUPLWHQ
GLVPLQXLU OD YDULDELOLGDG GH OD SUiFWLFD FOtQLFD \
establecer por consenso las prestaciones.
10 - Gestión de recursos humanos e incentivos en la organización de Salud / 273
&RQUHVSHFWRDODHYDOXDFLyQGHOGHVHPSHxR
FDEH GHFLU DGHPiV TXH OD HODERUDFLyQ \ DSOLcación de una propuesta de este tipo es una taUHDWpFQLFDTXHGHEHSDUWLUGHODVFRPSHWHQFLDV
FRQMXQWR GH KDELOLGDGHV FDSDFLGDGHV FRQRFLPLHQWRV SDWURQHV GH FRPSRUWDPLHQWR \ FODVHV
GHDFWLWXGTXHGH¿QHQXQGHVHPSHxRVXSHULRU\
UHVROXWLYRIUHQWHDGHWHUPLQDGRSUREOHPD SDUD
desarrollar acciones concretas en el trabajo indiYLGXDO \ FROHFWLYR TXH OD LQVWLWXFLyQ KD\D FRQVLGHUDGRQHFHVDULDVSDUDDOFDQ]DUVXVREMHWLYRV
de producción. La traducción de estas compeWHQFLDV\SURGXFWRVDLQGLFDGRUHVFXDOLWDWLYRV\
FXDQWLWDWLYRVFRQFUHWRVODGH¿QLFLyQGHWpFQLFDV
SDUD REWHQHU VLVWHPiWLFDPHQWH LQIRUPDFLyQ OD
LPSODQWDFLyQGHXQVLVWHPDGHLQIRUPDFLyQTXH
UHJLVWUHODVPHGLFLRQHV\SURFHVHORVUHVXOWDGRV
la disponibilidad de los mecanismos para hacer
YDORUDFLRQHV¿QDOHV LQGLYLGXDOHV\FROHFWLYDV \
VXUHODFLyQFRQORVVLVWHPDVGHSDJRHLQFHQWLYR
VRQDOJXQDVGHODVWDUHDVGHOHTXLSRUHVSRQVDEOH
de la gestión de recursos humanos del hospital.
7DQWRSDUDGLVHxDUXQQXHYRVLVWHPDGHHYDOXDFLyQGHOGHVHPSHxRFRPRSDUDYDORUDUVLVWHmas en aplicación puede se útil responder a las
siguientes preguntas:
‡¢([LVWHDOJ~QPHFDQLVPRGHJHVWLyQGHOGHVHPSHxRTXHVHHVWpXWLOL]DQGRHQODLQVWLWXFLyQ"
‡¢(VWRVPHFDQLVPRVVHEDVDQHQVXSHUYLVLyQ
HYDOXDFLyQUHFRPSHQVDKDELOLGDGHV\FRPpetencias o disciplina?
‡ ¢)RUPDQ SDUWH WRGRV HVWRV PHFDQLVPRV GH
una propuesta de gestión del desempeño o se
SULYLOHJLDDOJXQRGHHOORV"
‡ ¢&yPR SHUFLEHQ ORV GLIHUHQWHV QLYHOHV GHO
hospital los aspectos de gestión del desemSHxR" ¢VH XWLOL]D HVWD JHVWLyQ FRPR KHUUDmienta gerencial?
‡ ¢6H UHODFLRQD OD HYDOXDFLyQ GHO GHVHPSHxR
FRQODUHQGLFLyQGHFXHQWDV accountability GHO KRVSLWDO FDUUHUD DVLJQDFLyQ GH SXHVWRV
de más responsabilidad?
‡¢&XiOHVVRQORVFULWHULRVUHTXLVLWRV\SURFHGLPLHQWRVQHFHVDULRVSDUDDFUHGLWDUODH[SHULHQFLDSURIHVLRQDOTXHVHDSOLFDQHQHOKRVSLWDO"
‡ ¢4Xp UHTXLVLWRV H[WHUQRV GHEHQ FXPSOLU ORV
PLHPEURVGHORVHTXLSRVGHWUDEDMRSDUDVX
GHVHPSHxR VREUHWRGRORVJUXSRVGHSURIHVLRQDOHV "
‡ ¢&XiQ HIHFWLYRV VRQ ORV UHTXLVLWRV H[WHUQRV
SDUDLGHQWL¿FDUSURIHVLRQDOHVGHEDMRUHQGLmiento?
‡ ¢&XiOHV VRQ ODV RSRUWXQLGDGHV \ DPHQD]DV
TXHVHGHULYDQGHODVSROtWLFDVQDFLRQDOHVH
institucionales sobre gestión del recurso humano?
‡/DVQXHYDVIRUPDVGHFRQWUDWDFLyQ¢SHUPLWLUiQHOHYDUHOQLYHOGHGHVHPSHxR"
Motivación
8QRGHORVHOHPHQWRVFODYHSDUDODJHVWLyQGHO
GHVHPSHxR HV OD PRWLYDFLyQ GH¿QLGD FRPR OD
IRUPDHQODTXHHOLQGLYLGXRVHUHODFLRQDFRQVX
trabajo. Esta idea cobró interés en salud pública
FXDQGRVHKL]RXQDFUHHQFLDFRP~QGHTXHJUDQ
SDUWH GH OD LQH¿FLHQFLD HQ OD RUJDQL]DFLyQ GHO
trabajo era causada por la falta de motivación
DXVHQWLVPRODERUDOLPSXQWXDOLGDGSpUGLGDGH
DUPRQtD\EDMDSURGXFFLyQ 3HURQRVHWUDWDDO
SDUHFHUGHXQWHPDWDQVLPSOH\DTXHHQHVHQFLD
HVXQDGLPHQVLyQLQWHUQDGHOLQGLYLGXRVyORYHUL¿FDEOHFXDQGRpVWHDFW~DPDQLIHVWiQGRVHSRU
ODVDFFLRQHVLQGLYLGXDOHV
/DV WHRUtDV VREUH OD PRWLYDFLyQ VH GHVDUUROODURQ D SDUWLU GH OD YLVLyQ GH WUHV iUHDV GH LQTXLHWXG HV GHFLU ORV PRWLYRV TXH OOHYDQ D XQ
LQGLYLGXRDSURFHGHUGHXQDIRUPD\QRGHRWUD
Éstas son:
‡ÈUHDGHODVQHFHVLGDGHVSDUWHGHODSUHPLVD
GHTXHHQHOVHUKXPDQRHVODQHFHVLGDGLQVDWLVIHFKDORTXHLQGXFHDEXVFDUHQVXWUDEDMR
la forma de compensación o realización. Por
HOOR SDUD TXH HO SHUVRQDO HVWp PRWLYDGR \
UHDOLFHVXWDUHDFRQPD\RUH¿FLHQFLDQHFHsita de una atención constante de sus necesiGDGHVSHUVRQDOHV\SURIHVLRQDOHVWDQWRHQVX
IRUPDJUXSDOFRPRLQGLYLGXDO\WHQLHQGRHQ
FXHQWD ODV YDULDFLRQHV SRU IDFWRUHV VRFLDOHV
y culturales.
‡ÈUHDGHODVH[SHFWDWLYDVSDUWHGHODSUHPLVD
GH TXH OR TXH KDFH D XQ LQGLYLGXR WUDEDMDU
QRHVDOJRTXHHVWiHQVXSDVDGRRHQVXSUHVHQWHVLQRPiVVLPSOHPHQWHHQXQREMHWLYR
IXWXUR7UDWDGHLQWHJUDUDOPi[LPRSRVLEOH
ORV LQWHUHVHV LQGLYLGXDOHV FRQ ORV LQWHUHVHV
GH ODV WDUHDV \ VH YLQFXOD HQ OD DGPLQLVWUDción sanitaria con la gestión por objetivos
\D TXH HQ HO SURFHVR GH GH¿QLFLyQ GH ORV
REMHWLYRVGHXQDLQVWLWXFLyQGHVDOXGGHEHUtD
KDEHU PDUJHQ SDUD LQFRUSRUDU ORV LQWHUHVHV
H[SHFWDWLYDV H LQWHQFLRQHV LQGLYLGXDOHV HQ
ODVWDUHDVDGHVHPSHxDU6HVRVWLHQHTXHD ORV LQGLYLGXRV GLULJHQ VX FRPSRUWDPLHQWR
FRQ YLVWDV D DOFDQ]DU UHVXOWDGRV TXH MX]JDQ
274 / ADMINISTRACIÓN HOSPITALARIA / Lemus - Aragües - Lucioni
VHU ORV PiV DWUDFWLYRV SRU OR TXH OD PD\RU
PRWLYDFLyQSDUDHOWUDEDMRHVWDUiYLQFXODGDD
la capacidad de la organización de satisfacer
ODVH[SHFWDWLYDVLQGLYLGXDOHVE ORVLQFHQWLYRV LQÀXHQFLDQ OD PRWLYDFLyQ VRODPHQWH HQ
OD PHGLGD TXH ODV LQWHQFLRQHV GH ORV LQGLYLGXRV VHDQ SDUD OD DFFLyQ \ F OD JHVWLyQ
SDUWLFLSDWLYDFRQHOSHUVRQDOHQOD¿MDFLyQGH
REMHWLYRVHVSHFt¿FRVHVXQEXHQLQVWUXPHQWR
SDUDPHMRUDUODPRWLYDFLyQ\HOGHVHPSHxR
‡ÈUHDGHODSUHQGL]DMHVRFLDO\ORVLQFHQWLYRV
SDUWHGHODSUHPLVDGHTXHORVFRPSRUWDPLHQWRV KXPDQRV VH EDVDQ HQ LQFHQWLYRV (véase
más adelante)HQHVHVHQWLGRHQWRQFHVSDUD
RULHQWDU HO FRPSRUWDPLHQWR HV QHFHVDULR
FUHDUHVWtPXORVRLQFHQWLYRVSDUDTXHODSHUVRQDVHGLULMDKDFLDXQ¿QGHVHDGR
1RREVWDQWHORDQWHGLFKRHQXQHQWRUQRGHVDODULRVLQFHUWLGXPEUHSDUDHOGHVDUUROORGHODFDUUHUD SURIHVLRQDO PtQLPD R QLQJXQD UHFRPSHQVD DO
EXHQGHVHPSHxR\VXSHUYLVLyQSXQLWLYDDQWHVTXH
DSR\RHOp[LWRTXHSXHGHHVSHUDUVHGHODVPRGDOLGDGHVGHPRWLYDFLyQHVDPHQXGRHVFDVR(QORV
SDtVHVGHOD5HJLyQORVSURFHVRVGHUHIRUPDKDQ
FRPHQ]DGR SRU DXPHQWDU ODV H[LJHQFLDV GH SURGXFWLYLGDGGHORVUHFXUVRVKXPDQRVVLQPRGL¿FDU
VXVFRQGLFLRQHVGHWUDEDMR VDODULRVUHFRPSHQVDV
HVWtPXORVSRVLELOLGDGHVGHGHVDUUROORLQGLYLGXDO\
SURIHVLRQDO QLSUHSDUDUORVSDUDPHMRUDUVXGHVHPSHxR\ODFDOLGDGGHORVVHUYLFLRV
/RVIDFWRUHVGHPRWLYDFLyQLQGLYLGXDOVHUHODcionan directamente con la satisfacción de las neFHVLGDGHVLQGLYLGXDOHV\VLELHQHOWUDEDMRSXHGH
VDWLVIDFHUPXFKDVGHODVQHFHVLGDGHVGHOLQGLYLGXRFRUUHVSRQGHDFDGDRUJDQL]DFLyQLGHQWL¿FDU
ORVIDFWRUHVTXHHVWLPXODQ\GHVPRWLYDQDODVSHUVRQDVXQDVSHFWRPX\YLQFXODGRFRQODGLQiPLFD
JHUHQFLDOGHODLQVWLWXFLyQ\SRUVXSXHVWRFRQHO
PDUFRJOREDOGHFDGDSDtV/DPRWLYDFLyQHVXQ
HOHPHQWRFUtWLFRSDUDHOp[LWRGHODRUJDQL]DFLyQ
VLELHQQRHVHO~QLFRSDUDDVHJXUDUXQDOWRQLYHO
GH GHVHPSHxR pVWH VH ORJUD HQ XQ FRQWH[WR GH
DPSOLDSDUWLFLSDFLyQ\DXWRUUHJXODFLyQLQGLYLGXDO
\GHJUXSRRULHQWDGRVKDFLDODFDOLGDG\ODWUDVFHQGHQFLDGHSUHVWDUVHUYLFLRVDODFRPXQLGDG
FORMAS DE COMPENSACIÓN E INCENTIVOS
7UDGLFLRQDOPHQWH OD FRPSRVLFLyQ VDODULDO VH
HVWDEOHFHFRQDUUHJORDODVVLJXLHQWHVYDULDEOHV
SROtWLFDVDODULDOGHODHPSUHVDFDSDFLGDG¿QDQ-
FLHUD\GHGHVHPSHxRGHODPLVPDVLWXDFLyQGHO
PHUFDGRGHWUDEDMRFR\XQWXUDHFRQyPLFD LQÀDFLyQFRVWDGHODYLGDHWF FRQGLFLRQDQWHVHQOD
QHJRFLDFLyQFROHFWLYD\UHJODPHQWDFLyQGHRUJDQL]DFLRQHV SURIHVLRQDOHV \ OHJLVODFLyQ ODERUDO
(QJHQHUDOORVVDODULRVGHODViUHDVGHVDOXGGH
los distintos países de la Región han puesto de
PDQL¿HVWRXQGHWHULRUR\DTXHODVGHFLVLRQHVGH
los montos salariales dependen por lo general de
GLVSRVLFLRQHVHVWDWDOHVHQODVTXHHOHQFDUJDGR
gerente de recursos humanos no se inmiscuye.
([LVWHQWUHVIRUPDVEiVLFDVGHUHPXQHUDFLyQ
3ULPHURSRUWLHPSRHQODTXHQRVHDFRVWXPEUD
a controlar la calidad de la producción y el pago
HV ¿MR 6HJXQGR SRU UHVXOWDGR JHQHUDOPHQWH
asociada con la calidad de la producción y en la
TXH HO SDJR HV YDULDEOH < WHUFHUR PL[WD TXH
consiste en una combinación de las dos anterioUHVHVWRHVXQSDJR¿MR\RWUDIUDFFLyQYDULDEOH
relacionada con el desempeño.
(QODDFWXDOLGDGDGHPiVGHODVIRUPDVGHUHPXQHUDFLyQ\FRQWUDWDFLyQYLJHQWHVSRUODOH\\
HQHOPDUFRGHXQDWHQGHQFLDGHÀH[LELOL]DFLyQ
GHODVFRQGLFLRQHVGHWUDEDMRVHKDQLQFRUSRUDGRQXHYDVIRUPDVGHUHWULEXFLyQ\FRQWUDWDFLyQ
Se describen las siguientes formas de contrato y
pago en salud:
‡6DODULR¿MRSRUWLHPSR¿MRSRUORJHQHUDOEDMR
UHJtPHQHVMXUtGLFRV~QLFRVTXHLQFOX\HQORV
VHUYLFLRVFLYLOHVFRQFDUJRVGHFRQ¿DQ]DROLEUHUHPRFLyQQRPEUDPLHQWRVFRQWUDWRVSRU
WLHPSR¿MR\ODFRQWUDWDFLyQFROHFWLYD
‡3DJRGLUHFWRGHKRQRUDULRVOLEUHPHQWHQHJRFLDGRVHQWUHSURYHHGRU SURIHVLRQDO \FOLHQWH SDFLHQWH VLQ LQWHUYHQFLyQ GH XQ WHUFHU
pagador
‡ 3DJR SRU WDEOD GH YDORUHV SUHHVWDEOHFLGRV SRU
WHUFHURV FRUSRUDFLRQHVSURIHVLRQDOHVVHJXURV
‡ 3DJR SRU FDVR UHVXHOWR LQGHSHQGLHQWH GHO
Q~PHUR GH H[iPHQHV YLVLWDV R DFWRV PpGLcos realizados
‡ 3DJRSRUFDSLWDFLyQ
‡ 6DODULRPL[WRFRPSXHVWRSRUXQDSDUWH¿MD
SRU WLHPSR \ XQD SDUWH YDULDEOH SRU UHQGLmiento o por procedimiento realizado
‡ 3DJR GH UHPXQHUDFLyQ YDULDEOH HQ IXQFLyQ
GHOYROXPHQ\ODFDOLGDGGHDFWRV\SURFHGLmientos
‡ 3DJR D WHUFHURV PRGDOLGDG DOWHUQDWLYD GH
FRQWUDWRGHJUXSRVGHSURIHVLRQDOHVHPSUHsas u otras organizaciones para desarrollar
DFWLYLGDGHVHVSHFt¿FDV
10 - Gestión de recursos humanos e incentivos en la organización de Salud / 275
‡ %ROVDVGHWUDEDMRJHQHUDOPHQWHGHVWLQDGDVD en el marco de distintas formas de pago o comSHQVDFLyQVDODULDOTXHMXQWRFRQODUHPXQHUDFLyQ
pasantes en formación.
EDVH VDODULRVXHOGR \ORVEHQH¿FLRVTXHLQFOX\H
/DV WHQGHQFLDV DFWXDOHV SDUHFHQ SULYLOHJLDU HODFXHUGRRFRQWUDWRODERUDOFRQIRUPDQODFRPODHVWUXFWXUDFLyQGHXQVLVWHPDGHSDJRVPL[WR SHQVDFLyQ R UHWULEXFLyQ TXH UHFLEH HO HPSOHDGR
TXH LQFRUSRUD XQD IUDFFLyQ ¿MD \ RWUD YDULDEOH SRUVXWUDEDMR(QXQDFODVL¿FDFLyQPX\JHQHUDO
DVRFLDGD FRQ OD SURGXFWLYLGDG LQGLYLGXDO R FR- ORVLQFHQWLYRVSXHGHQVHU¿QDQFLHURV\QR¿QDQOHFWLYD/DVGLIHUHQWHV¿JXUDVGHFRQWUDWDFLyQ\ FLHURV \ ORV HIHFWRV TXH OD XWLOL]DFLyQ GH XQRV
SDJR GHEHUiQ GH¿QLUVH HQ HO PDUFR GH OD SROt- XRWURVJHQHUDFRUUHVSRQGHQWDQWRDOQLYHOGHOD
tica institucional de recursos humanos. En este SURGXFWLYLGDG \ HO UHQGLPLHQWR LQGLYLGXDO \ GH
marco de multiplicidad de mecanismos de pago JUXSRVGHWUDEDMRFRPRGHOGHVHPSHxRJOREDOGH
HVHVHQFLDOLGHQWL¿FDUORVFRPSRUWDPLHQWRVTXH ODVLQVWLWXFLRQHVGHVDOXG'HDFXHUGRD/HYLWW\
estos mecanismos inducen en el recurso huma- 'XEQHUXQLQFHQWLYRHV³XQDEDODXQDSDODQFD
QR SRUHMHPSORVLHOSDJRHVSRUSUHVWDFLyQVH XQDOODYHXQREMHWRSHTXHxRFRQXQHQRUPHSRWLHQGHDDXPHQWDUHOQ~PHURDXQTXHHVWRDWHQWH GHUSDUDFDPELDUXQDVLWXDFLyQ«´5 Aprendemos
FRQWUDODFDOLGDG 6HJ~QORVGLIHUHQWHVHQIRTXHV WHPSUDQDPHQWH HQ QXHVWUDV YLGDV D UHVSRQGHU D
GHODVWHRUtDVGHPRWLYDFLyQHOHIHFWRPRWLYDGRU LQFHQWLYRV VHDQ H
Descargar
Fichas aleatorios
tarjeta del programa pfizer norvasc

0 Tarjetas joseyepezsumino

tarjeta del programa pfizer norvasc

0 Tarjetas joseyepezsumino

notas de enfermeria

0 Tarjetas Karen LCHB

free fire garena

1 Tarjetas Rene Jonathan Ramos Reyes

sistemas educativos

17 Tarjetas Lizbet Sánchez Licea

Crear fichas