ESCUELA POLITÉCNICA NACIONAL
FACULTAD DE INGENIERÍA MECÁNICA
ANÁLISIS ESTRUCTURAL A CARGAS DE IMPACTO FRONTAL
DE UN BUS TIPO INTERPROVINCIAL MEDIANTE EL MÉTODO DE
ELEMENTOS FINITOS
TESIS PREVIA A LA OBTENCIÓN DEL GRADO DE MÁSTER (MSc) EN
DISEÑO PRODUCCIÓN Y AUTOMATIZACIÓN
MANJARRÉS ARIAS FÉLIX JAVIER
[email protected]
SANTILLÁN MARIÑO ERNESTO RAMIRO
[email protected]
DIRECTOR: ING. WILLIAM R. VENEGAS T, MSc.
[email protected]
CODIRECTOR: ING. RICARDO SOTO A, MSc.
[email protected]
Quito, Julio 2016
i
DECLARACIÓN
Nosotros, Félix Javier Manjarrés Arias y Ernesto Ramiro Santillán Mariño, declaramos
que el trabajo aquí descrito es de nuestra autoría, que no ha sido previamente
SUHVHQWDGRSDUDQLQJ~QJUDGRRFDOL¿FDFLyQSURIHVLRQDO\TXHVHKDFRQVXOWDGRODV
UHIHUHQFLDVELEOLRJUi¿FDVTXHVHLQFOX\HQHQHVWHGRFXPHQWR
La Escuela Politécnica Nacional puede hacer uso de los derechos correspondientes
a este trabajo, según lo establecido por la Ley de Propiedad Intelectual, por su
5HJODPHQWR\SRUODQRUPDWLYLGDGLQVWLWXFLRQDOYLJHQWH
Félix Javier Manjarrés Arias
Ernesto Ramiro Santillán Mariño
ii
CERTIFICACIÓN
&HUWL¿FRTXHHOSUHVHQWHWUDEDMRIXHGHVDUUROODGRSRU)pOL[-DYLHU0DQMDUUpV$ULDV\
(UQHVWR5DPLUR6DQWLOOiQ0DULxREDMRPLVXSHUYLVLyQ
ING. WILLIAM VENEGAS T, MSc.
DIRECTOR DE PROYECTO
ING. RICARDO SOTO AYMAR, MSc.
CODIRECTOR DE
PROYECTO
iii
AGRADECIMIENTOS
Agradezco a DIOS por la vida y posibilidad de aprender más, a nuestro Director
GH WHVLV ,QJ :LOOLDP 9HQHJDV DO ,QJ 5LFDUGR 6RWR$\PDU 06F &RGLUHFWRU GHO
SUR\HFWRDPLDPLJR5DPLUR\DWRGRVTXLHQHVFRQWULEX\HURQGHXQDIRUPDXRWUD
SDUDODUHDOL]DFLyQ\¿QDOL]DFLyQGHHVWHWUDEDMR
Félix Javier Manjarrés Arias
$O OQJ :LOOOLDP 5 9HQHJDV7 06F H OQJ 5LFDUGR 6RWR$ 06F SURIHVRUHV GH OD
Facultad de Mecánica, por sus conocimientos, guía y apoyo durante el desarrollo
GHOSUHVHQWHWUDEDMRGHLQYHVWLJDFLyQ
$PLVSDGUHVSRUVXFRPSUHQVLyQ\DSR\RHQORVPRPHQWRVPiVGLItFLOHV
A mi amigo y compañero de tesis FÉLIX sin quien no hubiese llegado a culminar
FRQp[LWRHVWDQXHYDPHWD\GHTXLHQKHDSUHQGLGRPXFKR
A todas y cada una de las personas que me ayudaron en algún momento en esta
H[SHULHQFLD
4XH',26OHVEHQGLJD
Ernesto Ramiro Santillán Mariño
iv
DEDICATORIAS
$PLPDGUHD.DWW\0LJXHO$DUyQ\-DYLHU
Félix Javier Manjarrés Arias
'HGLFRHOSUHVHQWHSUR\HFWRGHLQYHVWLJDFLyQD',26\VXLQ¿QLWDRPQLSUHVHQFLDHQ
FDGDSDVRGHPLFDPLQDUSHUVRQDO\SURIHVLRQDOHQHVWDMRUQDGDGHPXFKRHVIXHU]R
GHGLFDFLyQSDFLHQFLDSHUVHYHUDQFLDGLVFLSOLQDVLQVXSUHVHQFLDQRKXELHVHVLGR
SRVLEOHFXOPLQDUFRQp[LWRHOSUHVHQWHSUR\HFWR$PLV3$'5(6HMHPSORFRQVWDQWH
GHVDFUL¿FLRHQWUHJDJXtD\YDORUSRUVXFRQVWDQWHDSR\RHQORVPRPHQWRVFUtWLFRV
Ernesto Ramiro Santillán M.
v
TABLAS DE CONTENIDO
CAPÍTULO I
INTRODUCCIÓN .......................................................................................................1
1.1 EL PROBLEMA ............................................................................................................1
1.2 JUSTIFICACIÓN ..........................................................................................................1
1.3.1 Objetivos general ........................................................................................................2
2EMHWLYRVHVSHFt¿FRV ..................................................................................................2
1.4.GENERALIDADES ..............................................................................................3
1.4.1 La industria carrocera de transporte público en el mundo ................................3
1.4.2 La industria carrocera de transporte público en ecuador ....................................3
1.4.3 Estadística de accidentes de tránsito en buses ..................................................4
1.5 DISEÑO DE ESTRUCTURAS PARA TRANSPORTE PÚBLICO
INTERPROVINCIAL EN ECUADOR .............................................................5
CAPÍTULO II
ESTADO DE LA CIENCIA ........................................................................ 8
2.1 NORMAS INTERNACIONALES .......................................................... 8
2.2 NORMAS PARA EL DISEÑO DE CARROCERÍAS DE TRANSPORTE
PÚBLICO EN ECUADOR ..................................................................................11
2.3 NORMAS DE DISEÑO A IMPACTO ..............................................................11
2.4 TIPOS DE CARROCERÍAS PARA TRANSPORTE PÚBLICO
EN ECUADOR ......................................................................................... 13
2.4.1 Buses Urbanos ..................................................................................... 13
2.4.2 Vehículos de transporte escolar ............................................................... 14
2.4.3 Vehículos de transporte interprovincial e intraprovincial ............................. 15
2.4.4 Vehículos de tres ruedas para transporte de pasajeros ................................. 15
2.5 MATERIALES UTILIZADOS EN CONSTRUCCIONES DE
CARROCERÍAS DE BUSES EN ECUADOR ....................................... 16
2.5.1 Industria carroceras en Ecuador .............................................................. 16
2.5.2 Materiales utilizados para la construcción de carrocerías en Ecuador ............ 16
2.5.3 Acero Galvanizado ............................................................................... 17
2.6. INGENIERÍA ASISTIDA PARA ANÁLISIS DE IMPACTOS
FRONTALES ........................................................................................... 18
2.6.1 LS-DYNA .......................................................................................... 18
2.6.1.1 LS- PREPOST ............................................................................. 21
2.6.1.2 LS - OPT ..................................................................................... 22
2.6.2 ANSYS LS-DYNA............................................................................... 23
2.7 MODELADO MATEMÁTICO ................................................................ 23
2.8 SIMULACIONES PARA ANÁLISIS DE IMPACTOS............................ 25
2.8.1 Construcción del modelo (El pre-proceso) ................................................ 26
2.8.2 Aplicación de las cargas y obtención de resultados (Solver) ........................ 27
vi
2.8.3 Revisión e interpretación de los resultados (Pos proceso) ........................... 27
2.9 EL MÉTODO DEL ELEMENTO FINITO APLICADO A ANÁLISIS DE
IMPACTO ................................................................................................ 28
CAPÍTULO III
ANÁLISIS DE LA CARROCERÍA TIPO DE UN BUS PARA TRANSPORTE INTERPROVINCIAL EN ECUADOR, BAJO LA ACCIÓN DE CARGAS DE IMPACTO FRONTAL ................................................................. 31
3.1 IMPORTACIÓN DE LA GEOMETRÍA AL SOFTWARE ESPECIALIZADO DE ANÁLISIS MECÁNICO COMPUTACIONAL ......................... 31
3.2 VERIFICACIÓN DE LA GEOMETRÍA.................................................. 37
3.3 GENERACIÓN DE LA MALLA PARA ANÁLISIS POR MEF ............. 38
3.3.1 Diseño de la malla para el estudio a cargas de impacto frontal de la
carrocería de un bus tipo interprovincial utilizado en Ecuador .................... 38
3.3.1.1 Shell 163................................................................................... 39
3.4 CONDICIONES DE BORDE DEL ESCENARIO DE SIMULACIÓN .. 41
3.4.1 Preproceso de la simulación ................................................................... 42
3.4.2 Pos proceso de la simulación .................................................................. 46
3.4.2.1 Resultados obtenidos ................................................................... 47
3.4.2.2 Validación del estudio computacional ............................................. 50
3.4.2.3 Estudio en elementos críticos considerando el desplazamiento
direccional en Z ......................................................................... 53
3.4.2.4 Estudio en elementos críticos considerando esfuerzo de Von mises...... 57
3.4.2.5 Estudio en elementos críticos considerando la deformación plástica ....60
CAPÍTULO IV
MODELOS MATEMÁTICOS PARA EL ANÁLISIS DE IMPACTO
FRONTAL .................................................................................................... 69
4.1 MODELOS MATEMÁTICOS ................................................................. 69
4.1.1 Característica de la dinámica explicita ..................................................... 69
4.1.1,1 Formulación básica ...................................................................... 70
4.1.1.2 Estabilidad del paso del tiempo ....................................................... 72
4.1.2 Lagrange explicito ................................................................................ 73
4.1.2.1 Medición del esfuerzo .................................................................... 75
4.1.2.2 Conservación de la masa ............................................................... 76
4.1.2.3 Conservación del momento ............................................................. 76
4.1.2.4 Conservación de la energía ............................................................. 77
4.1.2.5 Ecuaciones constitutivas ................................................................ 77
4.1.2.6 Ecuación del momento en términos del desplazamiento ...................... 78
4.1.2.7 Condiciones de contorno ............................................................... 79
vii
4.1.2.8 Condiciones iniciales ..................................................................... 81
4.1.2.9 Formulación débil para la formulación Lagrangiana total .................... 81
4.1.2.10 Forma Fuerte a la forma débil ........................................................ 82
4.1.2.11 Suavizado en las funciones de prueba y de la evaluación ................... 82
4.1.2.12 Forma débil a la forma fuerte ...................................................... 83
4.1.2.13 Nombres físicos de los términos de trabajo virtuales ......................... 84
4.1.2.14 Principio del trabajo virtual........................................................... 86
4.1.3 Euler Explicito ..................................................................................... 86
4.1.3.1 Ecuaciones que gobiernan la Formulación Euleriana. ......................... 86
4.2 APLICACION DE UN MÉTODO PARA EL ANÁLISIS A
IMPACTO FRONTAL DE UNA CARROCERÍA .................................. 87
4.3 CONTROL DE HOURGLAS PARA LA CONVERGENCIA ................. 94
4.3.1 Modos del control por hourglass ............................................................. 94
4.3.2 Modos para minimizar o evitar el hourglass .............................................. 95
)RUPDVGHFRQWUROGHOKRXUJODVVVWL൵QHVVYHUVXVYLVFRXV ........................... 96
4.3.3.1 Formas viscosas............................................................................ 96
4.3.3.2 Formas rígidas.............................................................................. 97
4.4 IDEALIZACIÓN DEL MODELO ........................................................... 97
4.4.1 Contraste entre cálculo elástico y plástico ................................................ 100
4.4.2 Cálculo en la zona elástica ..................................................................... 103
4.4.3 Cálculo en la zona plástica. .................................................................... 107
4.4.4 Análisis de la barra en régimen plástico ................................................... 109
4.4.5 Cálculo de esfuerzos plásticos ................................................................ 113
4.4.6 Simulación de la barra en LS-DYNA....................................................... 113
CAPÍTULO V
5.1 Conclusiones ............................................................................................ 113
5.2 Recomendaciones .................................................................................... 116
ANEXOS ...................................................................................................... 119
viii
TABLAS DE FIGURAS
Figura 2.1 Bus urbano de Ecuador. ................................................................. 14
Figura 2.2 Transporte escolar de Ecuador. ...................................................... 14
Figura 2.3 Bus interprovincial de Ecuador. .................................................... 15
Figura 2.4 Tricimoto de Ecuador. ................................................................... 15
Figura 2.5 Accidente simulado en LS-DYNA. ............................................... 20
Figura 2.6 Campos de Análisis de LS-DYNA ................................................ 21
Figura 2.7 Ejemplo postproceso LS-DYNA. .................................................. 22
Figura 2.8 Esquema LMS para diseño de nueva estructura. ........................... 24
Figura 2.9 Esquema MEF para diseño de una nueva estructura. .................... 25
Figura 2.10 Esquema estructurado de una análisis de dinámica explícita. ..... 28
)LJXUD3URFHVRSDUDHOXVRGHOPpWRGRGHHOHPHQWRV¿QLWRV .................. 29
Figura 2.12 Simulación de impacto con LS-DYNA. ...................................... 30
Figura 3.1 Planos de la carrocería tipo de un bus interprovincial .................. 31
Figura 3.2 Carrocería tipo de bus interprovincial ........................................... 32
Figura 3.3 Boceto de la estructura del bus en 3D ........................................... 32
Figura 3.4 Detalle de materiales de la carrocería del bus interprovincial ....... 34
Figura 3.5 Acabados en los nodos de la carrocería ......................................... 35
Figura 3.6 Carrocería de bus tipo interprovincial en tres dimensiones........... 36
Figura 3.7 Vista lateral de la cabina del bus tipo interprovincial.................... 36
)LJXUD9HUL¿FDFLyQGHODJHRPHWUtDGHODFDUURFHUtD................................. 37
Figura 3.9 Características del elemento “Shell 163” ...................................... 41
Figura 3.10 Condiciones de borde para el escenario de simulación. .............. 41
Figura 3.11 Cabina de la carrocería, objeto de análisis .................................. 42
Figura 3.12 Cabina ingresada a Mechanical en Workbench LS-Dyna ........... 43
)LJXUD&RQ¿JXUDFLyQGHODFHURJDOYDQL]DGR .......................................... 43
Figura 3.14 Generación de un sistema auxiliar para la generación de la pared
rígida ............................................................................................................... 44
Figura 3.15 Aplicación del criterio de convergencia Jacobiano ..................... 45
)LJXUD*Ui¿FRHVWDGtVWLFRGHODPDOODREWHQLGD ...................................... 45
)LJXUD&RQ¿JXUDFLyQGHFRQGLFLRQHVLQLFLDOHVHQODFDELQD9HORFLGDGGH
impacto............................................................................................................ 45
)LJXUD&RQ¿JXUDFLyQHVWXGLRWLHPSRSURFHVDGRUHVWLSRGH+RXUJODVV 46
Figura 3.19 Detalles del Solver empleado ...................................................... 46
Figura 3.20 Procesamiento de datos en ANSYS APDL.................................. 47
Figura 3.21 Ingreso de datos a LS Prepost 4.2 ............................................... 48
Figura 3.22 Cabina deformada a impacto, obtenido en LS Prepost 4.2.......... 48
Figura 3.23 Resultados de la deformación direccional en el eje z,
obtenidos en LS Prepost 4.2........................................................ 49
Figura 3.24 Resultados del esfuerzo principal de Von Mises, obtenidos en LS
ix
Prepost 4.2....................................................................................................... 49
Figura 3.25 Resultados de la deformación plástica, en LS Prepost 4.2 .......... 50
Figura 3.26 Resultados de energía interna por impacto ................................. 50
Figura 3.27 Resultados del control de reloj de arena por impacto ................. 51
Figura 3.28 Comportamiento de energía interna y control de reloj de arena.. 52
Figura 3.29 Diagrama de energía durante la simulación del impacto en la carrocería tipo de autobús interprovincial .......................................................... 52
Figura 3.30 Elementos seleccionados para obtención de resultados .............. 53
Figura 3.31 Esfuerzo V-M en los elementos seleccionados ............................ 54
Figura 3.32 Deformación plástica en los elementos seleccionados ................ 54
Figura 3.33 Desplazamiento resultante en los elementos seleccionados ........ 55
Figura 3.34 Esfuerzo VM vs deformación en los elementos .......................... 55
Figura 3.35 Esfuerzo V-M vs. desplazamiento .............................................. 57
Figura 3.36 Elementos seleccionados según esfuerzo de Von mises. ............ 57
Figura 3.37 Esfuerzo V-M en los elementos seleccionados ............................ 58
Figura 3.38 Desplazamiento resultante en los elementos seleccionados ........ 58
Figura 3.39 Esfuerzo VM vs deformación en los elementos .......................... 59
Figura 3.40 Esfuerzo V-M vs. desplazamiento en los elementos .................. 60
Figura 3.41 Elementos seleccionados para obtención de resultados .............. 61
Figura 3.42 Esfuerzo V-M en los elementos seleccionados ............................ 61
Figura 3.43 Deformación plástica en los elementos seleccionados ................ 62
Figura 3.44 Desplazamiento resultante en los elementos seleccionados ........ 62
Figura 3.45 Esfuerzo VM vs deformación en los elementos .......................... 63
Figura 3.46 Esfuerzo V-M vs. desplazamiento en los elementos .................. 64
)LJXUD&XUYDGHODHQHUJtDLQWHUQD)ODQDJDQ%HO\WVFKNR6WL൵QHVV ........ 66
)LJXUD&XUYDGHKRXUJODVV)ODQDJDQ%HO\WVFKNR6WL൵QHVV ..................... 66
Figura 3.49 Curva de energía interna Flanagan Belytschko Viscous Form .... 66
Figura 3.50 Curva de hourglass Flanagan Belytschko Viscous Form ............ 67
Figura 3.51 Curva de energía interna Belytschko Bindeman ......................... 67
Figura 3.52 Curva de hourglass Belytschko Bindeman .................................. 67
Figura 4.1 Algoritmos de cálculo para Dinámica Explícita ............................ 73
)LJXUD&RQ¿JXUDFLyQLQGHIRUPDEOH\GHIRUPDEOHGHXQDEDUUDFDUJDGD. 74
Figura 4.3 Frontal para aplicación del método de análisis de impactos ......... 88
Figura 4.4 Representación física del modelo a impacto ................................. 88
Figura 4.5 Deformaciones Hourglass.............................................................. 89
Figura 4.6 Comparación entre dinámica implícita y explícita ........................ 90
Figura 4.7 Discretización por diferencias centrales ....................................... 92
Figura 4.8 Algoritmo para análisis explícito ................................................... 93
Figura 4.9 Modos de Hourglass31 .................................................................. 95
Figura 4.10 Modos de Hourglass en Shell31 .................................................. 95
Figura 4.11 Fuerzas nodales Hourglass que resisten HG ................................ 96
x
Figura 4.12 Modelo del frontal y la barra de la carrocería para idealización . 98
Figura 4.13 Frontal a partir del cual se determina la masa de impacto .......... 99
Figura 4.14 Resultado del cálculo de la masa del frontal en SolidWorks ....... 99
Figura 4.15 Viga biapoyada con carga uniforme ............................................ 100
Figura 4.16 Ley de momentos de la viga ........................................................ 101
Figura 4.17 Idealización del diagrama de cuerpo libre ................................. 101
Figura 4.18 Ley de momentos en el régimen elástico .................................... 102
)LJXUD0RPHQWRHQTXHSODVWL¿FDQODVVHFFLRQHVHPSRWUDGDV ............... 102
Figura 4.20 (a) Distribución de tensiones en zona plástica ............................ 103
)LJXUDE'LDJUDPDVGH)XHU]DGHFRUWHPRPHQWRÀHFWRU\GHIRUPDFLyQ
......................................................................................................................... 105
Figura 4.21 Distribución de tensiones en la zona plástica .............................. 107
Figura 4.22 Equilibrio de la sección ............................................................... 108
)LJXUD'LDJUDPDGHPRPHQWRÀHFWRU ..................................................... 110
Figura 4.24 Diagrama de fuerzas de corte ...................................................... 110
Figura 4.25 (a) Barra biarticulada ................................................................... 111
Figura 4.25 (b) Diagrama de barra biarticulada .............................................. 112
)LJXUD%DUUDSODVWL¿FDGDFRQYHUWLGDHQPHFDQLVPR .............................. 113
Figura 4.27 Barra idealizada dibujada en SpaceClaim ................................... 114
)LJXUD&RQ¿JXUDFLyQ\YHUL¿FDFLyQHVWDGtVWLFDGHODPDOOD ................... 114
Figura 4.29 Condiciones de borde para la simulación de la barra .................. 115
Figura 4.30 Esfuerzo de Von Mises en la barra .............................................. 115
Figura 4.31 Selección de los elementos para análisis en LS DYNA .............. 116
Figura 4.32 Curva correspondiente a la energía interna en la barra ............... 117
Figura 4.33 Curva correspondiente a la energía de Hourglass en la barra...... 117
Figura 4.34 Curvas de los nodos seleccionados para el esfuerzo de Von Mises
......................................................................................................................... 112
xi
LISTA DE TABLAS
Tabla 1.1 Siniestros por tipo a nivel nacional diciembre 2015 ...........................................5
Tabla 2.1 3HU¿OHV\PDWHULDOHVXWLOL]DGRHQFDUURFHUtDVGHO(FXDGRU ..................................16
Tabla 2.2 Propiedades mecánicas del Acero AISI 304 ........................................................17
Tabla 3.1 0DWHULDOHV\SHU¿OHVXWLOL]DGRVHQFDUURFHUtDV ....................................................35
Tabla 3.2 Cuadro comparativo de resultados de hourglass para métodos de cálculo .........65
Tabla 3.3 Variación de la energía interna vs hourglass de métodos de control ..................67
Tabla 4.1 Valores típicos para impacto de sólidos ..............................................................91
Tabla 4.2 Respuesta de los Materiales al Impacto ..............................................................91
xii
RESUMEN
(Q HVWH SUR\HFWR VH GHVDUUROOD XQD PHWRGRORJtD GH VLPXODFLyQ \ DQiOLVLV SDUD
determinar el comportamiento estructural de una carrocería de buses interprovincial
VRPHWLGR D XQD FRQGLFLyQ GH LPSDFWR IURQWDO VHJ~Q QRUPDWLYD LQWHUQDFLRQDO \ TXH
SHUPLWHHVWDEOHFHUFRPRHOHPHQWRPiVFUtWLFRDOIURQWDOGHODFDUURFHUtD6HGHVDUUROOD
un análisis matemático que permite idealizar el comportamiento de la zona critica del
IURQWDOGHODFDUURFHUtDEDVDGRHQSURSLHGDGHVGHOPDWHULDO\HQODDSOLFDFLyQGHOD
dinámica explicita, así como el uso de Lagrange explicito como base para su análisis
\ODVLPXODFLyQHQYLUWXGGHODVFDUDFWHUtVWLFDVGLQiPLFDVGHOIHQyPHQRGHLPSDFWR
GRQGHVHSURGXFHQHOHYDGDVGHIRUPDFLRQHVHQSHULRGRVGHWLHPSRPX\SHTXHxRV
3DUDHOSURFHVRGHVLPXODFLyQVHXWLOL]yHOVRIWZDUH$16<6/6'<1$HVWDEOHFLHQGR
ODVFRQGLFLRQHVGHERUGH\ODPHWRGRORJtDGHDSOLFDFLyQTXHVHEDVDHQIRUPDJHQHUDO
HQ WUHV HWDSDV SULQFLSDOHV SUH SURFHVDPLHQWR FRQVWUXFFLyQ GHO PRGHOR &$' GH
OD FDUURFHUtD HQ ' XWLOL]DQGR HOHPHQWRV WLSRV VXSHU¿FLH 6ROYHU GHWHUPLQDFLyQ
\ DSOLFDFLyQ GH ODV FDUJDV FRQGLFLRQHV GH IURQWHUD YHORFLGDGHV UHVWULFFLRQHV GH
PRYLPLHQWR FRQWURO GH OD GLQiPLFD H[SOLFLWD \ SRV SURFHVDPLHQWR REWHQFLyQ
SUHVHQWDFLyQHLQWHUSUHWDFLyQGHORVUHVXOWDGRV
(O SURFHVR GH YDOLGDFLyQ GH ORV UHVXOWDGRV REWHQLGRV HQ ORV HVWXGLRV DSOLFDQGR HO
PpWRGR GH ORV HOHPHQWRV ¿QLWRV HVWiQ HQ UHODFLyQ DO SDUiPHWUR GHO UHORM GH DUHQD
+RXUJODVV\DOPpWRGRGHVROXFLyQVHOHFFLRQDGR³)ODQDJDQ%HO\WVFKNR6WLႇQHVV´
TXHSHUPLWLyYDOLGDUHOHVWXGLRSDUDODFXDOVHFRPSDUyHQWUHWUHVPpWRGRVGHFRQWURO
GHO+RXUJODVV
PRESENTACIÓN
(O SUHVHQWH WUDEDMR GH LQYHVWLJDFLyQ HVWi HVWUXFWXUDGR HQ FLQFR FDStWXORV FX\D
GHVDUUROORVHVLQWHWL]DDFRQWLQXDFLyQ(QHOFDStWXORXQRVHUHDOL]DODLQWURGXFFLyQ
al tema, se aborda el problema que en el país no existen estudios y normas
QDFLRQDOHVTXHFRQVLGHUHQSDUDHOGLVHxR\FRQVWUXFFLyQGHFDUURFHUtDVQDFLRQDOHV
HOFRPSRUWDPLHQWRHVWUXFWXUDOGHODFDUURFHUtDDQWHFDUJDVGHLPSDFWRIURQWDOVH
plantea el objetivo general para determinar el comportamiento estructural de la
FDUURFHUtDGHXQEXV³WLSR´LQWHUSURYLQFLDODQWHFDUJDGHLPSDFWRIURQWDOPHGLDQWH
HO PpWRGR GH ORV HOHPHQWRV ¿QLWRV \ FRPSDUDU HO UHVXOWDGR GH HVIXHU]R GH 9RQ
mises obtenido mediante análisis matemático con los generados en un estudio
computacional
En el capítulo dos se revisa y se detalla el estado del arte y las normativas
internacionales y nacionales, existentes para el diseño de carrocerías a impacto
IURQWDODVtFRPRODLQJHQLHUtDDVLVWLGD\PRGHODFLyQPDWHPiWLFDXWLOL]DGD
En el capítulo tres se desarrolla el análisis de una carrocería de bus tipo de
transporte interprovincial a condiciones de impacto, estableciéndose la metodología
GHVLPXODFLyQHQEDVHDORVUHTXHULPLHQWRVGHODVQRUPDV\FRQHOXVRGHOVRIWZDUH
$16<6 /V'\QD SDUD XQ WHUFLR GH OD HVWUXFWXUD FRQVWUXLGD FRQ HOHPHQWRV WLSR
VXSHU¿FLH
(QHOFDStWXORFXDWURVHIXQGDPHQWDGHVDUUROOD\VHDSOLFDXQDQiOLVLVPDWHPiWLFR
EDVDGRHQODWHRUtDGHHVIXHU]RGHIRUPDFLyQSOiVWLFD\ODGLQiPLFDH[SOtFLWDSDUDOD
LGHDOL]DFLyQGHXQHOHPHQWRGHOD]RQDFULWLFDGHODFDELQDTXHVHGHWHUPLQyHQHO
FDStWXORWUHV$SDUWLUGHGLFKRDQiOLVLVVHFRPSDUyORVUHVXOWDGRVDQDOtWLFRVFRQORV
REWHQLGRVHQXQDVLPXODFLyQFRPSXWDFLRQDOHVWDEOHFLpQGRVHFXUYDVFDUDFWHUtVWLFDV
TXHSHUPLWHQHPLWLUFRQFOXVLRQHVLQJHQLHULOHV
En el capítulo cinco se detallan las conclusiones y recomendaciones de la
LQYHVWLJDFLyQ VH FXPSOLy FRQ HO REMHWLYR JHQHUDO GH OD LQYHVWLJDFLyQ DO DQDOL]DU
el comportamiento estructural de una carrocería de bus interprovincial ante un
LPSDFWR IURQWDO EDMR FRQGLFLRQHV UHIHUHQFLDGDV HQ QRUPDWLYDV LQWHUQDFLRQDOHV
HVWDEOHFLpQGRVHODVPHWRGRORJtDVGHDQiOLVLVFRPSXWDFLRQDO\PDWHPiWLFDV
1
CAPÍTULO I
INTRODUCCIÓN
1.1 EL PROBLEMA
En la actualidad, se han observado que los índices de accidentalidad en los buses
interprovinciales en Ecuador, han venido incrementándose, muchos de los cuales
son producto de fallas mecánicas o por la impericia del conductor, constituyéndose
la estructura de los buses la principal, y en la mayoría de las veces, la única forma
de protección ante estos eventos. Se conoce que en el diseño estructural de los
buses destinados al transporte de personas debe existir un proceso de diseño y
construcción que involucre la geometría, las dimensiones y materiales de los cuales
se hallen constituidos los elementos que conforman la carrocería. Es así que las
normas INEN existentes delimitan un espacio de supervivencia destinado a la
protección de los pasajeros. Sin embargo en el Ecuador no existe una metodología
de análisis y diseño para impactos frontales, que se pueda transformar en norma
técnica y así permita normar los ensayos virtuales o físicos a impacto, a partir de
los cuales se pueda comprobar y aprobar la efectividad de los diseños ofertados
actualmente por las empresas carroceras existentes.
1.2 JUSTIFICACIÓN
Nuestro país, tradicionalmente productor de materias primas, viene presentando
cambios muy profundos en sus estructuras socio-políticas, culturales, tecnológicas,
HGXFDWLYDV\SURGXFWLYDVTXHWLHQHQFRPRREMHWLYR¿QDOHOPHMRUDUORVHVWiQGDUHV
de calidad de vida de la población, considerando y teniendo en cuenta la diversidad
de la misma.
Dentro del campo de la producción, varias son las iniciativas privadas o públicas,
que se han venido impulsando y que buscan la creación y generación de empresas
especializadas, sostenibles y competitivas que vengan a contribuir en la economía
del país dando solución a problemas de la sociedad.
El presente proyecto, en este sentido, realiza un análisis del fenómeno físico de
impacto frontal y su incidencia en la carrocería de un autobús tipo utilizado en el
transporte interprovincial, para determinar un modelo de estudio y análisis optimo,
SDUD GH¿QLU HO FRPSRUWDPLHQWR HVWUXFWXUDO GHO YHKtFXOR FRQVLGHUDGR DQWH XQ
2
LPSDFWRIURQWDO'HHVWDPDQHUDVHREVHUYDUiQODVGH¿FLHQFLDVTXHSXHGHQH[LVWLU
en el diseño estructural previo y en la selección de los materiales utilizados en la
estructura de los autobuses.
Así se aportará a la industria carrocera con una metodología de análisis y diseño
que permitirá reducir los costos de investigación y producción, al disponer de una
mejor tecnología de diseño y análisis, que garantice que los nuevos diseños de
carrocerías cumplan con estándares de calidad nacionales e internacionales,
haciendo que la industria carrocera sea más productiva.
1.3 OBJETIVOS
1.3.1 OBJETIVOS GENERAL
Determinar el comportamiento estructural de la carrocería de un bus "tipo"
interprovincial ante carga de impacto frontal mediante el método de los elementos
¿QLWRV
Comparar el resultado de esfuerzo de Von Mises obtenido mediante análisis
matemático con los generados en un estudio computacional
1.3.2 OBJETIVOS ESPECÍFICOS
•
5HFRSLODULQIRUPDFLyQFLHQWt¿FDVHFXQGDULDSDUDHOHVWDEOHFLPLHQWR\GHOLPLWDFLyQ
del estudio basado en normas internacionales y nacionales.
•
Proyectar geométricamente la superestructura de un bus "tipo" interprovincial
basado en las normas nacionales NEN NTE INEN 1 323:2009, INEN 1 668 y la
NTE INEN 2664:2013
•
Plantear las condiciones de borde para el análisis computacional a impacto.
•
,GHQWL¿FDUOD]RQDHVWUXFWXUDOFUtWLFD\GHQWURGHHOODHOHOHPHQWRFUtWLFRHQEDVH
a resultados obtenidos en el análisis computacional.
•
Realizar el cálculo analítico en un elemento estructural idealizado que se
fundamente en el comportamiento elasto plástico del material de la carrocería.
3
•
Confrontar los resultados obtenidos del análisis matemático basado en la
idealización con los obtenidos en la simulación del programa de ingeniería
asistida.
1.4 GENERALIDADES
1.4.1 LA INDUSTRIA CARROCERA DE TRANSPORTE PÚBLICO EN EL MUNDO
En la actualidad, el mundo de la industria automotriz desarrolla el transporte
público por medio de empresas carroceras, que buscan la producción de vehículos
con tecnologías orientadas a dar una mayor seguridad, confort, y el cuidado del
PHGLRDPELHQWH6HKDQGHVDUUROODGRDYDQFHVVLJQL¿FDWLYRVHQGLVHxRVDVLVWLGRV
por computadora, procesos de ensamblaje automatizados o con la presencia de
robots manipuladores. Es así como también el uso de materiales compuestos han
venido a sustituir a los materiales utilizados tradicionalmente en la construcción de
carrocerías. Estos avances buscan no solo cumplir con las normas de calidad y
producción, sino también cumplir con los requerimientos de los consumidores y de
los propietarios del capital.
Se viene realizando investigaciones tendientes a la inclusión de las tecnologías
GHODFRPXQLFDFLyQHOXVRGHODLQWHOLJHQFLDDUWL¿FLDOHQHOGLVHxRGHDXWRPyYLOHV
conducción autónoma, mejoramiento y reducción de las emisiones contaminantes,
reducción del consumo de combustible y del dióxido de carbono, mejoramiento del
rendimiento o performance del vehículo.
En materia de seguridad se concentran en mejoras desde el sistema de frenado,
la estabilidad, componentes estructurales construidos con materiales más ligeros
y resistentes entre otros, en investigaciones de impacto se utilizan herramientas
computacionales como LS-DYNA, MSC Dytran, MADYMO u otros, como elementos
que optimizan los tiempos de desarrollo e investigación de los nuevos productos.
([LVWHQODERUDWRULRV\FHQWURVWHFQROyJLFRVR¿FLDOHVHQSDtVHVGH(XURSD-DSyQ
India, China, con una dedicación importante a la realización de investigación,
desarrollo, experimentación y homologaciones que están íntimamente relacionadas
con la construcción de carrocerías para autobuses y vehículos.
1.4.2 LA INDUSTRIA CARROCERA DE TRANSPORTE PÚBLICO EN ECUADOR
La industria carrocera de transporte público en el Ecuador está constituida por
4
pequeña y mediana empresa metal - mecánica ubicadas a lo largo del país. En
Pichincha existen cerca de 50 talleres; en la zona centro del país, especialmente
en Tungurahua existe la Asociación de Carroceros, que agrupa de manera formal
a cerca de 20 talleres grandes y otros 25 entre medianos y pequeños que en
conjunto cubren cerca del 65% del mercado nacional, se tienen también talleres de
carrocerías en Guayas, Manabí, Azuay.
Este sector impulsa el trabajo directo e indirecto al contratar profesionales y
WUDEDMDGRUHVFDOL¿FDGRV\VHPLFDOL¿FDGRVHQODViUHDVGHODVROGDGXUDWDSLFHUtD
electricidad, control de calidad, talento humano, seguridad industrial.
Existe conformada la Cámara Nacional de Fabricantes de Carrocerías CANFAC,
ente jurídico reconocido por el Ministerio de Industrias y Productividad mediante
resolución No. 07-290 desde el 31 de julio de 2007, agrupa a 41 empresas
FDOL¿FDGDV \ KRPRORJDGDV SDUD OD FRQVWUXFFLyQ GH FDUURFHUtDV GH ODV FXDOHV HO
44% de empresas carroceras son de personas naturales, el 22% son Artesanales,
un 15% son Compañías Limitadas, el 12% Sociedad Anónima y un 7% son de
Hecho1 .
Esta cámara asocia a los proveedores de carrocerías de las provincias de
Tungurahua, Chimborazo, Manabí, Azuay. En su gran mayoría están localizados
HVSHFt¿FDPHQWHHQODFLXGDGGH$PEDWR
Las principales empresas dedicadas a esta actividad la conforman entre otras la
Industria Metálica Cepeda (IMCE), VARMA, Carrocería Patricio Cepeda , SERMAN,
C. Altamirano, C. Alvarado, C. Buscars, C. Megabus, C. Mayorga, C.Ibimco, C Vipesa.
1.4.3 ESTADÍSTICA DE ACCIDENTES DE TRÁNSITO EN BUSES
En el país, según estadísticas manejadas por la Agencia Nacional de Tránsito,
y que están basadas en información presentada por los gobiernos autónomos
descentralizados municipales de Cuenca, Loja, Quito, Manta, Ambato e Ibarra, el
porcentaje de siniestros acumulado hasta diciembre de 2015, por choque frontal y
estrellamiento representan el 17,93% del total de siniestros a nivel nacional, que
representan 6.403 accidentes, constituyéndose luego del choque lateral con un
1 Reseña Histórica CANFACECUADOR ( 2015) Recuperado: http://www.canfacecuador.com/
index.php/quienes-somos/resena-historica.
5
28,37%, los principales tipos de accidente de tránsito.2
El porcentaje de siniestros en que participan los buses por choque frontal y
estrellamiento se constituyen en promedio anual del 6,50%. Si bien el porcentaje
se lo considera bajo, es importante tomar en cuenta que los buses trasladan mayor
cantidad de personas que los vehículos.
Tabla 1.1
Siniestros por tipo a nivel nacional diciembre 2015
TOTAL
TIPO
ENE
FEB
MAR
ABR
MAY
JUN
JUL
AGO
SEP
OCT
NOV
%
DIC
DIC-2015
Choque lateral
825
715
828
847
851
868
869
788
808
858
889
983
10.129
28,37
Atropello
460
390
434
431
456
431
381
393
406
468
384
506
5.140
14,40
Estrellamiento
332
311
391
399
402
361
397
396
376
399
391
469
4.624
12,95
Choque posterior
332
328
340
313
348
317
342
349
319
325
331
424
4.068
11,39
Pérdida de pista
230
194
247
275
319
290
315
290
292
341
353
325
3.471
9,72
Rozamiento
239
188
215
230
228
207
199
219
229
205
212
226
2.597
7,27
Choque frontal
130
145
176
148
152
146
142
148
143
125
162
162
1.779
4,98
Colisión
66
74
110
79
108
127
98
98
101
99
92
109
1.161
3,25
Volcamiento
80
93
108
87
95
77
79
76
79
95
80
105
1.054
2,95
Caída de pasajero
72
51
57
77
72
74
67
65
78
62
64
71
810
2,27
Otros
76
68
93
51
38
33
45
40
30
46
26
36
582
1,63
Arrollamiento
30
20
24
30
27
26
27
30
14
16
17
30
291
0,81
2.872
2.577
3.023
2.967
3.096
2.957
2.961
2.892
2.875
3.039
3.001
3.446
35.706
100
8,04
7,22
8,47
8,31
8,67
8,28
8,29
8,10
8,05
8,51
8,40
9,65
100
TOTAL
%
Fuente: Adaptado de DNCTSV, CTE, EMOV - Cuenca, Gobierno Autónomo Descentralizado Municipal de Loja, Agencia
Metropolitana de Tránsito - Quito, Gobierno Autónomo Descentralizado de Manta, Municipio de Ambato, Municipio de
Ibarra, Autoridad de Tránsito Municipal de Guayaquil.
1.5 DISEÑO DE ESTRUCTURAS PARA TRANSPORTE PÚBLICO
INTERPROVINCIAL EN ECUADOR
Según Novillo G (1999) menciona que, en el país, el diseño y construcción de
carrocerías metálicas para el transporte público interprovincial, ha tenido un avance
VLJQL¿FDWLYRHQUHODFLyQDORVDxRVGHLQLFLRGHODFRQVWUXFFLyQDOOiSRUORVDxRV
las mismas eran en su mayoría forradas de madera en el exterior y de latón en el
interior.
Según antecedentes históricos,en 1963 ingresa la empresa americana Thomas que
2 Estadísticas de transporte terrestre y seguridad vial Recuperado: http://www.ant.gob.ec/index.
php/noticias/ estadisticas#.Virc5EqxZER)
6
empezó la fabricación de carrocerías metálicas tipo pulman, con patente americana,
\TXHVLUYLyGHEDVHHLQÀXHQFLDSDUDHOGHVDUUROORGHODHPSUHVDFDUURFHUDHQHO
país, y que todavía en la actualidad algunas empresas y talleres la siguen utilizando.
En la actualidad si bien hay avances tecnológicos, las carrocerías metálicas para
autobuses se siguen construyendo en una parte de forma tradicional y empírica,
adoptando un criterio bajo el concepto de reforzamiento y rigidez respecto a
materiales y elementos estructurales, haciendo que las carrocerías tengan un
peso excesivo, situación que obliga a pensar en nuevas geometrías que evitan
sobrecargar el bastidor y el motor, esto permite una mejor conservación de los
sistemas y elementos que conforman un autobús con el ahorro económico.
Hoy en día se están empleando tecnologías de construcción que tratan de disminuir
el peso de las mismas y además buscan dar atención especial a la estética, así
como al confort y seguridad, para el efecto se asimila y se copian modelos foráneos.
Lastimosamente, muy a pesar que existen normas nacionales que señalan los
requisitos que deben cumplir las empresas carroceras para la construcción y
diseño de carrocerías, las mismas en sus requerimientos no disponen de una
normativa y regulación para la construcción y diseño de carrocerías que considere
el impacto frontal en las mismas, situación que afecta a las empresas carroceras en
el momento de tratar de exportar sus unidades, haciendo difícil o decir imposible el
SURFHVRGHKRPRORJDFLyQGHODVPLVPDVFRQ¿QHVGHH[SRUWDFLyQHQHVWHVHQWLGR
los estudios y trabajos sobre el análisis estructural a cargas de impacto que se
realizan en el país son nulos y los estudios existentes consideran solo el estudio
estructural estático.
Sin embargo, en los países desarrollados, especialmente en Europa, se ha trabajado
mucho en éste ámbito como exigencia imprescindible para la homologación,
existen centros carroceros que cuentan con polígonos de pruebas para evaluar la
resistencia, rigidez y confort de sus productos, desarrollando y sustituyendo nuevos
modelos y materiales como el Departamento de Homologación Applus IDIADA3 y
el Instituto de Investigación del Automóvil de la Universidad Politécnica de Madrid4
Los avances tecnológicos en los diferentes campos, así como, la oportunidad
de incursionar en mercados internacionales, ha generado en los miembros de la
3 Applus IDIADA ,2015, Recuperado: http://www.applusidiada.com/es/
4 INSIA (1993) Recuperado http://www.upm.es/institucional/UPM/Centros/CampusSur/INSIA
7
CANFAC la necesidad de emprender en procesos de mejora continua, que busque
REWHQHU XQD FHUWL¿FDFLyQ GH FDOLGDG SDUD LQFXUVLRQDU HQ OD H[SRUWDFLyQ GH EXVHV
carrozados en el país, en este contexto el presente estudio permite disponer de una
metodología de estudio, análisis y diseño de carrocerías a impacto frontal como
base referente para cumplir con normas internacionales.
8
CAPÍTULO II
ESTADO DE LA CIENCIA
2.1 NORMAS INTERNACIONALES
En los Estados Unidos de Norte América, existen las Normas Federales de Seguridad
SDUD 9HKtFXORV )0966 TXH HVSHFL¿FDQ HO GLVHxR FRQVWUXFFLyQ UHQGLPLHQWR \
los requisitos de durabilidad de los componentes de vehículos relacionados con la
¿DELOLGDGGHVXVVLVWHPDV\VXVFDUDFWHUtVWLFDVGHGLVHxR/DVQRUPDVPHQFLRQDGDV
UHVXOWDQVHUODFRQWUDSDUWHDO5HJODPHQWRGHOD2UJDQL]DFLyQGHODV1DFLRQHV8QLGDV
218GHVDUUROODGRSRUHOIRURPXQGLDOSDUDODDUPRQL]DFLyQGHORV5HJODPHQWRV
VREUHYHKtFXORVHOFXDOHVUHFRQRFLGRDXQTXHHQGLVWLQWRJUDGRGHDSOLFDFLyQSRU
ODPD\RUtDGHORVSDtVHVGHOPXQGRH[FHSWRORV(VWDGRV8QLGRV
En Canadá se cuenta con un sistema de normas análogas llamadas Normas de
6HJXULGDG &DQDGLHQVHV SDUD 9HKtFXORV 0RWRUL]DGRV FX\DV VLJODV VRQ &0966
TXHVHDVHPHMDQVXVWDQFLDOPHQWHSHURQRWRWDOPHQWHFRQHOFRQWHQLGR\ODHVWUXFWXUD
GHODV)0966/RVUHTXLVLWRV)0966&0966GL¿HUHQVLJQL¿FDWLYDPHQWHGHORV
UHTXLVLWRV LQWHUQDFLRQDOHV GH OD 218 SRU OR TXH OD LPSRUWDFLyQ SULYDGD GH ORV
vehículos no fabricados originalmente para el mercado de Estados Unidos es difícil
RLPSRVLEOH
/DVQRUPDV)0966VHGLYLGHQHQWUHVFDWHJRUtDVTXHVRQSUHYHQFLyQGHDFFLGHQWHV
VHULHUHVLVWHQFLDDORVFKRTXHVVHULH\ODVXSHUYLYHQFLDSRVWDFFLGHQWH
VHULH (O SULPHU UHJODPHQWR )0966 1R IXH DGRSWDGR HO GH PDU]R
GH\VLJXHYLJHQWHKDVWDODIHFKDDXQTXHVXVUHTXLVLWRVVHKDQDFWXDOL]DGR
SHULyGLFDPHQWH\KHFKRPiVULJXURVRV
(Q UHODFLyQ FRQ HO WHPD GHO SUHVHQWH SUR\HFWR HO HVWiQGDU 1R GH OD QRUPD
HVWDGRXQLGHQVHGHQRPLQDGR³,PSDFW3URWHFWLRQ´VHUH¿HUHDOVLVWHPDGHFRQWUROGH
GLUHFFLyQSDUDYHKtFXORVGHWXULVPRV\SDUDORVYHKtFXORVGHWUDQVSRUWHPXOWLSURSyVLWR
FRPRVRQFDPLRQHV\DXWREXVHVHVWDHVXQDUHJXODFLyQHVSHFt¿FDTXHH[SUHVD
ORVUHTXLVLWRVSDUDUHGXFLUDOPtQLPROHVLRQHVHQHOSHFKRHOFXHOOR\FDUDGHORV
RFXSDQWHVPHGLDQWHODSURSRUFLyQGHVLVWHPDVGHGLUHFFLyQTXHVHGHVSOD]DQKDFLD
DGHODQWHTXHDPRUWLJXDHOLPSDFWRGHOSHFKRGHOFRQGXFWRUPHGLDQWHODDEVRUFLyQ
GHJUDQSDUWHGHVXHQHUJtDGHLPSDFWRHQORVFKRTXHVIURQWDOHV7DOHVVLVWHPDV
VRQPX\H¿FDFHVHQODUHGXFFLyQGHODSUREDELOLGDGGHOHVLRQHVJUDYHV\PRUWDOHV
([LVWHQRWUDVQRUPDWLYDVDSOLFDGDVHQ(VWDGRV8QLGRVFRPRODVJHQHUDGDVSRUOD
$GPLQLVWUDFLyQ 1DFLRQDO GH 6HJXULGDG \7Ui¿FR HQ &DUUHWHUD 1DWLRQDO +LJKZD\
7UDႈF6DIHW\$GPLQLVWUDWLRQ1+76$TXHIXHHVWDEOHFLGDSRUOD/H\GH6HJXULGDG
HQ ODV &DUUHWHUDV GH \ VH GHGLFD D OD FRQVHFXFLyQ GH DOWRV HVWiQGDUHV GH
SHUIHFFLyQ HQ HO YHKtFXOR GH PRWRU \ VHJXULGDG YLDO7UDEDMD WRGRV ORV GtDV SDUD
D\XGDUDSUHYHQLUORVDFFLGHQWHV\HYLWDUVXVFRUUHVSRQGLHQWHVJDVWRV¿QDQFLHURV
\KXPDQRV
(XURSDWLHQHVXUHIHUHQWHHQQRUPDWLYDVGHVHJXULGDGHQHO'LVHxR2SHUDFLyQ\
&RQVWUXFFLyQ GH YHKtFXORV GH XVR SDUWLFXODU DVt FRPR ORV GH WUDQVSRUWH S~EOLFR
GHQRPLQDGDV(XUR(1&$3TXHHQJOREDXQ3URJUDPDGHHYDOXDFLyQGH$XWRPyYLOHV
1XHYRVSURGXFLGRVHQ(XURSDTXHFXHQWDFRQHODSR\R\ODSDUWLFLSDFLyQGHVLHWH
países europeos, varios fabricantes e instituciones que están relacionadas con el
VHFWRUDXWRPRWUL]HQHOPXQGR
Con respecto a los países que conforman el cono Sur Americano (Argentina, Bolivia,
%UDVLO &KLOH 3DUDJXD\ 3HU~ \ 8UXJXD\ HO WUDQVSRUWH WHUUHVWUH VH HQFXHQWUD
DFWXDOPHQWH UHJXODGR SRU HO $FXHUGR VREUH 7UDQVSRUWH ,QWHUQDFLRQDO 7HUUHVWUH $7,7TXHQRUPDODVRSHUDFLRQHVGHWUDQVSRUWHGHQWURGHORVSDtVHVPLHPEURV
Cabe puntualizar que aparte de este acuerdo, ciertos países sudamericanos se
HQFXHQWUDQHQHOGHVDUUROORGHVXVSURSLDVQRUPDWLYDVSDUDODUHJXODFLyQGHOGLVHxR
\FRQVWUXFFLyQGHODVFDUURFHUtDVXWLOL]DGDVHQORVEXVHVGHWUDQVSRUWHWDOHVFDVR
ejemplar de Colombia que posee las normas generadas por el Instituto Colombiano
GH1RUPDV7pFQLFDV\&HUWL¿FDFLyQ,&217(&DVtFRPRHQ(FXDGRUTXHVHDSOLFDQ
ODV 1RUPDV 7pFQLFDV (FXDWRULDQDV GHWHUPLQDGDV SRU HO ,QVWLWXWR (FXDWRULDQR GH
1RUPDOL]DFLyQ,1(1
/RVHVWXGLRVVREUHODUHVLVWHQFLDDORVLPSDFWRV\ODVHJXULGDGGHORVYHKtFXORVKDQ
JDQDGRDWHQFLyQHQORV~OWLPRVDxRVFRQpQIDVLVHQODLQYHVWLJDFLyQGHODVHJXULGDG
GHOFRFKHGHSDVDMHURV3URFKRZVNLHWDO$O7KDLU\\:DQJ
/DLQYHVWLJDFLyQVREUHODVHJXULGDGGHORVDXWREXVHV\DXWRFDUHVHVWiHYLGHQWHPHQWH
OLPLWDGD/D1RUPD)HGHUDOGH6HJXULGDGGHSDUD9HKtFXORV)0966HVWDEOHFH
ORVUHTXLVLWRVGHSURWHFFLyQFRQWUDHOYXHOFRGHDXWREXVHVHVFRODUHVHQORV(VWDGRV
8QLGRV
(Q OD FRPXQLGDG HXURSHD OD &RPLVLyQ (FRQyPLFD GH ODV 1DFLRQHV 8QLGDV SDUD
(XURSD 81(&( GLVSRQH GHO 5HJODPHQWR UHODWLYD D OD UHVLVWHQFLD GH OD
10
VXSHUHVWUXFWXUDGHDXWRE~VEDMRHOHQVD\RGLQiPLFRGHYXHOFRODWHUDO\ODQRUPD
(&(5TXHHVSHFL¿FDODUHVLVWHQFLDGHORVDVLHQWRV\VXVDQFODMHV6LQHPEDUJR
ODVUHJXODFLRQHV\RGLUHFWULFHVGLVSXHVWDVHVSHFt¿FDPHQWHSDUDODFROLVLyQIURQWDO
GHODHVWUXFWXUDGHEXVGLUHFWDPHQWHUHODFLRQDGRVFRQODVHJXULGDGGHOFRQGXFWRU\
ODWULSXODFLyQQRH[LVWHQ
/DQRUPDWLYD(&(5VHLPSRQHSDUDSURSRUFLRQDUODVHJXULGDGGHODFDELQDGHO
FDPLyQREXV\GHOFRQGXFWRUEDMRLPSDFWRIURQWDO0LU]DDPLULHWDO$OJXQDV
SURSXHVWDVVLPLODUHVD(&(5HVWiQEDMRGLVFXVLyQHQJUXSRGHWUDEDMRVREUHOD
VHJXULGDGSDVLYD*563HQ81(&(\XQDUHJXODFLyQVLPLODUSDUDORVDXWREXVHV
VHUiQLPSXHVWDVHQXQIXWXURSUy[LPR&HULWHWDO
(QHOFDVRGHFROLVLyQIURQWDOGHEXVODVHJXULGDGGHOFRQGXFWRUHVWiUHODFLRQDGD
FRQ GRV HIHFWRV RSXHVWRV OD GHIRUPDFLyQ GHO KDELWiFXOR GHO FRQGXFWRU PHGLGR
SRULQWUXVLyQ\GHVDFHOHUDFLyQVHQWLGDSRUHOFRQGXFWRUPHGLGRSRUODDPSOLWXGGH
GXUDFLyQ\HOWLHPSRGHOLPSXOVRGHFKRTXH0DWVXPRWRHWDO
(OXVRGHFRPSRQHQWHVFDSDFHVGHSDQGHDUVHHQXQSDWUyQFRQWURODGRGHSOHJDGR
SURJUHVLYRVHXWLOL]DFRPRXQPHGLRSDUDPHMRUDUODUHVLVWHQFLDDORVLPSDFWRV\SDUD
ODSURWHFFLyQGHORVRFXSDQWHVGHOYHKtFXORHQORVYHKtFXORVGHSDVDMHURV7XERV
de acero de pared delgada colapsan bajo aplastamiento axial, pueden también
VHU DEVRUEHQWHV GH HQHUJtD H[LVWHQ PiV FRP~QPHQWH \D VHD FRPR VHFFLRQHV
WUDQVYHUVDOHV FXDGUDGDV R FLUFXODUHV $EUDPRZLF] =KDQJ \ =KDQJ 1LD\3DUVDSRXU
/DLQH¿FLHQFLDHQHOGLVHxRKDFHTXHORVWXERVORQJLWXGLQDOHVIURQWDOHVFRODSVHQHQ
XQPRGRGHÀH[LyQHQOXJDUGHDSODVWDPLHQWRD[LDOSURJUHVLYR(UHQHWDO
\$PEDWLHWDOKDQHPSOHDGRHOVROXFLRQDGRUGHHOHPHQWRV¿QLWRV$16<6
/6'<1$SDUDSUHGHFLUFRQSUHFLVLyQHOFRODSVRGHGLIHUHQWHVFRQ¿JXUDFLRQHVGH
FDUULOHVODWHUDOHVGHODQWHUDVGHXQFRFKHGHSDVDMHURV
(QFDVRGHFROLVLyQIURQWDOGHDXWREXVHVDOJXQRVLQYHVWLJDGRUHVKDQXWLOL]DGRSDUD
HYDOXDUHOPHFDQLVPRGHGHIRUPDFLyQ\ODVUHVSXHVWDVHVWUXFWXUDOHVGHOYHKtFXOR
sometido a cargas de impacto basadas en diferentes conceptos, el análisis por
HOHPHQWRV¿QLWRV)($6LQHPEDUJRODVVXJHUHQFLDVGHPHMRUDGHODUHVLVWHQFLD
a los choques de autobuses de pasajeros son limitadas (Patarramon et al 2015)
11
2.2 NORMAS PARA EL DISEÑO DE CARROCERÍAS DE TRANSPORTE
PÚBLICO EN ECUADOR
'HQWURGHOSDtVHOGLVHxR\FRQVWUXFFLyQGHFDUURFHUtDVSDUDHOWUDQVSRUWHS~EOLFR
LQWHUSURYLQFLDOHVWiQRUPDGR\UHJXODGRSRUORVHVWiQGDUHVTXHOD$JHQFLD1DFLRQDO
GH7UiQVLWR\VHEDVDSDUDVXRSHUDFLyQHQODVQRUPDV\UHJODPHQWRVGHO,QVWLWXWR
1DFLRQDO (FXDWRULDQR GH 1RUPDOL]DFLyQ ,1(1 TXH GLVSRQH SDUD HO HIHFWR \ VH
HVSHFL¿FDQ HQ OD 1RUPD ,1(1 5HYLVLyQ 9HKtFXORV $XWRPRWRUHV
&DUURFHUtDVGH%XVHV
Además se establecen los requisitos que deben cumplir los fabricantes de carrocerías
0HWiOLFDVSDUDYHKtFXORVGHWUDQVSRUWHGHSDVDMHURVVHJ~Q17(,1(1
2.3 NORMAS DE DISEÑO A IMPACTO
$QWHVGHPHQFLRQDUODVQRUPDVSDUDHOGLVHxRGHFDUURFHUtDVDLPSDFWRHVQHFHVDULR
GH¿QLUORVGLVWLQWRVWLSRVGHSUXHEDVGHFKRTXHTXHVHGHVDUUROODQHQORVYHKtFXORV
\TXHVHGHVFULEHQDFRQWLQXDFLyQ
•
Pruebas de impacto frontal: son por lo general los impactos frontales sobre
XQ VyOLGR D XQD YHORFLGDG HVSHFL¿FDGD SHUR WDPELpQ SXHGHQ VHU SUXHEDV GH
YHKtFXORV LPSDFWDQGR YHKtFXORV 9HKtFXORV GHSRUWLYRV XWLOLWDULRV VSRUW XWLOLW\
vehicle SUVs) han sido empleados en este tipo de impactos, debido a su gran
SUHVWDQFLD\VHUYLFLRVTXHSUHVWDQDOXVXDULRFRP~Q
•
Pruebas Overlap Moderado: HO LPSDFWR VH JHQHUD HQ VyOR XQD SDUWH IURQWDO
GHODQWHUDGHORVDXWRPyYLOHV\FRQWUDXQDEDUUHUDYHKtFXOR6RQLPSRUWDQWHVODV
fuerzas de impacto que se consideran aproximadamente constantes durante la
SUXHEDGHLPSDFWRIURQWDOSHURVHUHTXLHUHXQDIUDFFLyQPiVSHTXHxDGHOFRFKH
SDUDDEVRUEHUODWRWDOLGDGGHODIXHU]D$PHQXGRHVWDVSUXHEDVVHUHDOL]DQSDUD
YHUL¿FDUDORVDXWRVTXHGDQYXHOWD\HQIUHQWDQHOWUi¿FRTXHÀX\HHQXQVHQWLGR
GHWHUPLQDGR(VWHWLSRGHSUXHEDHVUHDOL]DGDSRUHO,QVWLWXWRGH6HJXURVSDUD
ODVHJXULGDGHQODVFDUUHWHUDVGHORV(VWDGRV8QLGRVGH1RUWH$PpULFDFX\DV
VLJODVVRQ,,+6SRUODQRUPDHXURSHD(XUR1&$3HO3URJUDPDGH(YDOXDFLyQ
GH$XWRV 1XHYRV GH$XVWUDOLD $1&$3 \ OD$6($1 1&$3 TXH HV HO QXHYR
SURJUDPDGHHYDOXDFLyQGHFRFKHVGH3DtVHVGHO6XGHVWH$VLiWLFRHVWHHVXQ
SURJUDPDGHFDOL¿FDFLyQGHVHJXULGDGGHODXWRPyYLOHVWDEOHFLGRFRQMXQWDPHQWH
SRUHO,QVWLWXWR0DOD\RGH,QYHVWLJDFLyQGH6HJXULGDG9LDO0,526\HO3URJUDPD
12
GH(YDOXDFLyQ*OREDOGHFRFKHVQXHYRV*OREDO1&$3HQXQPHPRUDQGRGH
HQWHQGLPLHQWR GH FRODERUDFLyQ ¿UPDGR SRU DPEDV SDUWHV FRQ DYDO GH OD ),$
)HGHUDFLyQ,QWHUQDFLRQDOGHO$XWRPyYLO
•
Pruebas Overlap pequeñas HQ HVWH WLSR GH HQVD\R GH LPSDFWR VyOR XQD
SHTXHxD SDUWH GH OD HVWUXFWXUD GHO FRFKH FKRFD FRQWUD XQ REMHWR FRPR XQ
SRVWHRXQiUERO(VWDHVODSUXHEDPiVH[LJHQWHTXHH[LVWH\DTXHVHJHQHUD
XQDFDUJDFRUUHVSRQGLHQWHDODPD\RUIXHU]DSRVLEOHVREUHODHVWUXFWXUDGHORV
FRFKHVDFXDOTXLHUYHORFLGDGGDGD(VWDVVHUHDOL]DQQRUPDOPHQWHHQXQ
GHODHVWUXFWXUDGHODQWHUDGHXQYHKtFXOR
•
Pruebas de impacto lateral: VRQ UHDOL]DGDV SDUD HYLWDU HO VLJQL¿FDWLYR
porcentaje de fatalidad que se presenta en el caso de impacto lateral, debido a
TXHORVYHKtFXORVQRWLHQHQXQD]RQDGHGHIRUPDFLyQVLJQL¿FDWLYDTXHSHUPLWD
DEVRUEHUODVIXHU]DVGHLPSDFWRVDQWHVTXHXQRFXSDQWHVXIUDGDxRV/D]RQD
GH GHIRUPDFLyQ GHEH HVWDU GLVHxDGD SDUD DEVRUEHU OD HQHUJtD GHO LPSDFWR
GXUDQWHXQDFFLGHQWHGHWUi¿FRSRUGHIRUPDFLyQFRQWURODGD
•
Pruebas Antivuelco SRQHQ D SUXHED OD FDSDFLGDG GH XQ DXWRPyYLO SDUD
VRSRUWDUXQLPSDFWRGLQiPLFRHVSHFt¿FDPHQWHODVFROXPQDVTXHVRVWLHQHQHO
WHFKR /RV HQVD\RV GH YXHOFR GLQiPLFRV KDQ VLGR SURSXHVWRV UHFLHQWHPHQWH
para sustituir a las pruebas de aplastamiento estático que generalmente se
XWLOL]DED
•
Pruebas de choque en los bordes del caminoVHXWLOL]DQEDUUHUDVGHVHJXULGDG
\ DPRUWLJXDGRUHV GH FKRTXH SDUD JDUDQWL]DU OD SURWHFFLyQ GH ORV RFXSDQWHV
del vehículo ante peligros laterales por impacto, a la vez se pretende también
DVHJXUDU TXH ODV EDUDQGLOODV SRVWHV SXEOLFLWDULRV SRVWHV GH OX] \ DFFHVRULRV
VLPLODUHVQRVHFRQVWLWX\DQHQXQULHVJRSDUDORVRFXSDQWHVGHOYHKtFXOR
•
Viejo contra nuevo: esta prueba se desarrolla a menudo mediante el impacto
GHXQFRFKHYLHMR\JUDQGHFRQWUDXQFRFKHSHTXHxR\QXHYRHVGHFLUGRVR
WUHVJHQHUDFLRQHVGLIHUHQWHVGHXQPLVPRPRGHORGHFRFKH6HUHDOL]DQHVWDV
pruebas para demostrar los avances en la resistencia a los impactos que los
GLVHxDGRUHVGHDXWRVORJUDQ
•
Modelo por ordenador: Debido al costo de las pruebas de choque a escala
UHDOORVLQJHQLHURVDPHQXGRUHFXUUHQDODVLPXODFLyQGHSUXHEDVGHFKRTXH
13
XWLOL]DQGR PRGHORV GH FRPSXWDGRUD SDUD GH HVWD PDQHUD UH¿QDU HO GLVHxR GH
VXVYHKtFXORDQWHVGHUHDOL]DUODVSUXHEDVHQYLYR
/DVQRUPDVGHGLVHxRPiVHPSOHDGDVVRQODVVLJXLHQWHV
•
(Q (XURSD ODV QRUPDV (81&$3 VRQ XQ SURJUDPD GH HYDOXDFLyQ SDUD
YHKtFXORV QXHYRV PHGLDQWH HQVD\RV D FDUJD SRU LPSDFWR /D FRGL¿FDFLyQ
de la norma para impactos frontales perteneciente a este grupo es la
75$16:3*563H
•
(Q(VWDGRV8QLGRVVHXWLOL]DHOVLVWHPDGHQRUPDV1+76$86&2'(&+$37(5
)HGHUDO0RWRU9HKLFOH6DIHW\6WDQGDUGDQG5HJXODWLRQ)0966)0965
DVtFRPRODQRUPD)0966TXHGHWHUPLQDORVUHTXLVLWRVSDUDODUHVLVWHQFLD
PHFiQLFDHQODVXQLRQHVVROGDGDVXWLOL]DGDVHQyPQLEXVHVFRODUHV
2.4 TIPOS DE CARROCERÍAS PARA TRANSPORTE PÚBLICO EN
ECUADOR
/DVFRQ¿JXUDFLRQHVGHFDUURFHUtDVOHJDOPHQWHDSUREDGDV\GHVWLQDGDVDOWUDQVSRUWH
S~EOLFRHQHO(FXDGRUVHEDVDQHQODV1RUPDV\5HJODPHQWRV,1(1DSOLFDGRVDO
7UDQVSRUWH 7UiQVLWR \ 6HJXULGDG 9LDO \ VHJ~Q OD $JHQFLD 1DFLRQDO GH 7UDQVLWR
HVWiQFRQVWLWXLGDVSRU
•
•
Buses urbanos
Vehículos de transporte escolar
•
•
Vehículos de transporte interprovincial e intraprovincial
9HKtFXORVDXWRPRWRUHV9HKtFXORVGHWUHVUXHGDVSDUDWUDQVSRUWHGHSDVDMHURV
\SDUDWUDQVSRUWHGHFDUJD
2.4.1 BUSES URBANOS
8Q EXV XUEDQR OODPDGR WDPELpQ DXWRE~V S~EOLFR R GH WUiQVLWR HV XQ PHGLR GH
transporte de personas para distancias cortas o medianas, utilizado generalmente
SDUD HO VHUYLFLR GH WUDQVSRUWH GHQWUR GH OD FLXGDG \ FX\DV UXWDV \ SDUDGDV HVWiQ
HVWDEOHFLGDVVHJ~QODVFDUDFWHUtVWLFDVGHODVFLXGDGHVVRQFRQVWUXLGRVFRQFDPD
EDMDRPRGL¿FDGRVDHVWUXFWXUDVGHWXERFRPRHVHOFDVRGHORVGHQRPLQDGRVEXV
tipo en Ecuador, se diferencian de los buses interprovinciales utilizados en largas
GLVWDQFLDVHQTXHSXHGHQOOHYDUSHUVRQDVSDUDGDV
Figura 2.1 Bus urbano de Ecuador5
5
2.4.2 VEHÍCULOS DE TRANSPORTE ESCOLAR
Son vehículos destinados al servicio de transporte de estudiantes pertenecientes
DODVHVFXHODVSULPDULDVGHWDPDxRSHTXHxRRPHGLDQRVHORVGLVWLQJXHSRUVHU
GHFRORUDPDULOORRQDUDQMD6XVDVLHQWRVVRQSHTXHxRV\GLVSRQHQGHXQDVLHQWR
UHVHUYDGRSDUDODSHUVRQDTXHVXSHUYLVDDORVHVWXGLDQWHV
6HJ~QHOQ~PHURGHSDVDMHURV\RFXSDQWHSXHGHQVHUFODVL¿FDGRVHQIXUJRQHWDV
PLFURE~V0LQLE~V\%XV57(,1(1
Figura 2.2 Transporte escolar de Ecuador7
2.4.3 VEHÍCULOS
DE
INTRAPROVINCIAL
TRANSPORTE
INTERPROVINCIAL
E
(FXDEXV5HFXSHUDGRKWWSZZZHFXDEXVQHW1XHYRV%XVHVKWPO
6HUYLFLR(FXDWRULDQRGH1RUPDOL]DFLyQ5HFXSHUDGRKWWSZZZQRUPDOL]DFLRQJREHFZS
FRQWHQWXSORDGVGRZQORDGVUWHBBUSGI
KWWSZZZMDFHFXDGRUFRPEXVHWDV
15
(VWH WLSR GH YHKtFXOR GH WUDQVSRUWH HVWi GLVHxDGR SDUD WUDQVSRUWDU QXPHURVDV
SHUVRQDV PHGLDQWH YtDV GH LQWHUFRQH[LyQ SURYLQFLDO$ YHFHV DVXPHQ OD IXQFLyQ
GHOWUDQVSRUWHHQWUHFDQWRQHVGHXQDPLVPDSURYLQFLDFXDQGRODYLGD~WLOHVWiSRU
WHUPLQDU6XFDSDFLGDGYDUtDHQWUH\SDVDMHURVVHQWDGRV(VWHWLSRGHEXV
en Ecuador es manufacturado a partir de la base de un chasis importado, dada
la planta de energía con la que generalmente están equipados, alcanzan altas
YHORFLGDGHVHQFDUUHWHUDDXQHVWDQGRDPi[LPDFDUJD
Figura 2.3 Bus interprovincial de Ecuador8
8
2.4.4 VEHÍCULOS DE TRES RUEDAS PARA TRANSPORTE DE PASAJEROS
6HJ~QORGH¿QHODQRUPDWpFQLFDHFXDWRULDQD17(,1(1HVXQYHKtFXOR
RPRWRFLFOHWDGHWUHVUXHGDVFX\DSDUWHSRVWHULRUFRQVLVWHHQXQHVSDFLRGHVWLQDGR
SDUDHOWUDQVSRUWHFRPHUFLDOGHSDVDMHURVRSDUDHOWUDQVSRUWHFRPHUFLDOGHFDUJD
Figura 2.4 Tricimoto de Ecuador
(FXDEXV5HFXSHUDGRKWWSZZZHFXDEXVQHW%XVHV6FDQLDKWPO
2.5 MATERIALES UTILIZADOS EN CONSTRUCCIONES
CARROCERÍAS DE BUSES EN ECUADOR
DE
2.5.1 INDUSTRIA CARROCERA EN ECUADOR
/DLQGXVWULDPHWDOPHFiQLFDHFXDWRULDQDTXHGHGLFDVXVDFWLYLGDGHVDODFRQVWUXFFLyQ
GH FDUURFHUtDV SDUD WUDQVSRUWH GH SDVDMHURV EXVHV VH HQFXHQWUD FDOL¿FDGD SRU
SDUWHGHODVHVFXHODVSROLWpFQLFDVHQEDVHGHOFRQYHQLRFRQOD(PSUHVD3~EOLFDGH
0RYLOLGDG\2EUDV3~EOLFDVVHGHWDOODQHQHODQH[R$
2.5.2 MATERIALES
UTILIZADOS
PARA
LA
CONSTRUCCIÓN
DE
CARROCERÍAS EN ECUADOR
/DVLQGXVWULDVFDUURFHUDVGHWDOODGDVHQHO$QH[R$VRQFHUWL¿FDGDVSRUODV(VFXHODV
Politécnicas del Ecuador mediante convenio con la Empresa Municipal de Obras
3~EOLFDVGH4XLWR³(00234´&DGDXQDJXDUGDODUHVHUYDGHVXVGLVHxRV\GHO
WLSRGHPDWHULDOTXHXWLOL]D
/DQRUPDGHFRQVWUXFFLyQ17(,1(1HVWDEOHFHTXHHOPDWHULDODXWLOL]DU
HQODFDUURFHUtDGHEHVHUSHU¿OHVHVWUXFWXUDOHVSURWHJLGRVFRQWUDODFRUURVLyQTXH
FXPSODQFRQODV17(,1(1FRUUHVSRQGLHQWHV(QOD7DEODVHLQGLFDORVSHU¿OHV
XWLOL]DGRV\HOPDWHULDOXWLOL]DGRSRUFRQVWUXFWRUDVGHFDUURFHUtDVGHYHKtFXORVGH
WUDQVSRUWHS~EOLFR
Tabla 2.1
3HU¿OHV\PDWHULDOHVXWLOL]DGRHQFDUURFHUtDVGHO(FXDGRr
PERFIL
Canal U 100x50x2mm
MATERIAL
ACERO GALVANIZADO
Canal U 25x50x2mm
ACERO GALVANIZADO
3HU¿O2PHJDPP
Plancha 1.5 mm
Tubo Cuadrado 40x40x2mm
ACERO GALVANIZADO
ACERO GALVANIZADO
ACERO GALVANIZADO
Tubo Cuadrado 40x40x2mm
ACERO GALVANIZADO
Tubo Cuadrado 50x50x2mm
ACERO GALVANIZADO
Tubo Cuadrado 50x50x2mm
ACERO GALVANIZADO
PARTE DE LA CARROCERÍA
Piso
Lat. Izq. + Lat. Der. + Techo
(Refuerzo)
Refuerzo del techo
Lat. Izq. + Lat. Der. (Refuerzo)
Piso
Plataforma + Frente + Respaldo
+ Techo
Lat. Izq. + Lat. Der. + Techo
(Principal)
Contravientos
Continua..
Tubo Cuadrado 50x50x3mm
ACERO GALVANIZADO
Piso + Apoyos
Tubo Cuadrado 50x50x3mm
$QJXOR[[PP
ACERO GALVANIZADO
ACERO GALVANIZADO
Curva R 80mm
ACERO GALVANIZADO
Piso + Apoyos
Lat. Izq. + Lat. Der. (Faldón)
Piso + Lat. Izq. + Lat. Der.
3HU¿O[[PP
3HU¿O[[[[PP
7XER5HFWDQJXODU[[PP
7XER5HFWDQJXODU[[PP
ACERO GALVANIZADO
ACERO GALVANIZADO
ACERO GALVANIZADO
ACERO GALVANIZADO
(Vértice)
Placas - Chasis
Lat. Izq. + Lat. Der. (Refuerzo)
Piso
Piso
2.5.3 ACERO GALVANIZADO
(Q FDUURFHUtDV VH XWLOL]D JHQHUDOPHQWH HO DFHUR FRQ OD GHQRPLQDFLyQ $,6, galvanizado/DVSURSLHGDGHVVHVHxDODQHQOD7DEOD
Tabla 2.2
3URSLHGDGHVPHFiQLFDVGHO$FHUR$,6,
Composición Química
C (Carbón)
Fe (Hierro)
0Q0DQJDQHVR
Ni (Niquel)
Cr (Cromo)
P (Fósforo)
Si (Silicio)
Propiedades Mecánicas
0yGXORGH<RXQJ
Densidad
0yGXORGHÀH[LyQ
Módulo de corte
Módulo de
compresibilidad
Ratio de Poisson's
Límite Elástico
Resistencia a la Tracción
Mínimo
0.08
0
8
18
0.045
1
Mínimo
200
7.8e3
200
Máximo
0.08
2
10,5
20
Unidad
%
%
%
%
%
1
Máximo
215
H
215
%
Unidad
GPa
.JP
GPa
GPa
158
175
GPa
0.285
250
505
310
----MPa
MPa
0DQXDOWpFQLFRGHO$FHUR*DOYDQL]DGR$&(6&2
5HFXSHUDGR KWWSZZZDFHVFRFRPGRZQORDGVPDQXDO0*DOYDQL]DGRSGI KWWSLQFRFRPX\
LQVWLWXFLRQDOSURSLHGDGHV
18
Continua...
Módulo de Ruptura
(Resistencia a la Flexión)
(ORQJDFLyQ
Dureza Vickers
5HVLVWHQFLDDOD)DWLJDD
107 Ciclos
505
MPa
108
47
173
% Deformación
HV
203
MPa
Fuente: KWWSZZZD]RPFRPDUWLFOHDVS["$UWLFOH,' 2.6 INGENIERÍA ASISTIDA PARA ANÁLISIS
FRONTALES
DE
IMPACTOS
+R\ HQ GtD HO DYDQFH \ XVR GH OD LQJHQLHUtD DVLVWLGD VH HQFXHQWUD H[WHQGLGR
ampliamente en todos los campos de la ciencia, gracias a los constantes avances
HLQYHVWLJDFLRQHVTXHVHGDQHQODFLHQFLD\WHFQRORJtDHOGHVDUUROORGHPHMRUHV
HTXLSRVGHFRPSXWDFLyQ\GHVRIWZDUHTXHVRQXWLOL]DGRVQRVyORHQODLQYHVWLJDFLyQ
VLQRHQHOGHVDUUROORGHQXHYRVSURGXFWRV(VWRVSURJUDPDVLQIRUPiWLFRVSHUPLWHQ
HO DQiOLVLV \ VLPXODFLyQ GH ORV QXHYRV GLVHxRV GH LQJHQLHUtD FRQ HO REMHWLYR GH
YDORUDU ODV FDUDFWHUtVWLFDV SURSLHGDGHV FRPSRUWDPLHQWR ¿DELOLGDG YLDELOLGDG \
PHGLU ODUHQWDELOLGDG GHXQGLVHxR HVWRSHUPLWH DGHPiV RSWLPL]DU VXGHVDUUROOR
RSWLPL]DQGR ORV FRVWRV GH IDEULFDFLyQ HO WLHPSR GH GHVDUUROOR ODV SUXHEDV GH
IXQFLRQDPLHQWR
(Q OD LQGXVWULD DXWRPRWUL] HO XVR GH OD LQJHQLHUD DVLVWLGD HV PX\ XWLOL]DGD H
imprescindible, los altos índices de accidentes en las carreteras obligan a que los
GLVHxDGRUHV \ IDEULFDQWHV GH YHKtFXORV DXPHQWHQ OD VHJXULGDG GH ORV RFXSDQWHV
HQHOFDVRGHFROLVLyQ\SDUDORJUDUHVWRVHUHTXLHUHGHSURJUDPDVLQIRUPiWLFRVGH
VLPXODFLyQTXHSHUPLWDQXQHVWXGLRYLUWXDOSUHYLRDODFRQVWUXFFLyQGHXQSURWRWLSR
GHYHUL¿FDFLyQ&RQGpV1RYLOOR
(Q OD LQGXVWULD DXWRPRWUL] HO XVR GH OD LQJHQLHUtD DVLVWLGD HQ ORV HVWXGLRV \
VLPXODFLyQ GH LPSDFWR IURQWDO HVWi EDVDGR HQ HO SURJUDPD GH VLPXODFLyQ /6
'<1$XWLOL]DGDFRPRKHUUDPLHQWDSDUDLPSOHPHQWDUHOPRGHOR\SDUDYLVXDOL]DUORV
UHVXOWDGRVVHXWLOL]DHO/635(3267/RVGRVSURJUDPDVHVWiQGHVDUUROODGRVSRU
ODFRPSDxtDQRUWHDPHULFDQD/LYHUPRUH6RIWZDUH7HFKQRORJ\&RUSRUDWLRQ/67&\
VRQDPSOLDPHQWHXWLOL]DGRVHQODLQGXVWULDDXWRPRYLOtVWLFDSDUDDQDOL]DUGLVHxRVGH
YHKtFXORV\PiVFRQFUHWDPHQWHSDUDHYDOXDUODVHJXULGDGTXHpVWRVRIUHFHQDQWH
situaciones de impacto (/LYHUPRUH6RIWZDUH7HFKQRORJ\&RUSRUDWLRQ)
2.6.1 LS - DYNA
/6 '<1$ HV XQ SURJUDPD GH HOHPHQWRV ¿QLWRV FDSD] GH VLPXODU FRPSOHMRV
SUREOHPDVTXHVHSUHVHQWDQHQODUHDOLGDG(VXWLOL]DGRSRUODVLQGXVWULDVDXWRPRWUL]
DHURHVSDFLDOFRQVWUXFFLyQPLOLWDUHVGHIDEULFDFLyQ\GHELRLQJHQLHUtD
(O SURJUDPD GH /V'<1$' HV XQ SURJUDPD H[SOtFLWR QR OLQHDO GH HOHPHQWRV
¿QLWRV6HSXHGHREWHQHUODUHVSXHVWDWUDQVLWRULDGHVyOLGRV\HVWUXFWXUDVHQWUHV
GLPHQVLRQHVVXMHWRVDJUDQGHVGHIRUPDFLRQHV/DIRUPXODFLyQEiVLFDXWLOL]DGDHQ
HOSURJUDPDHVWiEDVDGDHQODREWHQFLyQGHODVHFXDFLRQHVGHPRYLPLHQWRGHXQ
VLVWHPDGHULYDGDVGHOSULQFLSLRGHFRQVHUYDFLyQGHOPRPHQWXPInstituto Mexicano
GHO7UDQVSRUWH&RPSRUWDPLHQWRDO&KRTXHGHORV9HKtFXORV
(Q HO DQiOLVLV WUDQVLWRULR GH XQ HVWXGLR VH UHTXLHUH HVSHFL¿FDU ODV FRQGLFLRQHV
LQLFLDOHVTXHSDUDHOSUHVHQWHSUR\HFWRVHHVSHFL¿FDQFRPRYHORFLGDGHVLQLFLDOHV
El programa permite simular una amplia variedad de condiciones de frontera
DSOLFDEOHV D OD PD\RUtD GH ORV SUREOHPDV GH LQJHQLHUtD (VWDV FRQGLFLRQHV VH
UH¿HUHQDODVFDUJDVDSOLFDGDV\DODVLPXODFLyQGHVXSHU¿FLHVGHFRQWDFWRORFXDO
SHUPLWHPRGHODUODLQWHUDFFLyQPHFiQLFDHQWUHGRVFXHUSRVRHQWUHGRVSDUWHVGHO
PLVPRFXHUSR
/DGLVFUHWL]DFLyQGHOVLVWHPDFRQVLGHUDHOEDODQFHGHOPRPHQWXPOLQHDOHQODIRUPD
³GpELO´GHOWUDEDMRYLUWXDO(VGHFLUGHODIRUPXODFLyQLQWHJUDOGHODVHFXDFLRQHVGH
gobierno del sistema, aplicado a estas el principio del trabajo virtual, a diferencia de
ODH[SUHVLyQGHODVHFXDFLRQHVGHJRELHUQRHQIRUPDGHHFXDFLRQHVGLIHUHQFLDOHV
&RPRHOSURJUDPDHPSOHDXQHVTXHPDGHLQWHJUDFLyQH[SOLFLWDHOFiOFXORGHXQD
PDJQLWXGSDUDXQWLHPSRGDGRVHUHDOL]DDSDUWLUGHPDJQLWXGHV\DFRQRFLGDVSDUD
ese tiempo), cuando el problema implica un comportamiento no lineal, se requiere
ODHYDOXDFLyQGHOEDODQFHGHODHQHUJtDSDUDDVHJXUDUODHVWDELOLGDGGHOVLVWHPD
3DUDUHDOL]DUHVWDHYDOXDFLyQGHOHVWDGRGHODHQHUJtDGXUDQWHHOPLVPRODHFXDFLyQ
ODHQHUJtDVHLQWHJUDUHVSHFWRDOWLHPSRFX\RVLJQL¿FDGRItVLFRVHUH¿HUHDTXHHO
WUDEDMR UHDOL]DGR SRU ODV IXHU]DV H[WHUQDV VH FRQYLHUWH HQ HQHUJtD FLQpWLFD \ D
RWURVWLSRVGHHQHUJtDFRPRODDOPDFHQDGDSRUHOVLVWHPDHQIRUPDHOiVWLFD\D
OD GLVLSDGD GHELGR D OD GHIRUPDFLyQ SOiVWLFD (VWH EDODQFH HV XQ LQGLFDGRU GH OD
20
FRQYHUJHQFLDGHODQiOLVLV6&7,07
/RVRUtJHQHVGHOFyGLJRVHEDVDQPD\RUPHQWHHQHODQiOLVLVQROLQHDO\GHHOHPHQWRV
¿QLWRV FRQ GLQiPLFD WUDQVLWRULD PHGLDQWH OD LQWHJUDFLyQ HQ WLHPSR H[SOtFLWD /6
'<1$$ERXW
(O WHUPLQR ³ 1R OLQHDO ³ VLJQL¿FD TXH DO PHQRV XQR \ D YHFHV WRGDV ODV
VLJXLHQWHVLPSOLFDFLRQHVHVWpQSUHVHQWHV
•
•
•
Cambio de las condiciones de frontera (como el contacto entre las partes que
cambia con el tiempo)
Deformaciones grandes (por ejemplo, el arrugamiento de piezas de chapa)
Materiales no lineales, que no presentan comportamiento idealmente elástico
SRUHMHPSORSROtPHURVWHUPRSOiVWLFRV
En cambio, el término “dinámica transitoria“ implica realizar análisis de alta velocidad,
HYHQWRVGHFRUWDGXUDFLyQGRQGHODVIXHU]DVGHLQHUFLDVRQLPSRUWDQWHVORVXVRV
WtSLFRVLQFOX\HQ
•
$FFLGHQWH$XWRPRWUL]GHIRUPDFLyQGHOFKDVLVODDFWLYDFLyQGHDLUEDJIXHU]D
GHWHQVLyQHQHOFLQWXUyQGHVHJXULGDG
Explosiones (Minas, naval bajo el agua , cargas huecas)
•
Manufactura (hoja de metal estampado)
•
Figura 2.5 Accidente simulado en LS-DYNA
21
/RVFDPSRVGHDQiOLVLVGHO/6'<1$VHGHWDOODQHQOD)LJXUDHLQFOX\HQ
Figura 2.6 Campos de Análisis de LS-DYNA
/63UHSRVW
/63UHSRVWHVXQDYDQ]DGRSUH\SRVSURFHVDGRUTXHVHLQFOX\HFRQHOSURJUDPD
/6'<1$/DLQWHUID]GHOXVXDULRKDVLGRGLVHxDGDSDUDVHUH¿FLHQWHHLQWXLWLYD
/63UHSRVWVHHMHFXWDHQSURJUDPDVTXHXWLOL]DQJUi¿FRV2SHQ*/SDUDORJUDUXQ
UHQGHUL]DGR\SORWHRUiSLGRHQ;<(QOD)LJXUDVHREVHUYDXQDDSOLFDFLyQGHO
SRVSURFHVR
22
Figura 2.7 Ejemplo pos proceso LS-DYNA10
10
(OSUHSURFHVDPLHQWRLQFOX\HKHUUDPLHQWDVXWLOL]DGDVSDUDGH¿QLUHOPDOODGRPDOODGR
GH VXSHU¿FLH PDOODGR GH VyOLGR KHUUDPLHQWDV SDUD HGLFLyQ GHO PDOODGR PDOODGR
'SRUEORTXHV\DSOLFDFLRQHVHVSHFLDOHV)RUMDGHPHWDOHVSRVLFLRQDPLHQWRGH
PDQLTXt)LMDFLyQRPRQWDMHGHFLQWXUyQGHVHJXULGDGFRPSUREDFLyQGHSHQHWUDFLyQ
FRPSUREDFLyQGHPRGHOR
/6237
/6237 HV XQ SURJUDPD LQGHSHQGLHQWH SDUD OD RSWLPL]DFLyQ GHO GLVHxR UHDOL]D
XQ DQiOLVLV SUREDELOtVWLFR FRQ XQD LQWHUID] SDUD HO /6'<1$ TXH VH EDVD HQ OD
PHWRGRORJtD GH VXSHU¿FLH GH UHVSXHVWD 560 TXH HV XQ FRQMXQWR GH WpFQLFDV
HVWDGtVWLFDV\PDWHPiWLFDV~WLOHVSDUDGHVDUUROODUPHMRUDU\RSWLPL]DUHOSURFHVR
GHGLVHxR
10 /LYHUPRUH6RIWZDUH7HFKQRORJ\&RUSRUDWLRQ5HFXSHUDGR KWWSZZZOVWFFRPDSSOLFDWLRQV
23
/D RSWLPL]DFLyQ GHO GLVHxR HV XQ SURFHVR GH FRQ¿JXUDFLyQ GH ODV YDULDEOHV GH
GLVHxRWtSLFDPHQWHODVGLPHQVLRQHVGHXQSURGXFWRSDUDPLQLPL]DURPD[LPL]DU
HO YDORU GH VX UHVSXHVWD 8QD IRUPD PiV JHQHUDO GH RSWLPL]DFLyQ LQFOX\H OtPLWHV
HVSHFt¿FRVVREUHRWUDVUHVSXHVWDVRSWLPL]DFLyQUHVWULQJLGD
/6237 SURSRUFLRQD XQ HQWRUQR GH VLPXODFLyQ TXH SHUPLWH OD GLVWULEXFLyQ GH ORV
WUDEDMRVGHVLPXODFLyQDWUDYpVGHP~OWLSOHVSURFHVDGRUHVRHTXLSRVFRQHFWDGRVHQ
UHG&DGDWUDEDMRGHVLPXODFLyQVHHMHFXWDHQSDUDOHOR
2.6.2 ANSYS LS-DYNA
(O SURJUDPD $16<6 /6'<1$ LQWHJUD ODV FDUDFWHUtVWLFDV SURSLDV GHO SURJUDPD
H[SOtFLWRGHHOHPHQWRV¿QLWRVTXHGLVSRQHHO/6'<1$FRQODVH¿FDFHVSUHVWDFLRQHV
GHSUH\SRVSURFHVDPLHQWRGHOSURJUDPD$16<6(OPpWRGRH[SOtFLWRGHVROXFLyQ
XWLOL]DGRSRU/6'<1$RIUHFHUiSLGDVVROXFLRQHVSDUDWLHPSRVPX\FRUWRVJUDQGHV
GHIRUPDFLRQHV GLQiPLFDV UHVXHOYH SUREOHPDV FXDVLHVWiWLFRV TXH SUHVHQWDQ
JUDQGHV GHIRUPDFLRQHV HVWXGLRV P~OWLSOHV QR OLQHDOHV \ SUREOHPDV FRPSOHMRV
GH FRQWDFWR R GH LPSDFWR (O XVR GH HVWH SURGXFWR LQWHJUDGR SXHGH PRGHODU OD
HVWUXFWXUDHQ$16<6REWHQHUODVROXFLyQGLQiPLFDH[SOtFLWDDWUDYpVGH/6'<1$
\ UHYLVDU ORV UHVXOWDGRV XWLOL]DQGR ODV KHUUDPLHQWDV GH SRV SURFHVR HVWiQGDU GH
$16<6
6HSXHGHWUDQVIHULUWDPELpQODJHRPHWUtD\ODLQIRUPDFLyQGHORVUHVXOWDGRVHQWUH
$16<6 \ $16<6 /6'<1$ SDUD HMHFXWDU VHFXHQFLDOPHQWH DQiOLVLV LPSOtFLWRV
explícitos o explícitos implícitos, así como los necesarios para test de impacto,
HODVWLFLGDG\RWUDVDSOLFDFLRQHV$16<6+HOS9LHZHU
2.7 MODELADO MATEMÁTICO
/DPRGHODFLyQPDWHPiWLFDXWLOL]DGDSDUDHOHVWXGLRGHLPSDFWRVVHKDGHVDUUROODGR
FDGD YH] UiSLGR \ FRQ XQD PD\RU SUHFLVLyQ JUDFLDV DO GHVDUUROOR GH DOJRULWPRV
GH FiOFXOR PiV UHDOLVWDV OHQJXDMHV GH SURJUDPDFLyQ KHUUDPLHQWDV GH VRIWZDUH
PDWHPiWLFRFRPRHO0$7/$%:ROIUDP0DWKHPDWLFD0DSOH0DWK&DGHQWUHRWURV
XVRGHHTXLSRVGHFyPSXWRFRQPD\RUHV\PHMRUHVSUHVWDFLRQHVTXHD\XGDQDOD
UHVROXFLyQGHORVPRGHORVPDWHPiWLFRV
/DDSOLFDFLyQGHORVPRGHORVPDWHPiWLFRVHQHVWXGLRVGHLPSDFWRFRQVLGHUDODV
condiciones físicas, velocidades de desplazamiento, componentes estructurales,
PDWHULDOHVJHRPHWUtDVFRQGLFLRQHVGHFDUJD\HVIXHU]RHQWUHRWURV6LQHPEDUJR
HVWRVPRGHORVVRQPX\FRPSOHMRVSDUDVXGHVDUUROOR\UHVROXFLyQVHUHTXLHUHQGH
ODFRPSUREDFLyQH[SHULPHQWDO\VXYDOLGDFLyQ(VSRUHVWRTXHFRQHODSDUHFLPLHQWR
GHSURJUDPDVLQIRUPiWLFRVHVSHFLDOL]DGRVVHKDSRGLGRDYDQ]DUQRVyORHOXVRGH
PRGHOR PDWHPiWLFRV VLQR HQ HVWDEOHFHU XQD SURFHVR \ QRUPDWLYD D XWLOL]DU SDUD
UHDOL]DU ODV SUXHEDV GH LPSDFWR RUJDQLVPRV FRPR OD )+:$ )HGHUDO +LJKZD\
$GPLQLVWUDWLRQ \ OD 1+76$ 1DWLRQDO +LJKZD\ 7UDႈF 6DIHW\ $GPLQLVWUDWLRQ D
WUDYpVGHOD1&$&7KH1DWLRQDO&UDVK$QDO\VLV&HQWHUVHHQFDUJDGHQRUPDU\
HVWDEOHFHUORVPRGHORVPDWHPiWLFRVDXWLOL]DUHQODVLQYHVWLJDFLRQHVGHLPSDFWR
(Q OD DFWXDOLGDG HO SURFHVR GH GLVHxR GH HVWUXFWXUDV GH YHKtFXORV D LPSDFWR
se basa en modelos matemáticos con base en la respuesta a pulso de choque
/XPSHG0DVV6SULQJ/06RHQPRGHORVGHHOHPHQWRV¿QLWRV)()LJXUDV\
SURSRUFLRQDQXQDGHVFULSFLyQHVTXHPiWLFDGHORVGRVSURFHVRV3DXO'X%RLV
HWDO
Figura 2.8 Esquema LMS para diseño de nueva estructura
25
Figura 2.9 Esquema MEF para diseño de una nueva estructura
2.8 SIMULACIONES PARA ANÁLISIS DE IMPACTOS
(Q HO iPELWR GH OD VLPXODFLyQ \ DQiOLVLV GH LPSDFWR IURQWDO H[LVWHQ WUDEDMRV GH
LQYHVWLJDFLyQFRPRHOSUHVHQWDGRSRU4LDQJ/LHWDOTXHSODQWHDHODQiOLVLV
\PHMRUDHQHOGLVHxR&$(GHXQEXVGHGRVSLVRVDQWHXQLPSDFWRIURQWDOFRQHO
¿QGHHVWXGLDUODVFDUDFWHUtVWLFDVGHGHIRUPDFLyQ\ODVHJXULGDGHQXQDFFLGHQWHGH
LPSDFWRIURQWDODQDOL]DODGHIRUPDFLyQHQHUJtDDEVRUELGD\OHVLRQHVHQPDQLTXtHV
HQXQDHVWUXFWXUDDQWHV\GHVSXpVGHODVPHMRUDV
6XSDNLW5RRSSDNKXQHWDOGHVDUUROODXQDQiOLVLVSRUHOHPHQWRV¿QLWRVGHO
impacto frontal en un bus de cama alta de dos pisos con el objetivo de establecer
HOFRPSRUWDPLHQWRHVWUXFWXUDO\GHGHIRUPDFLyQWRWDOGHOPLVPRDQWHHOLPSDFWR\
SUR\HFWDUHOXVRGHDWHQXDGRUHVGHLPSDFWRTXHSHUPLWDODDEVRUFLyQGHODHQHUJtD
GHLPSDFWRSDUDJDUDQWL]DUXQHVSDFLRGHVXSHUYLYHQFLDVX¿FLHQWHSDUDHOFRQGXFWRU
\HOSDVDMHURGHODVLHQWRGHODQWHURHQFDVRGHXQDFFLGHQWH
3DWWDUDPRQ-RQJSUDGLVWHWDOSUHVHQWDXQHVWXGLRSDUDDQDOL]DU\HYDOXDU
ODUHVLVWHQFLDHVWUXFWXUDOGHDXWREXVHV\ODVFDUDFWHUtVWLFDVGHGHIRUPDFLyQGHXQD
FDUURFHUtDDQWHXQFKRTXHIURQWDOVREUHODEDVHGHODQRUPDWLYD(&(5FRQVLGHUD
HQSULPHUOXJDULQYHVWLJDUVREUHUHVLVWHQFLDDOLPSDFWRGHOEXVVHJ~QODQRUPDH
LGHQWL¿FDUODVSDUWHVGHODHVWUXFWXUDHQODTXHVHUHTXLHUHHOIRUWDOHFLPLHQWRROD
UHDOL]DFLyQGHPRGL¿FDFLRQHVSDUDVDWLVIDFHUODUHJXODFLyQ
Puesto que el análisis del modelo completo toma recurso informático considerable,
XQ PRGHOR )( VLPSOL¿FDGR WDPELpQ VH FRQVLGHUD (Q HO PRGHOR VLPSOL¿FDGR VH
LQFOX\HQ VyOR ODV SDUWHV GHODQWHUDV GHO DXWRE~V D ORV SLODUHV /DV SDUWHV GH OD
FDUURFHUtD TXH QR WLHQHQ QLQJ~Q HIHFWR VLJQL¿FDWLYR HQ OD VDOLGD ¿QDO GH LPSDFWR
IURQWDOVHHOLPLQDQGHOPRGHOR3DWWDUDPRQ-RQJSUDGLVWHWDO
/DV WpFQLFDV PDWHPiWLFDV XWLOL]DGDV SRU ORV SURJUDPDV FRPSXWDFLRQDOHV SDUD OD
VROXFLyQ GH SUREOHPDV \ VLPXODFLRQHV GH LQJHQLHUtD HVWUXFWXUDO R PHFiQLFD GH
ÀXLGRVLQLFLDOPHQWHVHEDVDURQHQODVGLIHUHQFLDV¿QLWDVOXHJRVHDGRSWyHOPpWRGR
SRUHOHPHQWRV¿QLWRVHOFXDOHQODDFWXDOLGDGHVHOPiVFRP~QPHQWHXWLOL]DGRSRU
ORVSDTXHWHVGHDVLVWHQFLDFRPSXWDFLRQDOHQHOFDPSRLQJHQLHULO
/D PD\RUtD GHO VRIWZDUH &$( GLVSRQHQ GH PyGXORV HVSHFt¿FRV TXH SHUPLWHQ OD
UHDOL]DFLyQ GH HVWXGLRV R VLPXODFLRQHV GH WLSR OLQHDO R QR OLQHDO HVWUXFWXUDOHV
DQiOLVLVGHYLEUDFLyQ&)'HQWUHRWURVDVtFRPRKHUUDPLHQWDVSDUDODUHDOL]DFLyQ
GH VLPXODFLRQHV SDUD DQiOLVLV GH LPSDFWR TXH VH EDVDQ HQ WUHV HWDSDV HO SUH
SURFHVRHOVROYHU\HOSRVSURFHVR
7RGDVLPXODFLyQSDUDXQDQiOLVLVGHLPSDFWRSRUVXVFDUDFWHUtVWLFDVVHEDVDHQHO
desarrollo de un análisis de dinámica explicita, requiere principalmente seguir una
PHWRGRORJtDTXHFRQVLVWHHQIRUPDJHQHUDOGHWUHVHWDSDVSULQFLSDOHV/6'<1$
7KHRU\0DQXDO
&RQVWUXFFLyQGHOPRGHOR
$SOLFDFLyQGHODVFDUJDV\REWHQFLyQGHUHVXOWDGRV\
5HYLVLyQHLQWHUSUHWDFLyQGHORVUHVXOWDGRV
2.8.1 CONSTRUCCIÓN DEL MODELO (EL PRE-PROCESO)
Esta etapa permite introducir los datos de entrada para realizar el proceso de
VLPXODFLyQTXHFRPLHQ]DFRQODFRQVWUXFFLyQGHOPRGHORVHLQLFLDFRQUHSUHVHQWDU
el sistema físico a ser analizado, considerando las dimensiones, tipos de elementos
D XWLOL]DU VKHOO EHDP \ UHVWULFFLRQHV VH HVSHFL¿FD ODV FDUDFWHUtVWLFDV GH ORV
PDWHULDOHVVHGH¿QHHOPRGHORQRGRV\HOHPHQWRVODJHQHUDFLyQGHOWLSRGHPDOOD
WULDQJXODUSDUDFDVFDUDVRWHWUDKpGULFRSDUDVyOLGRVVHGH¿QHODVUHODFLRQHVGH
FRQWDFWRHQWUHVXSHU¿FLHV
2.8.2 APLICACIÓN DE LAS CARGAS Y OBTENCIÓN DE RESULTADOS
(SOLVER)
6H HVSHFL¿FDQ ODV FDUJDV D DQDOL]DU HQ HO HVWXGLR TXH SXHGHQ VHU GHELGR D
desplazamientos, rotaciones, fuerzas, momentos, velocidades, aceleraciones (sobre
los nodos), velocidades angulares , temperaturas, presiones, desplazamientos,
rotaciones, velocidades, fuerzas, momentos, velocidades angulares sobre cuerpos
UtJLGRVVHVLJXHFRQODFRQ¿JXUDFLyQGHODVYHORFLGDGHVLQLFLDOHVUHVWULFFLRQHVGH
PRYLPLHQWR GH GHVSOD]DPLHQWR R URWDFLyQ GHO PRGHOR JUDGRV GH OLEHUWDG GH ORV
DFRSODPLHQWRVVHHVSHFL¿FDHOFRQWUROGHODGLQiPLFDH[SOLFLWDHVWDEOHFLHQGRHOWLSR
GHFRQWUROGHUHORMGHDUHQDWLHPSRGHWHUPLQDFLyQFRQWUROGHSDVRVGHLWHUDFLyQ
LQWHUYDORVGHVDOLGDGHGDWRVUHVROXFLyQ\JUDEDFLyQGHEDVHGHGDWRVJHQHUDGRV
(QHVWDHWDSDVHUHVXHOYHGHIRUPDLWHUDWLYDODVHFXDFLRQHV\ODVFRQGLFLRQHVGDGDV
HQ HO SUHSURFHVR OR TXH SHUPLWH REWHQHU UHVXOWDGRV TXH VHUiQ SRVWHULRUPHQWH
UHYLVDGRVHLQWHUSUHWDGRVHQHOSRVSURFHVR
&DEHLQGLFDUTXHHQHVWDHWDSDHVGHVXPDLPSRUWDQFLDGH¿QLUFRUUHFWDPHQWHHO
WLSRGHFRQWUROGHUHORMGHDUHQDKRXUJODVVTXHVHXWLOL]DUiSDUDHODQiOLVLV\TXH
HVWiHQIXQFLyQGHOWLSRGHHOHPHQWRTXHVHXWLOL]DVyOLGRRPHPEUDQD(OFRQWURO
GHO UHORM GH DUHQD HV XQ PRGR QR ItVLFR GH GHIRUPDFLyQ TXH VH SURGXFH HQ ORV
HOHPHQWRVQRLQWHJUDGRV\TXHQRJHQHUDQHVIXHU]RV\ORTXHKDFHHVSHUPLWLUXQ
GRPLQLRGHPDOODPHGLDQWHODDSOLFDFLyQGHIXHU]DVLQWHUQDVSDUDUHVLVWLUORVPRGRV
GHGHIRUPDFLyQGHOKRXUJODVVDWUDYpVGHXQRGHORVYDULRVDOJRULWPRVGHFRQWURO
TXHH[LVWHQSDUDHOHIHFWR
2.8.3 REVISIÓN E
PROCESO)
INTERPRETACIÓN
DE
LOS
RESULTADOS
(POS
6HSUHVHQWDQGHPDQHUDQXPpULFD\JUi¿FDORVUHVXOWDGRVSURGXFWRGHODVLPXODFLyQ
QXPpULFDGHOPRGHORHQWHURRGHSXQWRVGHLQWHUpVHVSHFt¿FRVHQXQSHUtRGRGH
WLHPSRVHSXHGHJHVWLRQDUXQDJUDQFDQWLGDGGHGDWRVHLQIRUPDFLyQJHQHUDGDV
HQODIDVHDQWHULRU
28
Figura 2.10 Esquema estructurado de una análisis de dinámica explícita
2.9 EL MÉTODO DEL ELEMENTO FINITO APLICADO A ANÁLISIS
DE IMPACTO
Castigliano, et al, a inicios del siglo xx desarrollaran un método que basado en
ODV HFXDFLRQHV GH IXQFLRQHV GH IRUPD GH XQ VLVWHPD GH FDUJD VHQFLOOR SHUPLWLy
pronosticar el desplazamiento de una estructura, obteniéndose los resultados por
XQDPLQLPL]DFLyQGHODHQHUJtD$PHGLDGRVGH5LFKDUG&RXUDQWGHVDUUROORXQ
HVWXGLRTXHVLUYHGHEDVHHQODUHVROXFLyQGHVLVWHPDVHVWUXFWXUDOHVDOLPSOHPHQWDU
ODQRWDFLyQPDWULFLDO\VXUHVROXFLyQDOJHEUDLFD
'HVGH HVH LQVWDQWH \ JUDFLDV DO FRQVWDQWH GHVDUUROOR TXH KDQ H[SHULPHQWDGR ODV
FRPSXWDGRUDV HQ VXV SUHVWDFLRQHV GH FiOFXOR JHVWLyQ GH GDWRV YHORFLGDG GH
SURFHVDPLHQWR DVt FRPR HO GHVDUUROOR \ GLIXVLyQ GH QXHYRV PpWRGRV GH DQiOLVLV
QXPpULFRV TXH VXVWLWX\HQ D ORV PpWRGRV LWHUDWLYRV SUHGRPLQDQWHV PpWRGRV GH
&URVV\.DQLTXHVHUHVROYtDQGHPDQHUDPDQXDOHOPpWRGRGHORVHOHPHQWRV¿QLWRV
DSOLFDGRHQYDULRVFDPSRVFRPRFiOFXORHVWUXFWXUDOOLQHDOIHQyPHQRVGLQiPLFRV\
térmicos, estudios no lineales, entre otros, ha permitido que se extienda su uso en
SUiFWLFDPHQWHWRGRVORVFDPSRVGHODLQJHQLHUtD
'HQWURGHODPHFiQLFDGHOVyOLGRGHIRUPDEOHVXVDSOLFDFLRQHVSXHGHQDJUXSDUVH
HQ GRV JUDQGHV VLVWHPDV SUREOHPDV DVRFLDGRV D VLVWHPDV GLVFUHWRV \ VLVWHPDV
FRQWLQXRV(QORVSULPHURVHOVLVWHPDVHGLYLGHHQHOHPHQWRVGH¿QLGRVFODUDPHQWH
En los segundos, no puede ser subdividido de manera original en unidades simples,
GHELpQGRVH HPSOHDU OD UHVROXFLyQ DQDOtWLFD GH HFXDFLRQHV GLIHUHQFLDOHV TXH HQ
SUREOHPDVFRPSOHMRVSUHVHQWDXQDJUDQGL¿FXOWDGDVtVXUJHHOSULQFLSLRGHO0()
0pWRGR GH ORV (OHPHQWRV )LQLWRV TXH VH EDVD HQ OD UHGXFFLyQ GHO SUREOHPD
FRQLQ¿QLWRVJUDGRVGHOLEHUWDGHQXQSUREOHPDFRQXQQ~PHUR¿QLWRGHYDULDEOHV
DVRFLDGDVDSXQWRVFDUDFWHUtVWLFRVGHQRPLQDGRVQRGRV
/DLGHDJHQHUDOGHO0()FRQVLVWHHQODGLYLVLyQGHXQPHGLRFRQWLQXRHQXQFRQMXQWR
GH SHTXHxRV HOHPHQWRV LQWHUFRQHFWDGRV SRU XQD VHULH GH SXQWRV FRPXQHV HQWUH
Vt OODPDGRV QRGRV$Vt ODV HFXDFLRQHV TXH ULJHQ HO FRPSRUWDPLHQWR GHO FRQWLQXR
UHJLUiQWDPELpQHOGHOHOHPHQWR
'HHVWDIRUPDVHORJUDSDVDUGHXQVLVWHPDFRQWLQXRFRQLQ¿QLWRVJUDGRVGHOLEHUWDG
TXHHVUHJLGRSRUXQDHFXDFLyQGLIHUHQFLDORXQVLVWHPDGHHFXDFLRQHVGLIHUHQFLDOHV
DXQVLVWHPDFRQXQQ~PHURGHJUDGRVGHOLEHUWDG¿QLWRFX\RFRPSRUWDPLHQWRVH
PRGHODSRUXQVLVWHPDGHHFXDFLRQHVOLQHDOHVRQRTXHGHSHQGHGHOWLSRGHDQiOLVLV
)LJXUD3URFHVRSDUDHOXVRGHOPpWRGRGHHOHPHQWRV¿QLWRV
(QOD)LJXUDVHPXHVWUDHOSURFHVRTXHXVDHOPpWRGRGHORVHOHPHQWRV¿QLWRV
partiendo del sistema físico se pasa a un modelo discreto mediante un proceso
GH GLVFUHWL]DFLyQ XQD YH] UHVXHOWR VH SXHGH YHUL¿FDU HO PRGHOR GLVFUHWR GLFKD
YDOLGDFLyQUHTXLHUHHVWDEOHFHUXQHUURUGHVLPXODFLyQTXHHVWiHQIXQFLyQGHOHUURU
QXPpULFRTXHVHGDHQODVROXFLyQGHODVHFXDFLRQHVJHQHUDGDVHQHOPRGHOR
(OUHVXOWDGR¿QDOGHOPRGHORVHYHUL¿FDFRPSDUDQGR\FRQWUDVWDQGRORVUHVXOWDGRV
FRQVROXFLRQHVREWHQLGDVHQPpWRGRVH[SHULPHQWDOHVRWHyULFRVH[LVWHQWHVSURFHVR
TXHFRQVWLWX\HODYDOLGDFLyQGHOPRGHOR'XUDQWHHOGHVDUUROORGHOPpWRGRVHSXHGHQ
30
SUHVHQWDUHUURUHVSRUHIHFWRVGHODGLVFUHWL]DFLyQGHODIRUPXODFLyQ\SRUORVHUURUHV
QXPpULFRV
El método permite estudiar también problemas no lineales, donde exista contacto
HQWUHORVFRPSRQHQWHVJUDQGHVGHIRUPDFLRQHVGLYHUVRVPRGRVGHIDOOR\HIHFWRV
GLQiPLFRV8QFDVRGHHVWHWLSRVRQODVVLPXODFLRQHVGHFKRTXHRLPSDFWRFRPR
HQ HO SUHVHQWH SUR\HFWR GHELGR D TXH HQ XQ FKRTXH IURQWDO ORV PDWHULDOHV TXH
DEVRUEHQ OD HQHUJtD GHO LPSDFWR H[SHULPHQWDQ JUDQGHV GHIRUPDFLRQHV \ HQWUDQ
HQOD]RQDSOiVWLFDHQGRQGHGHVDSDUHFHODUHODFLyQGHOLQHDOLGDGHQWUHWHQVLyQ\
GHIRUPDFLyQ,OOHVFDV'/ySH]%
/D VLPXODFLyQ GH LPSDFWRV SRU HO PpWRGR GHO HOHPHQWR ¿QLWR JHQHUDOPHQWH VH OD
DERUGDSRUPHGLRGHVRIWZDUHTXHSHUPLWHQJHQHUDUXQDDVLVWHQFLDFRPSXWDFLRQDO
SDUD OD VROXFLyQ PDWHPiWLFD GH HVWRV SUREOHPDV GH LQJHQLHUtD TXH VXHOHQ VHU
EDVWDQWHFRPSOHMRV$QWHULRUPHQWHVHKDPHQFLRQDGRD/6'<1$FRPRXQRGH
ORVSURJUDPDVPiVUHSUHVHQWDWLYRVHQDSOLFDFLRQHVGHLQJHQLHUtDGHLPSDFWRV+R\
HQGtDJUDFLDVDORVDYDQFHV\UHFXUVRVFRPSXWDFLRQDOHVVHFRQVLJXHQHVWXGLRV\
VLPXODFLRQHVGHFKRTXHVPiVUHDOHVTXHSHUPLWHQDODVFRPSDxtDVFRQVWUXFWRUDV
GHYHKtFXORVSUREDUVXVGLVHxRVGHPDQHUDYLUWXDODQWHVGHHPSUHQGHUHQSURFHVRV
GHSURGXFFLyQDKRUUDQGRWLHPSR\GLQHUR
/D)LJXUDPXHVWUDXQFKRTXHODWHUDOVLPXODGRFRQ/6'<1$GHXQYHKtFXOR
FRQWUDXQFDUURHQFX\RIURQWDOVHKD¿MDGRXQDEDUUHUDGHIRUPDEOH(OLPSDFWRVH
SURGXFHHQHOODGRGHOFRQGXFWRU
11
Figura 2.12 Simulación de impacto con LS-DYNA11
KWWSZZZ[LWDGHOFRPOVG\QD
31
CAPÍTULO III
ANÁLISIS DE LA CARROCERÍA TIPO DE UN BUS PARA
TRANSPORTE INTERPROVINCIAL EN
ECUADOR, BAJO LA ACCIÓN DE CARGAS DE IMPACTO.
3.1 IMPORTACIÓN DE LA GEOMETRÍA AL SOFTWARE
ESPECIALIZADO DE ANÁLISIS MECÁNICO COMPUTACIONAL
Considerando la norma técnica de construcción de carrocería, INEN NTE 1323,
DVtFRPRODVHVSHFL¿FDFLRQHVSDUDORVHVSDFLRVGHVXSHUYLYHQFLDYHU$QH[R&
VHSUR\HFWySDUDHIHFWRVGHODQiOLVLVODFDUURFHUtDGHEXVWLSRLQWHUSURYLQFLDOTXHVH
REVHUYDHQOD)LJXUD
Figura 3.1 Planos de la carrocería tipo de un bus interprovincial
6H JHQHUy HO GLEXMR WULGLPHQVLRQDO GH OD FDUURFHUtD KDFLHQGR XVR GHO VRIWZDUH
6SDFH&ODLP GH$16<6 YHUVLyQ SUHYLy D OD VLPXODFLyQ (Q OD )LJXUD VH
REVHUYDHOERFHWRGHODHVWUXFWXUDGHOEXVWLSRLQWHUSURYLQFLDOHQ'
32
Figura 3.2 Boceto de la estructura del bus en 3D
(QOD)LJXUDVHREVHUYDODFDUURFHUtDWLSRGHOEXVLQWHUSURYLQFLDOFRPSOHWD
Figura 3.3 Carrocería tipo de bus interprovincial
33
(VWXGLRVLQWHUQDFLRQDOHVVLPLODUHVDOSUHVHQWH6XSDNLW5RRSSDNXQHWDO\
3DWWDURP-RQJSUDGLVWHWDO\EDVDGRVHQODQRUPD(&(5XWLOL]DQXQD
SRUFLyQGHODFDUURFHUtDFRPREDVHSDUDVXVHVWXGLRVGHELGRDOJDVWRFRPSXWDFLRQDO
TXHSUHVHQWDHOWUDEDMDUFRQWRGDODFDUURFHUtD\SRUODVSDUWHVGHODFDUURFHUtDTXH
QRWLHQHQQLQJ~QHIHFWRVLJQL¿FDWLYRHQODVDOLGD¿QDOGHLPSDFWRIURQWDOODVPLVPDV
VHHOLPLQDQGHOPRGHOR
3DUDHIHFWRVGHOSUHVHQWHHVWXGLRDVXPLHQGR\FRQVLGHUDQGRTXHODVGHIRUPDFLRQHV
PD\RUHVHVWDUiQSUHVHQWHHQODSDUWHGHODQWHUDGHODFDUURFHUtDVHFRQVLGHUDXWLOL]DU
DSUR[LPDGDPHQWHHOGHODORQJLWXGWRWDOGHOEXVODPLVPDTXHVHGHQRPLQDUi
FRPR³FDELQD´SRUWDOUD]yQODVPDVDVFRQVLGHUDGDVVHUiQODGHORVSHU¿OHVTXH
LQWHUYLHQHQHQODVHFFLyQGHHVWXGLR\DODVTXHVHOHDJUHJDUiODPDVDGHOUHVWRGH
ODFDUURFHUtDDVtORVUHVXOWDGRVFRUUHVSRQGHUiQDODVFDUJDVGHLPSDFWRJHQHUDGDV
SRUGLFKDVPDVDV
6H UHFRUWy OD ORQJLWXG GH FDELQD \ VH DVLJQy D FDGD HOHPHQWR GH OtQHD VX
FRUUHVSRQGLHQWHSHU¿OHVWUXFWXUDOVHWRPDHQFRQVLGHUDFLyQODVVHFFLRQHVTXHVH
XWLOL]DQSDUDHIHFWXDUODFRQVWUXFFLyQGHODVFDUURFHUtDVGHEXVLQWHUSURYLQFLDOHQHO
(FXDGRU(OGHWDOOHGHORVSHU¿OHVVHPXHVWUDHQOD7DEODFRQUHIHUHQFLDDOD
)LJXUD
Figura 3.4 Detalle de materiales de la carrocería del bus interprovincial
Tabla 3.1
0DWHULDOHV\SHU¿OHVXWLOL]DGRVHQFDUURFHUtDV
IDENTIFICACIÓN
A
B
C
D
E
F
G
H
I
J
K
L
M
N
O
P
Q
R
S
T
DENOMINACIÓN
Placa de acero 1,5 mm
Tubo cuadrado de 50 x 50 x 2 mm
Tubo cuadrado de 50 x 50 x 2 mm
Tubo cuadrado de 50 x 50 x 2 mm
Placa de acero 1,5 mm
Tubo cuadrado de 50 x 50 x 2 mm
Placa de acero 1,5 mm
Tubo cuadrado de 50 x 50 x 2 mm
Tubo cuadrado de 50 x 50 x 2 mm
Tubo cuadrado de 50 x 50 x 2 mm
Tubo cuadrado de 50 x 50 x 2 mm
Tubo cuadrado de 50 x 50 x 2 mm
Canal “U” 25 x 50 x 2 mm
Tubo cuadrado de 50 x 50 x 2 mm
Tubo cuadrado de 50 x 50 x 2 mm
3HU¿O2PHJDPP
Tubo cuadrado de 50 x 50 x 2 mm
Tubo cuadrado de 50 x 50 x 2 mm
3HU¿O[[[[PP
Canal “U” 25 x 50 x 2 mm
MATERIAL
Acero Galvanizado
Acero Galvanizado
Acero Galvanizado
Acero Galvanizado
Acero Galvanizado
Acero Galvanizado
Acero Galvanizado
Acero Galvanizado
Acero Galvanizado
Acero Galvanizado
Acero Galvanizado
Acero Galvanizado
Acero Galvanizado
Acero Galvanizado
Acero Galvanizado
Acero Galvanizado
Acero Galvanizado
Acero Galvanizado
Acero Galvanizado
Acero Galvanizado
6HH[WUX\HFDGDSHU¿ODPRGRGHVXSHU¿FLHFRQVLGHUDQGRODVHFFLyQJHRPHWUtD
\ ORQJLWXG UHTXHULGD HQ FDGD HOHPHQWR 6H REWXYR HO PRGHOR &$' WHQLHQGR HQ
FXHQWD TXH ORV HOHPHQWRV GHEHU HVWDU XQLGRV HQ ORV QRGRV GH OD HVWUXFWXUD HQ
FRQGLFLRQHVDWRSH6HXWLOL]DQODVKHUUDPLHQWDVGLVSRQLEOHVHQ6SDFH&ODLPFRPR
VRQFRUWHGLYLGLUFRPELQDUSUR\HFWDUHQWUHRWUDVOD)LJXUDPXHVWUDXQHMHPSOR
GHOUHVXOWDGRREWHQLGR
Figura 3.5 Acabados en los nodos de la carrocería
(OUHVXOWDGR¿QDOGHOSURFHVRGHGLEXMRDVLVWLGRSRUFRPSXWDGRUVHREVHUYDHQOD
)LJXUD\)LJXUD
Figura 3.6 Carrocería de bus tipo interprovincial en tres dimensiones
Figura 3.7 Vista lateral de la cabina del bus tipo interprovincial
/D FDELQD VH JXDUGD HQ OD H[WHQVLyQ VFGRF QDWLYD GH 6SDFH&ODLP GH$16<6
HVWHVRIWZDUHWLHQHODSDUWLFXODULGDGGHHVWDUYLQFXODGRDO:RUNEHQFKGHWDOPDQHUD
TXHVHSXHGHLQJUHVDUODJHRPHWUtDDO$16<6VLQSUREOHPDVHVPiVGLQiPLFRTXH
FRQRWUDVDSOLFDFLRQHV&$'
3.2 VERIFICACIÓN DE LA GEOMETRÍA
6HSXHGHYHUL¿FDUHOGLEXMRWULGLPHQVLRQDOGHGRVPDQHUDVODSULPHUDVHUHDOL]D
PHGLDQWHVRIWZDUHHVSHFLDOL]DGRVHQWUHORVFXDOHVGHVWDFDQ&$'GRFWRU(O\VLXP
&$'GRFWRU (; &$'GRFWRU 1;12 (VWRV SURJUDPDV WUDGXFHQ R UHSDUDQ GLVHxRV
&$' ODV DSOLFDFLRQHV YHUL¿FDQ OD JHRPHWUtD \ PHMRUDQ VXV GDWRV ' WLHQHQ OD
SRVLELOLGDGGHVLPSOL¿FDFLyQGHGDWRVSDUDDQiOLVLV&$(KHUUDPLHQWDVGHRSHUDFLyQ
\OLPSLH]DGHJHRPHWUtDSDUDSURWRWLSRVUiSLGRVHLQJHQLHUtDLQYHUVD
/DVHJXQGDDOWHUQDWLYDGHYHUL¿FDFLyQHVYLVXDOHOGLVHxDGRUDFW~DGLUHFWDPHQWH
VREUH FLHUWDV LQWHUIHUHQFLDV TXH SXHGHQ GDUVH SRU HIHFWR GH ODV RSHUDFLRQHV
JHQHUDGDVHQHOSURFHVRGHGLEXMR([LVWHQSURJUDPDVGH&$'TXHD\XGDQDOD
GHWHFFLyQGHIDOODVHQHOPRGHORGHGLEXMRPHGLDQWHKHUUDPLHQWDVYLVXDOHV
(QHOSUHVHQWHWUDEDMRVHFRPSUXHEDODJHRPHWUtD\SRVLEOHLQWHUIHUHQFLDPHGLDQWH
KHUUDPLHQWDVGHGHWHFFLyQGHLQWHUIHUHQFLDTXHSRVHHHOVRIWZDUH6SDFH&ODLP
6HWUDEDMDHOPRGHORGHODHVWUXFWXUDGHODFDELQDKDVWDVXSULPLUWRGRVORVH[FHVRV
SRU HIHFWR GH LQWHUIHUHQFLDV FDXVDGDV SRU FUXFHV HQWUH SHU¿OHV HVWUXFWXUDOHV (Q
OD)LJXUDVHYLVXDOL]DHOSURFHVRGHGHWHFFLyQGHYHUL¿FDFLyQGHODJHRPHWUtD
PHGLDQWH6SDFH&ODLP
)LJXUD9HUL¿FDFLyQGHODJHRPHWUtDGHODFDUURFHUtD
12
(/6<6,05HFXSHUDGRKWWSHO\VLXPLQFFRPSURGXFWVFDGGRFWRUIRUQ[
3.3 GENERACIÓN DE LA MALLA PARA ANÁLISIS POR MEF
/D JHQHUDFLyQ GH PDOOD SDUD DQiOLVLV SRU HOHPHQWRV ¿QLWRV HV XQ WHPD TXH KD
JHQHUDGRDWHQFLyQHQHVSHFLDOLVWDVGHPHFiQLFDFRPSXWDFLRQDO/DVUD]RQHVVRQ
P~OWLSOHV8QDGHODVLPSRUWDQWHVIXHTXHDOSULQFLSLRODPDOODVXSHU¿FLDOSUHVHQWD
XQ HIHFWR VREUH OD H[DFWLWXG GH ODV VROXFLRQHV QXPpULFDV HQ SDUWH UHODFLRQDGD
FRQODVFRQGLFLRQHVGHFRQWRUQR\ODFRQYHUJHQFLDGHOHVTXHPDFRPSXWDFLRQDOHQ
VLPXODFLRQHVQXPpULFDVEDVDGDVHQHOHPHQWRVRIURQWHUDV¿QLWRV
Por otra parte, las técnicas de mallado tridimensional se basan en mallas de
VXSHU¿FLH R FRQWRUQRV HQ HO SUHVHQWH HVWXGLR HO WLSR GH PDOOD D XWLOL]DU HQ HO
HVWXGLRSRUODVFDUDFWHUtVWLFDVGHORVHOHPHQWRVDQDOL]DGRVHVXQDPDOODGHOWLSR
SDUDOHOHStSHGR
3.3.1 DISEÑO DE LA MALLA PARA EL ESTUDIO A CARGAS DE IMPACTO
FRONTAL DE LA CARROCERÍA DE UN BUS TIPO INTERPROVINCIAL
UTILIZADO EN ECUADOR
/DVFRQGLFLRQHVGHPDOODSDUDHOSUHVHQWHHVWXGLRVHEDVDQHQHOUHTXHULPLHQWRGHO
PRGHORPDWHPiWLFRTXHSHUPLWDDQDOL]DUHOSUREOHPDGHLPSDFWRGHODFDELQDGHVGH
XQSXQWRGHYLVWDQROLQHDOSDUDHVWRVHXWLOL]DHOPyGXORGHGLQiPLFDH[SOtFLWDHQ
HO$16<6
/D GLQiPLFD H[SOtFLWD HVWi GLVHxDGD SDUD VLPXODU DSOLFDFLRQHV PHFiQLFDV
HVWUXFWXUDOHVTXHLPSOLFDQXQRRPiVGHORVVLJXLHQWHVFDVRV $16<6+HOS9LHZHU
$SSHQGL[)([SOLFLW'\QDPLFV7KHRU\*XLGH
,PSDFWRGHEDMDYHORFLGDG>[email protected]\DOWDYHORFLGDG>[email protected]
3URSDJDFLyQGHODRQGDGHHVIXHU]RV
5HVSXHVWDGLQiPLFDGHDOWDIUHFXHQFLD
/DVJUDQGHVGHIRUPDFLRQHV\ODVQROLQHDOLGDGHVJHRPpWULFDV
&RQGLFLRQHVGHFRQWDFWRFRPSOHMDV
&RPSRUWDPLHQWRFRPSOHMRGHORVPDWHULDOHV
5HVSXHVWDHVWUXFWXUDOQROLQHDOLQFOX\HQGRHOSDQGHR
(OIDOORGHFRQWDFWRVVROGDGXUDVRVXMHFLRQHV
3URSDJDFLyQGHRQGDVGHFKRTXHDWUDYpVGHVyOLGRV\OtTXLGRV
&XHUSRVUtJLGRV\ÀH[LEOHV
(QHOSUHVHQWHDQiOLVLVVHSUHVHQWDQORVQXPHUDOHV\ORTXHREOLJD
DODFRQ¿JXUDFLyQGHXQDPDOODXWLOL]DGDHQGLQiPLFDH[SOtFLWD
/DFDELQDHVWiFRQIRUPDGDSRUHOHPHQWRVHVWUXFWXUDOHVGHVXSHU¿FLHSRUHOORHV
PHQHVWHUGLVHxDUXQDPDOODFRQHOHPHQWRVLGyQHRVSDUDHVDFDUDFWHUtVWLFD\TXH
FXPSODQ OR UHTXHULGR SRU OD GLQiPLFD H[SOtFLWD VHJ~Q$16<6 VH UHFRPLHQGD HO
HOHPHQWR³6+(//´
3.3.1.1 Shell 163
(VXQHOHPHQWRGHQRGRVFRQFDSDFLGDGHVGHÀH[LyQ\GHPHPEUDQD3HUPLWHQ
FDUJDVHQHOSODQR\QRUPDOHVHQDPERVFDVRV(OHOHPHQWRWLHQHJUDGRVGH
OLEHUWDGHQFDGDQRGRWUDVODFLRQHVDFHOHUDFLRQHV\YHORFLGDGHVHQORVQRGRVHQ
ODVGLUHFFLRQHV[\]\URWDFLyQDOUHGHGRUGHORVHMHVQRGDOHV[\](VWHHOHPHQWR
HVXVDGRVRODPHQWHHQORVDQiOLVLVGHGLQiPLFDH[SOLFLWD
(VWH WLSR GH HOHPHQWR SHUPLWH GRFH IRUPXODFLRQHV GLIHUHQWHV $O LJXDO TXH FRQ
ORV HOHPHQWRV VyOLGRV HO Q~PHUR GH SXQWRV GH LQWHJUDFLyQ SRU HOHPHQWR DIHFWD
GLUHFWDPHQWHHQHOWLHPSRGHSURFHVDPLHQWRGHO&383RUORWDQWRSDUDORVDQiOLVLV
JHQHUDOHVVHUHFRPLHQGDODIRUPXODFLyQGHPHPEUDQDGHLQWHJUDFLyQUHGXFLGD
Los sistemas de coordenadas para la salida de las cantidades asociadas con
6+(//SXHGHYDULDUSDUDGLIHUHQWHVIRUPXODFLRQHV/DVIRUPXODFLRQHVJHQHUDOHV
GHOHOHPHQWR6KHOOVRQ
%HO\WVFKNR7VD\.(<237 RSRUGHIHFWR
•
•
0X\UiSLGR\VHUHFRPLHQGDSDUDODPD\RUtDGHDSOLFDFLRQHV
8WLOL]DODLQWHJUDFLyQUHGXFLGDXQSXQWR
•
1RGHEHVHUXWLOL]DGRFXDQGRORVHOHPHQWRVH[SHULPHQWDQGHIRUPDFLyQH[FHVLYD
%HO\WVFKNR:RQJ&KLDQJ.(<237 •
•
PiVOHQWRTXH%HO\WVFKNR7VD\
8WLOL]DODLQWHJUDFLyQUHGXFLGDXQSXQWR
•
3RUORJHQHUDOGDUHVXOWDGRVFRUUHFWRVHQHOSDQGHR
%HO\WVFKNR/HYLDWKDQ.(<237 •
PiVOHQWRTXH%HO\WVFKNR7VD\
•
•
8WLOL]DODIRUPXODFLyQGHLQWHJUDFLyQUHGXFLGDXQSXQWR
,QFOX\HFRQWUROGHUHORMGHDUHQDItVLFDGHIRUPDDXWRPiWLFD
7RWDOPHQWHLQWHJUDGR%HO\WVFKNR7VD\.(<237 •
YHFHVPiVOHQWDTXHODLQWHJUDFLyQUHGXFLGDGHODFiVFDUD%HO\WVFKNR7VD\
•
•
7LHQHFXDWURSXQWRVGHLQWHJUDFLyQHQHOSODQR\QRQHFHVLWDFRQWUROGHUHORMGH
DUHQD
(O HVIXHU]R GH FL]DOODPLHQWR VH UHPHGLD SRU OD WHQVLyQ VXSXHVWD SDUD HO
•
FL]DOODPLHQWRWUDQVYHUVDO
6HUHFRPLHQGDVLORVPRGRVGHUHORMGHDUHQDVRQXQSUREOHPDHQHODQiOLVLV
+XJKHV/LX.(<237 !SUHVHQWDFXDWURIRUPXODFLRQHVGLIHUHQWHV
TXHSXHGHQFRPSHQVDUODGLVWDQFLDDOSODQRPHGLRGHOHOHPHQWRGHVGHORVQRGRV
.(<237 *HQHUDO +XJKHV/LX7LHQH OD LQWHJUDFLyQ GH XQ SXQWR \ HV YHFHVPiVOHQWDTXH%HO\WVFKNR7VD\
.(<237 )DVW+XJKHV/LXFRUURWDFLRQDO7LHQHODLQWHJUDFLyQGHXQSXQWR
\HVYHFHVPiVOHQWRTXH%HO\WVFKNR7VD\
.(<237 65+XJKHV/LX7LHQHFXDWURSXQWRVGHLQWHJUDFLyQVLQQLQJ~Q
FRQWUROGHDUHQDSHURHVYHFHVPiVOHQWDTXH%HO\WVFKNR7VD\
.(<237 65FRUURWDFLRQDO+XJKHV/LX7LHQHFXDWURSXQWRVGHLQWHJUDFLyQ
VLQQLQJ~QFRQWUROGHDUHQDYHFHVPiVOHQWRTXH%HO\WVFKNR7VD\5HFRPHQGDGR
VLHOUHORMGHDUHQDHVXQSUREOHPDHQHODQiOLVLV
Supuestos y restricciones del SHELL163
• /RV HOHPHQWRV GH iUHD FHUR QR HVWiQ SHUPLWLGRV (VWR RFXUUH FRQ PD\RU
•
•
IUHFXHQFLDFXDQGRORVHOHPHQWRVQRHVWiQQXPHUDGRVFRUUHFWDPHQWH
1RVHSHUPLWHHOHPHQWRVGHHVSHVRUFHURRHOHPHQWRVTXHGLVPLQX\HQKDVWDXQ
HVSHVRUFHURHQFXDOTXLHUHVTXLQD
8Q HOHPHQWR WULDQJXODU SXHGH HVWDU IRUPDGR PHGLDQWH OD GH¿QLFLyQ GH QRGRV
GXSOLFDGRV . \ / HQ ORV Q~PHURV FRPR VH GHVFULEH HQ HOHPHQWRV GH IRUPD
•
GHJHQHUDGD(QHVWHFDVRHOHOHPHQWRGHODOiPLQDWULDQJXODU&.(<237
VHXWLOL]DUi
8Q FRQMXQWR GH HOHPHQWRV GH VXSHU¿FLH SODQD SXHGH SURGXFLU XQD EXHQD
DSUR[LPDFLyQ DXQDVXSHU¿FLH GHHVWUXFWXUDFXUYDGD FRQODFRQGLFLyQ GHTXH
FDGDHOHPHQWRSODQRQRVHH[WLHQGHPiVVREUHGHXQDUFRGHƒ/D)LJXUD
PXHVWUDFDUDFWHUtVWLFDVIXQGDPHQWDOHVGHOVKHOO 13
Figura 3.9 Características del elemento “Shell 163”
3.4 CONDICIONES DE BORDE DEL ESCENARIO DE SIMULACIÓN
/DVFRQGLFLRQHVGHERUGHDXWLOL]DUHQHOHVFHQDULRGHVLPXODFLyQFRQWHPSODQHO
XWLOL]DU OD QRUPDV 1&$3 GHWHUPLQD TXH HO WHVW GH LPSDFWR VH UHDOLFH FRQWUD XQD
SDUHGUtJLGDDXQDYHORFLGDGGH.PKPVPDVDWRWDOGHODFDUURFHUtDGH
.JVHUHVWULQJHHOPRYLPLHQWRHQHOHMH<FRPRVHREVHUYDHQOD)LJXUD
)LJXUD&RQGLFLRQHVGHERUGHSDUDHOHVFHQDULRGHVLPXODFLyQ
$16<6+HOS9LHZHU$16<6/6'<1$8VHU¶V*XLGH
(QORVDFiSLWHVGHVFULWRVHQHOSXQWRVHGHVFULELyGHPDQHUDJHQHUDOHOSURFHVRD
VHJXLUHQHODQiOLVLV\VLPXODFLyQGHLPSDFWRVDSOLFDQGRHOPLVPRSDUDHOSUHVHQWH
SUR\HFWR FRQ HO REMHWLYR GH HVWDEOHFHU HO HOHPHQWR HVWUXFWXUDO FUtWLFR GHO VLVWHPD
TXHVHUtDDIHFWDGRSRUODFRQGLFLyQGHOLPSDFWRVHWLHQHORVVLJXLHQWHVSXQWRV
3.4.1 PRE PROCESO DE LA SIMULACIÓN
6HOLPLWDHOHVWXGLRDODFDELQDOD)LJXUDLQGLFDODVXSHUHVWUXFWXUDREMHWRGHO
DQiOLVLV
Figura 3.11 Cabina de la carrocería, objeto de análisis
6HXWLOL]DODVFRQGLFLRQHVLQLFLDOHVGHYHORFLGDGPVHQHOPRPHQWRGHOWHVW
GHLPSDFWRFRQWUDXQDSDUHGUtJLGD\VHSURFHGHFRQHOSURFHVRGHFRQ¿JXUDFLyQ
GHODVLPXODFLyQTXHVHGHVFULEHDFRQWLQXDFLyQ
0HGLDQWH6SDFH&ODLPVHJHQHUDODFDELQDGHWDOPDQHUDTXHODVMXQWDVGHORV
SHU¿OHVHVWUXFWXUDOHVVHDQFRPSOHWDPHQWHDWRSHORTXHSHUPLWHTXHVHJHQHUH
XQDFRQGLFLyQ³ERQGHG´SHJDGRGHORVPLHPEURVHVWUXFWXUDOHVTXHIDFLOLWDHO
DQiOLVLVGHGHIRUPDFLyQ
0HGLDQWHHOSOXJLQ³:RUNEHQFK/6'<1$´VHWUDEDMDHQODLQWHUID]GH:RUNEHQFK
GH $16<6 FRQ HO VRIWZDUH GH GLQiPLFD H[SOtFLWD /6'<1$ /D )LJXUD PXHVWUDODFDELQDLQJUHVDGDDOPyGXOR³0HFKDQLFDO´
Figura 3.12 Cabina ingresada a la interfaz de Mechanical en Workbench LS-Dyna
6HUHDOL]DODFRQ¿JXUDFLyQGHOPDWHULDODXVDUHQODFDELQDHQHVWHFDVRDFHUR
JDOYDQL]DGRVHLQJUHVDODVSURSLHGDGHVPHFiQLFDVGHOPDWHULDOGHWDOIRUPD
TXHVHSXHGDWUDEDMDUHQOD]RQDSOiVWLFDVHLQFOX\HODVSURSLHGDGHV³%LOLQHDU
,VRWURSLF+DUGHQLQJ´FRPRVHPXHVWUDHQOD)LJXUD
)LJXUD&RQ¿JXUDFLyQGHODFHURJDOYDQL]DGR
6H DVLJQD HO PDWHULDO FRUUHVSRQGLHQWH D ORV PLHPEURV HVWUXFWXUDOHV VHJ~Q
SODQRVGHFRQVWUXFFLyQ
6HJHQHUDXQVLVWHPDGHFRRUGHQDGDVDX[LOLDUTXHVHVLW~HHQODSDUWHIURQWDO
GHOSDUDFKRTXHVGHODFDUURFHUtDFRQHOREMHWLYRGHEULQGDUGDWRVGHXELFDFLyQ
D OD SDUHG UtJLGD TXH UHTXLHUH HO /6'<1$ SDUD OD FRQ¿JXUDFLyQ GHO LPSDFWR
IURQWDO/D)LJXUDPXHVWUDORGHVFULWR
)LJXUD*HQHUDFLyQGHXQVLVWHPDDX[LOLDUSDUDODJHQHUDFLyQGHODSDUHGUtJLGD
/DV FRQH[LRQHV GH FRQWDFWR IXHURQ VXSULPLGDV OD GLQiPLFD H[SOtFLWD UHTXLHUH
HVDFRQGLFLyQSDUDODVLPXODFLyQ
6HSURFHGHDODFRQ¿JXUDFLyQGHODPDOODVHDVLJQDHOHOHPHQWR6KHOO/6
'<1$QRDFHSWDHOHPHQWRVWHWUDpGULFRVQLSLUDPLGDOHV
6HFRQRFHTXHORVVRIWZDUHV&$(GHGLVHxRPHFiQLFRWUDEDMDQFRQPRGHORV
PDWHPiWLFRVEDVDGRVHQHOHPHQWRV¿QLWRVTXHVHUHVXHOYHQSRUGLIHUHQFLDFLyQ
6HEXVFDJDUDQWL]DUUHVXOWDGRVPHGLDQWHHOXVRGHKHUUDPLHQWDVHVWDGtVWLFDVTXH
HO:RUNEHQFK/6'<1$SRVHHHVGHFLUHVWDEOHFHUHOJUDGRGHFRQYHUJHQFLDGH
UHVXOWDGRVGHODVLPXODFLyQFRQUHVSHFWRDOPXQGRUHDO/RVPRGRVHVWDGtVWLFRV
TXH HO RIUHFH HO VRIWZDUH VRQ FDOLGDG GHO HOHPHQWR HOHPHQW TXDOLW\ UDWLR GH
DVSHFWRDVSHFWUDWLRUDWLRMDFRELDQRMDFRELDQUDWLRIDFWRUGHSDQGHRZDUSLQJ
IDFWRUGHVYLDFLyQGHSDUDOHOHLGDG3DUDOOHOGHVYLDWLRQ
6HXWLOL]DHOFULWHULRGHUDGLRMDFRELDQRTXHSHUPLWHHVWDEOHFHUXQDPHGLGDGH
ODGHVYLDFLyQGHXQHOHPHQWRGDGRFRQUHVSHFWRDRWURGHIRUPDLGHDO(OYDORU
MDFRELDQRRVFLODHQWUHDGRQGHUHSUHVHQWDXQHOHPHQWRGHIRUPD
SHUIHFWD8QDSURSRUFLyQDOWDLQGLFDTXHHOPDSHRHQWUHHOHVSDFLRGHOHOHPHQWR
\HOHVSDFLRGHOHOHPHQWRUHDOVHHVWiFRQYLUWLHQGRHQFRPSXWDFLRQDOPHQWHSRFR
¿DEOH/D)LJXUD\)LJXUDPXHVWUDQUHVSHFWLYDPHQWHODDSOLFDFLyQGHO
FULWHULRMDFRELDQR\ODJUi¿FDGHODHVWDGtVWLFDGHOQ~PHUR\WLSRGHHOHPHQWRV
REWHQLGRV
)LJXUD$SOLFDFLyQGHOFULWHULRGHFRQYHUJHQFLD-DFRELDQR
)LJXUD*Ui¿FRHVWDGtVWLFRGHODPDOODREWHQLGD
6HDVLJQDODYHORFLGDGGHOLPSDFWRGHPVDODFDUURFHUtDSDUDHOHVWXGLR
FRPRVHREVHUYDHQOD)LJXUD
)LJXUD&RQ¿JXUDFLyQGHFRQGLFLRQHVLQLFLDOHVHQODFDELQD9HORFLGDGGHLPSDFWR
(Q OD FRQ¿JXUDFLyQ GHO DQiOLVLV VH VHOHFFLRQD XQ WLHPSR GH V YDORU TXH
se asume para el estudio en referencia a los resultados obtenidos en otras
VLPXODFLRQHVUHDOL]DGDVDVtWDPELpQVHFRQVLGHUDORVXMHULGRSRU$16<6/6
'<1$6HFRQ¿JXUDHOQ~PHURGHSURFHVDGRUHVGLVSRQLEOHVHQHVWHFDVRVRQ
HODQiOLVLVVHHIHFWXyHQXQDPiTXLQDWLSRZRUNVWDWLRQGH*EGHPHPRULD
5$0VHVHOHFFLRQDFRPRHOWLSRGHUHORMGHDUHQD+RXUJODVV7\SHPiVLGyQHR
³)ODQDJDQ %HO\WVFKNR 6WLႇQHVV´ FRQ XQ FRH¿FLHQWH SRU GHIHFWR GH La
)LJXUDPXHVWUDHOSURFHVRLQGLFDGR
)LJXUD&RQ¿JXUDFLyQGHOHVWXGLRWLHPSRSURFHVDGRUHVWLSRGH+RXUJODVV
3.4.2 POS PROCESO DE LA SIMULACIÓN
(O VROYHU XWLOL]DGR HQ HO HVWXGLR HV HO QDWLYR GHO VRIWZDUH /6'<1$ FX\DV
FDUDFWHUtVWLFDVJHQHUDOHVVHGHVFULELHURQHQHOFDStWXOR,,/D)LJXUDPXHVWUD
DOJXQDVSDUWLFXODULGDGHVGHHVWHUHVROYHGRU
Figura 3.19 Detalles del Solver empleado
&DEHLQGLFDUTXHHOWLHPSRGHVROXFLyQGHSHQGHGHODFDOLGDGGHODPDOODDVtFRPR
GHOWLHPSRFRQ¿JXUDGRSDUDHOHVWXGLRHQHOSUHVHQWHSUR\HFWRODJHQHUDFLyQGHO
DQiOLVLV\REWHQFLyQGHUHVXOWDGRVWDUGyFHUFDGHKRUDV
$16<6+HOS9LHZHU6SHFLI\$QDO\VLV6HWWLQJVIRU([SOLFLW'\QDPLFV$QDO\VHV
3.4.2.1 5HVXOWDGRV2EWHQLGRV
3DUD GHWHUPLQDU ORV UHVXOWDGRV TXH VH H[SRQHQ D FRQWLQXDFLyQ IXH QHFHVDULR
UHDOL]DUYDULDVVLPXODFLRQHVHLWHUDFLRQHVDVtFRPRFiOFXORVGHODUHODFLyQHQWUHOD
HQHUJtDLQWHUQD\HO+RXUJODVVFRQHOREMHWRGHYDOLGDUHOHVWXGLR
(Q HO $QH[R ' VH XELFDQ HYLGHQFLDV GH ORV HVWXGLRV SUHYLRV HIHFWXDGRV SDUD
GHWHUPLQDUODVLPXODFLyQFRQVLGHUDUiFRPRFRKHUHQWH\YiOLGD
3DUDODSUHVHQWDFLyQGHORVUHVXOWDGRVH[SUHVDGRVPHGLDQWHJUi¿FRV\FXUYDVTXH
SHUPLWDQDQDOL]DU\HYDOXDUORVUHVXOWDGRVORJUDGRVHQHOSRVSURFHVDGRVHXWLOL]D
HOPyGXOR$3'/GH$16<6TXHSHUPLWHH[WUDHULQIRUPDFLyQGHODVLPXODFLyQ\TXH
SXHGHVHUDSUHFLDGDHQHOSRVSURFHVDGRU/63UHSRVWQDWLYRGH/6'<1$
6HHIHFW~DHOSRVSURFHVDPLHQWRHQ$16<6$3'/SDUDJHQHUDUDUFKLYRVOHJLEOHV
HQ/63UHSRVWOD)LJXUDPXHVWUDHOSURFHVR
Figura 3.20 Procesamiento de datos en ANSYS APDL
6HSURFHGHDOLQJUHVRGHORVDUFKLYRVJHQHUDGRVHQ$16<6$3'/HQ/63UHSRVW
OD)LJXUDPXHVWUDODFDELQDXWLOL]DGDHQHODQiOLVLVDQWHVGHOLPSDFWRIURQWDO
Figura 3.21 Ingreso de datos a LS Prepost 4.2
(Q OD )LJXUD VH REVHUYD OD GHIRUPDFLyQ SURGXFWR GHO LPSDFWR IURQWDO HQ OD
FDELQDDVtFRPRVHFRQ¿UPDTXHORVHOHPHQWRVFUtWLFRVUHVXOWDQVHUORVHOHPHQWRV
TXHFRQIRUPDQHOIURQWDOHOFXDOVHUYLUiGHEDVHSDUDODLGHDOL]DFLyQDUHDOL]DUVHHQ
HO&DStWXOR,9
Figura 3.22 Cabina deformada después del impacto, obtenido en LS Prepost 4.2
(QOD)LJXUDVHREVHUYDHOGHVSOD]DPLHQWRGLUHFFLRQDOHQHOHMH=REVHUYiQGRVH
TXHHOHOHPHQWRSUHVHQWDHOYDORUPi[LPRGHFPVHREVHUYDQDPSOLDFLRQHV
HQHOHOHPHQWRSDUDXQDPHMRUYLVXDOL]DFLyQ
)LJXUD5HVXOWDGRVGHODGHIRUPDFLyQGLUHFFLRQDOHQHOHMH]REWHQLGRVHQ/63UHSRVW
(QOD)LJXUDVHREVHUYDHOHVIXHU]RHIHFWLYRREVHUYiQGRVHTXHHOHOHPHQWR
SUHVHQWD HO YDORU Pi[LPR GH 03D YDORU TXH SXHGH VHU XQD
VLQJXODULGDGGHOSURJUDPDGHQRVHUDVtVHGHWHUPLQDTXHHOHOHPHQWR\DVXIULyOD
URWXUD
Figura 3.24 Resultados del esfuerzo principal de Von Mises, obtenidos en LS Prepost 4.2
(QOD)LJXUDVHREVHUYDODGHIRUPDFLyQXQLWDULDSOiVWLFRREVHUYiQGRVHTXHHO
HOHPHQWRSUHVHQWDHOYDORUPi[LPRGH
)LJXUD5HVXOWDGRVGHODGHIRUPDFLyQXQLWDULDSOiVWLFDREWHQLGRVHQ/63UHSRVW
3.4.2.2 9DOLGDFLyQGHOHVWXGLRFRPSXWDFLRQDO
3DUD YDOLGDU ORV UHVXOWDGRV REWHQLGRV HQ HO HVWXGLR VH KD UHFXUULGR D OD UHODFLyQ
HQWUHODHQHUJtDLQWHUQDGHGHIRUPDFLyQGHLPSDFWRYHUVXVHOYDORUGHODHQHUJtDGHO
+RXUJODVV6LOD(QHUJtDGH+RXUJODVVHVPHQRUDOGHOD(QHUJtD,QWHUQDOD
VROXFLyQHVDFHSWDEOH$16<6+HOS9LHZHU+RXUJODVVLQJ
6HGHWHUPLQDORVYDORUHVGHHQHUJtDLQWHUQDSRULPSDFWRHQXQDJUi¿FDTXHVHH[WUDH
GHO/6'<1$HVWHYDORUHVGH[-DXQWLHPSRGHVDFRQWLQXDFLyQOD
)LJXUDPXHVWUDHOGHWDOOHPHQFLRQDGR
Figura 3.26 Resultados de energía interna por impacto
(O YDORU GHO +RXUJODVV HV GH [ - D XQ WLHPSR GH VHJ OR FXDO VH
PXHVWUDHQOD)LJXUD
)LJXUD5HVXOWDGRVGHOFRQWUROGHUHORMGHDUHQD+RXUJODVVSRULPSDFWR
6HFDOFXODODUHODFLyQHQWUHHO+RXUJODVVREWHQLGR\ODHQHUJtDLQWHUQDSRUGHIRUPDFLyQ
en la cabina:
Hourglass
Energíaint
H
0.68x10 6 J
54x10 6 J
Hourglass
x100%
Energíaint
H 1.26%
H 10%
&RPRHOYDORUGHODUHODFLyQREWHQLGR+HVPHQRUDOVHHVWDEOHFHSRUORWDQWR
TXHHOHVWXGLRSDUDODVFRQGLFLRQHVHVWDEOHFLGDVVHFRQVLGHUDYiOLGR
(QOD)LJXUDVHREVHUYDHOFRPSRUWDPLHQWRGHODHQHUJtDLQWHUQD\GHOFRQWURO
GHUHORMGHDUHQDFRQUHVSHFWRDOWLHPSRREVHUYiQGRVHTXHODUHODFLyQGHOFRQWURO
GHDUHQDUHVSHFWRDODHQHUJtDLQWHUQDHVLQIHULRUDO
Figura 3.28 Comportamiento de la energía interna y control de reloj de arena
(QOD)LJXUDVHREVHUYDHOFRPSRUWDPLHQWRGHODHQHUJtDWRWDOGHOPRGHORHQ
EDVHDODHVWUXFWXUDGHODFDELQDGXUDQWHODSUXHEDGHLPSDFWR/DSUHFLVLyQHVWi
JDUDQWL]DGD\DTXHODHQHUJtDWRWDOWLHQGHDPDQWHQHUVHFRQVWDQWH\ODHQHUJtDGH
UHORMGHDUHQDQRH[FHGLyGHGHODHQHUJtDLQWHUQD
(OFRPSRUWDPLHQWRGHODJUi¿FDGHHQHUJtDWRWDOREWHQLGRSDUDHOSUHVHQWHHVWXGLR
es similar al resultado obtenido en un estudio similar presentado por Pattaramon
-RQJSUDGLVWHWDO
)LJXUD'LDJUDPDGHHQHUJtDGXUDQWHODVLPXODFLyQGHOLPSDFWRHQHOPRGHORGHFDUURFHUtD
tipo de autobús interprovincial
3DWWDURP-RQJSUDGLVWHWDOImprovement of Crashworthiness of bus Structure under Frontal
ImpacW7KH:RUOG&RQJUHVVRQ$GYDQFHVLQ6WUXFWXUDO(QJLQHHULQJDQ0HFKDQLFV$6(0
,QFKHRQ.RUHD$XJXVW
6H FRQFOX\H DGHPiV TXH OD PD\RU GHIRUPDFLyQ VH SURGXFH HQ HO HOHPHQWR
HVWUXFWXUDO GHQRPLQDGR IURQWDO R SDUDFKRTXHV 6H FRQVLGHUDUi HVWD SDUWH FRPR
HOHPHQWRFUtWLFRPLVPRTXHVHUiXWLOL]DGRSDUDHOGHVDUUROORGHODPHWRGRORJtDGH
FiOFXORHQ]RQDSOiVWLFDGHOFDStWXOR,9
3.4.2.3 (VWXGLRHQHOHPHQWRVFUtWLFRVFRQVLGHUDQGRHOGHVSOD]DPLHQWRGLUHFFLRQDOHQ=
&RQ HO REMHWLYR GH HVWDEOHFHU HO FRPSRUWDPLHQWR GH ORV HOHPHQWRV FUtWLFRV GH OD
FDUURFHUtD HQ OD )LJXUD VH LOXVWUD HO GHVSOD]DPLHQWR GLUHFFLRQDO HQ HO HMH
= VH HOLJHQ WUHV HOHPHQWRV DGLFLRQDOHV DGHPiV GHO FUtWLFR SDUD HVWDEOHFHU HO
FRPSRUWDPLHQWR GH ORV PLVPRV FRQVLGHUDQGR SDUiPHWURV FRPR HO HVIXHU]R GH
9RQPLVHVHOGHVSOD]DPLHQWRGLUHFFLRQDO\ODGHIRUPDFLyQSOiVWLFDTXHD\XGHQD
VXVWHQWDUHOFRPSRUWDPLHQWRGHODFDELQD
(Q OD ]RQD FUtWLFD VH SURFHGH D H[WUDHU GDWRV \ UHVXOWDGRV HQ FXDWUR HOHPHQWRV
¿QLWRVGLVWLQWRVTXHVHGHQRPLQDQHOHPHQWR666\6
OD)LJXUDLQGLFDORVHOHPHQWRVYLVXDOL]DGRVDGLIHUHQWHVDPSOLDFLRQHV
)LJXUD(OHPHQWRVVHOHFFLRQDGRVFRPRPXHVWUDVSDUDREWHQFLyQGHUHVXOWDGRV
(OFRPSRUWDPLHQWRGHORVHOHPHQWRVVHOHFFLRQDGRVUHVSHFWRDOHVIXHU]RSULQFLSDO
GH 9RQ PLVHV VH PXHVWUDQ HQ OD )LJXUD FRPR VH REVHUYD HQ HO LQVWDQWH
inmediato al impacto el comportamiento de los cuatro elementos es muy similar
OOHJDQGRDYDORUHVFHUFDQRVD03DYDORUHVTXHVXJLHUHQTXHORVHOHPHQWRV
\D SUHVHQWDQ XQ FRPSRUWDPLHQWR SOiVWLFR D SDUWLU GH GLFKR SXQWR VH SUHVHQWDQ
ÀXFWXDFLRQHV
Figura 3.31 Esfuerzo V-M en los elementos seleccionados
ඔDFXUYDGHODGHIRUPDFLyQSOiVWLFDHQORVHOHPHQWRVVHPXHVWUDHQOD)LJXUD
)LJXUD'HIRUPDFLyQSOiVWLFDHQORVHOHPHQWRVVHOHFFLRQDGRV
ඔD FXUYD GHO GHVSOD]DPLHQWR UHVXOWDQWH UHVSHFWR DO WLHPSR HQ ORV HOHPHQWRV VH
PXHVWUDQHQOD)LJXUD
Figura 3.33 Desplazamiento resultante en los elementos seleccionados
(Q OD )LJXUD VH REVHUYDQ ODV FXUYDV TXH UHSUHVHQWDQ HO HVIXHU]R YHUVXV OD
GHIRUPDFLyQGHFDGDXQRGHORVHOHPHQWRVVHOHFFLRQDGRV
)LJXUD(VIXHU]R90YVGHIRUPDFLyQHQORVHOHPHQWRV
&RQ UHVSHFWR DO HOHPHQWR 6 HOHPHQWR FUtWLFR VH REVHUYD TXH HO
FRPSRUWDPLHQWRGHUHFXSHUDFLyQHOiVWLFDVHSURGXFHKDVWDXQHVIXHU]RGH03D
TXHFRUUHVSRQGHDOYDORUGHOOLPLWHGHÀXHQFLDGHOPDWHULDOFRQXQDGHIRUPDFLyQ
GH(OFRPSRUWDPLHQWRSDUDHODMXVWHOLQHDOSOiVWLFRLVRWUySLFROOHJDKDVWDXQ
HVIXHU]R GH 03D HQ XQ WLHPSR GH V GH LQLFLDGR HO LPSDFWR OXHJR GHO
FXDOVXIUHXQDGLVPLQXFLyQEUXVFDGHOHVIXHU]RDXQWLHPSRGHVGHLQLFLDGRHO
LPSDFWRORTXHLQGLFDHOFRODSVRGHOHOHPHQWR
&RQ UHVSHFWR DO HOHPHQWR 6 VH REVHUYD XQ FRPSRUWDPLHQWR HOiVWLFR KDVWD
XQ HVIXHU]R GH 03D FRQ XQD GHIRUPDFLyQ GH (O FRPSRUWDPLHQWR
SDUDHODMXVWHOLQHDOSOiVWLFRLVRWUySLFROOHJDKDVWDXQHVIXHU]RGH03DHQXQ
WLHPSRGHVGHLQLFLDGRHOLPSDFWR\OOHJDDXQYDORUPi[LPRGH03DTXH
FRUUHVSRQGHDXQWLHPSRGHVOXHJRGHOFXDOVXIUHXQDGLVPLQXFLyQEUXVFDGHO
HVIXHU]RORTXHSUHVXSRQHHOFRODSVRGHOHOHPHQWR
&RQ UHVSHFWR DO HOHPHQWR 6 VH REVHUYD XQ FRPSRUWDPLHQWR HOiVWLFR KDVWD
XQ HVIXHU]R GH 03D FRQ XQD GHIRUPDFLyQ GH (O FRPSRUWDPLHQWR
SDUDHODMXVWHOLQHDOSOiVWLFRLVRWUySLFROOHJDKDVWDXQHVIXHU]RGH03DHQXQ
WLHPSRGHVGHLQLFLDGRHOLPSDFWR\OOHJDDXQYDORUPi[LPRGH03DTXH
FRUUHVSRQGHDXQWLHPSRGHVOXHJRGHOFXDOVXIUHXQDGLVPLQXFLyQEUXVFDGHO
HVIXHU]RORTXHSUHVXSRQHHOFRODSVRGHOHOHPHQWR
&RQ UHVSHFWR DO HOHPHQWR 6 HO FRPSRUWDPLHQWR HV PX\ VLPLODU D ORV GRV
HOHPHQWRV DQWHULRUPHQWH GHVFULWRV DVt VH REVHUYD XQ FRPSRUWDPLHQWR HOiVWLFR
KDVWDXQHVIXHU]RGH03DFRQXQDGHIRUPDFLyQGH(OFRPSRUWDPLHQWR
SDUDHODMXVWHOLQHDOSOiVWLFRLVRWUySLFROOHJDKDVWDXQHVIXHU]RGH03DHQXQ
WLHPSRGHVHJGHLQLFLDGRHOLPSDFWR\OOHJDDXQYDORUPi[LPRGH03D
TXH FRUUHVSRQGH D XQ WLHPSR GH V OXHJR GHO FXDO VXIUH XQD GLVPLQXFLyQ
EUXVFDGHOHVIXHU]RORTXHSUHVXSRQHHOFRODSVRGHOHOHPHQWR
(Q OD )LJXUD VH REVHUYD HO FRPSRUWDPLHQWR GHO HVIXHU]R GH 9RQ PLVHV FRQ
UHVSHFWRDOGHVSOD]DPLHQWRGHORVHOHPHQWRV6HREVHUYDTXHHOFRPSRUWDPLHQWR
de los elementos es muy similar, no se puede diferenciar entre el comportamiento
HOiVWLFRHODVWRSOiVWLFR\SOiVWLFRGHORVHOHPHQWRV6LQHPEDUJRHQODPD\RUtDGH
ORVHOHPHQWRVVHSURGXFHODGLVPLQXFLyQGHOYDORUGHHVIXHU]RHQXQYDORUFHUFDQRDO
OLPLWHGHURWXUDGHOPDWHULDO03DSURGXFLpQGRVHHOFRODSVRGHORVHOHPHQWRV
Figura 3.35 Esfuerzo V-M vs. desplazamiento en los elementos seleccionados
3.4.2.4 (VWXGLRHQHOHPHQWRVFUtWLFRVFRQVLGHUDQGRHOHVIXHU]RGH9RQPLVHV
(QOD)LJXUDVHSUHVHQWyHOHVIXHU]RHIHFWLYR\VHREVHUYyTXHHOYDORUHQHO
HOHPHQWRFUtWLFRIXHGH03DYDORUH[FHVLYDPHQWHDOWRSDUDODVSURSLHGDGHV
mecánicas del material de la cabina, para determinar sí el mismo se constituye
HQ XQD VLQJXODULGDG R HV XQ FRPSRUWDPLHQWR UHDO VH SURFHGH D VHOHFFLRQDU WUHV
HOHPHQWRVDGLFLRQDOHVFHUFDQRVDOD]RQDGHOPHQFLRQDGRHOHPHQWR\VHSUHVHQWD
HOFRPSRUWDPLHQWRVHJ~QORVSDUiPHWURVXWLOL]DGRVHQHODFiSLWH
(Q OD )LJXUD VH LOXVWUD HO HVIXHU]R FRQ ORV WUHV HOHPHQWRV DGLFLRQDOHV
VHOHFFLRQDGRV (Q OD ]RQD FUtWLFD VH H[WUDH GDWRV \ VH SUHVHQWDQ ORV UHVXOWDGRV
HQFXDWURHOHPHQWRV¿QLWRVGLVWLQWRVTXHFRUUHVSRQGHQDORVHOHPHQWRV6
HOHPHQWRFUtWLFR666
Figura 3.36 Elementos seleccionados según esfuerzo de Von mises
(OFRPSRUWDPLHQWRGHORVHOHPHQWRVVHOHFFLRQDGRVUHVSHFWRDOHVIXHU]RSULQFLSDOGH
9RQPLVHVVHPXHVWUDQHQOD)LJXUDFRPRVHREVHUYDHQHOLQVWDQWHLQPHGLDWR
DOLPSDFWRHOFRPSRUWDPLHQWRGHORVFXDWURHOHPHQWRVHVPX\VLPLODUOOHJDQGRD
YDORUHVFHUFDQRVD03DHQORVSULPHURVVOXHJRGHOLPSDFWRHQHOFDVR
GHOHOHPHQWR6VHREVHUYDTXHOXHJRGHWUDQVFXUULGRORVVVHSURGXFH
XQLQFUHPHQWREUXVFRHQHOYDORUGHOHVIXHU]ROOHJDQGRDXQYDORUGH03DHQ
XQWLHPSRGHV\GH03DHQXQWLHPSRGHVYDORUHVTXHFRQ¿UPDQ
TXH HO FRPSRUWDPLHQWR GHO HOHPHQWR 6 VH FRQVWLWX\H HQ XQD VLQJXODULGDG
SURSLDGHOSURJUDPD(VWRVHFRQ¿UPDVLVHREVHUYDHOFRPSRUWDPLHQWRGHORVWUHV
HOHPHQWRVFHUFDQRVTXHHVPX\VLPLODUHQWUHHOORV
Figura 3.37 Esfuerzo V-M en los elementos seleccionados
ඔD FXUYD GHO GHVSOD]DPLHQWR UHVXOWDQWH UHVSHFWR DO WLHPSR GH ORV HOHPHQWRV VH
PXHVWUDHQOD)LJXUD
Figura 3.38 Desplazamiento resultante en los elementos seleccionados
(Q OD )LJXUD VH REVHUYDQ ODV FXUYDV TXH UHSUHVHQWDQ HO HVIXHU]R YHUVXV OD
GHIRUPDFLyQGHFDGDXQRGHORVHOHPHQWRVVHOHFFLRQDGRV
)LJXUD(VIXHU]R90YVGHIRUPDFLyQHQORVHOHPHQWRV
&RQUHVSHFWRDOHOHPHQWR6VHFRQ¿UPDTXHHOFRPSRUWDPLHQWRGHOPLVPR
HVXQDVLQJXODULGDG
&RQUHVSHFWRDOHOHPHQWR6VHREVHUYDXQFRPSRUWDPLHQWRHOiVWLFRKDVWD
XQHVIXHU]RGH03DFRQXQDGHIRUPDFLyQGH(OFRPSRUWDPLHQWR
SDUDHODMXVWHOLQHDOSOiVWLFRLVRWUySLFROOHJDKDVWDXQHVIXHU]RGH03DFRQ
XQDGHIRUPDFLyQSOiVWLFDGHOXJDUGRQGHVHSURGXFHHOFRODSVRGHOHOHPHQWR
&RQ UHVSHFWR DO HOHPHQWR 6 VH REVHUYD XQ FRPSRUWDPLHQWR HOiVWLFR KDVWD
XQ HVIXHU]R GH 03D FRQ XQD GHIRUPDFLyQ GH (O FRPSRUWDPLHQWR
SDUDHODMXVWHOLQHDOSOiVWLFRLVRWUySLFROOHJDKDVWDXQHVIXHU]RGH03DFRQXQD
GHIRUPDFLyQGH
&RQ UHVSHFWR DO HOHPHQWR 6 VH REVHUYD XQ FRPSRUWDPLHQWR HOiVWLFR KDVWD
XQ HVIXHU]R GH 03D FRQ XQD GHIRUPDFLyQ GH (O FRPSRUWDPLHQWR
SDUDHODMXVWHOLQHDOSOiVWLFRLVRWUySLFROOHJDKDVWDXQHVIXHU]RGH03DFRQXQD
GHIRUPDFLyQGHOXJDUHQGRQGHVHSURGXFHXQGHFUHPHQWRGHOHVIXHU]RTXH
VHGHEHDOFRODSVRGHOHOHPHQWR
(Q OD )LJXUD VH REVHUYD HO FRPSRUWDPLHQWR GHO HVIXHU]R GH 9RQ PLVHV FRQ
UHVSHFWRDOGHVSOD]DPLHQWRGHORVHOHPHQWRV6HREVHUYDTXHHOFRPSRUWDPLHQWR
GHHOHPHQWRFUtWLFRHVGLIHUHQWHDORVRWURVHOHPHQWRVUHLWHUDQGRTXHORVUHVXOWDGRV
HQHVWHHOHPHQWRVHGHEHDXQDVLQJXODULGDG&RQUHVSHFWRDORVWUHVHOHPHQWRV
UHVWDQWHVHOFRPSRUWDPLHQWRHVPX\SDUHFLGRVHREVHUYDXQDIDVHLQLFLDOHQGRQGH
VHSUHVHQWDXQFRPSRUWDPLHQWROLQHDOKDVWDOOHJDUDXQYDORUFHUFDQRDORV03D
TXHVHPDQWLHQHDSUR[LPDGDPHQWHFRQVWDQWHHQXQFLHUWRGHVSOD]DPLHQWRKDVWD
OOHJDUDXQYDORUGH03DHQGRQGHVHSURGXFHXQLQFUHPHQWRGHOHVIXHU]RKDVWD
OOHJDUDXQYDORUFHUFDQRDOOtPLWHGHURWXUDGHOPDWHULDOSURGXFLpQGRVHHOFRODSVR
GHOPDWHULDO(QORVWUHVHOHPHQWRVVHREVHUYDTXHHOFRODSVRGHORVHOHPHQWRVVH
SURGXFHHQYDORUHVFHUFDQRVDPPGHGHVSOD]DPLHQWR
Figura 3.40 Esfuerzo V-M vs. desplazamiento en los elementos seleccionados
3.4.2.5 (VWXGLRHQHOHPHQWRVFUtWLFRVFRQVLGHUDQGRODGHIRUPDFLyQSOiVWLFD
0DQWHQLHQGRHOSURFHGLPLHQWRHVWDEOHFLGRHQHODFiSLWH\XWLOL]DQGRFRPR
UHIHUHQFLDOD)LJXUDHQTXHVHLOXVWUDODGHIRUPDFLyQXQLWDULDSOiVWLFDVHHOLJHQ
tres elementos adicionales, además del crítico, para establecer el comportamiento
GHORVPLVPRV
(Q OD ]RQD FUtWLFD VH H[WUDHQ GDWRV GH FXDWUR HOHPHQWRV ¿QLWRV GLVWLQWRV TXH VH
GHQRPLQDQHOHPHQWR666\6OD)LJXUDLQGLFD
ORVHOHPHQWRVPHQFLRQDGRV
)LJXUD(OHPHQWRVVHOHFFLRQDGRVSDUDREWHQFLyQGHUHVXOWDGRV
(OFRPSRUWDPLHQWRGHORVHOHPHQWRVVHOHFFLRQDGRVUHVSHFWRDOHVIXHU]RSULQFLSDOGH
9RQPLVHVVHPXHVWUDQHQOD)LJXUDFRPRVHREVHUYDHQHOLQVWDQWHLQPHGLDWR
DOLPSDFWRHOFRPSRUWDPLHQWRGHORVFXDWURHOHPHQWRVHVPX\VLPLODU OOHJDQGRD
YDORUHVFHUFDQRVD03DHQXQWLHPSRGHLPSDFWRGHVOXHJRVHSUHVHQWDQ
LQFUHPHQWRVGHVWDFiQGRVHHOLQFUHPHQWRGHOHOHPHQWRTXHOOHJDDXQYDORU
Pi[LPRGH03DYDORUVXSHULRUDOOtPLWHGHURWXUDGHOPDWHULDO\VXSRVWHULRU
GLVPLQXFLyQ HVWH YDORU VXJLHUH TXH HO HOHPHQWR \D SUHVHQWD XQ FRPSRUWDPLHQWR
SOiVWLFR\TXHDIDOODGRDSDUWLUGHGLFKRSXQWRVHSUHVHQWDQÀXFWXDFLRQHV(QHO
FDVRGHORVRWURVHOHPHQWRVHOFRPSRUWDPLHQWRHVVLPLODU
Figura 3.42 Esfuerzo V-M en los elementos seleccionados
ඔDVFXUYDVGHODGHIRUPDFLyQSOiVWLFDHQORVHOHPHQWRVVHPXHVWUDHQOD)LJXUD
)LJXUD'HIRUPDFLyQSOiVWLFDHQORVHOHPHQWRVVHOHFFLRQDGRV
ඔD FXUYD GHO GHVSOD]DPLHQWR UHVXOWDQWH UHVSHFWR DO WLHPSR GH ORV HOHPHQWRV VH
PXHVWUDHQOD)LJXUD
Figura 3.44 Desplazamiento resultante en los elementos seleccionados
(Q OD )LJXUD VH REVHUYDQ ODV FXUYDV TXH UHSUHVHQWDQ HO HVIXHU]R YHUVXV OD
GHIRUPDFLyQGHFDGDXQRGHORVHOHPHQWRVVHOHFFLRQDGRV
)LJXUD(VIXHU]R90YVGHIRUPDFLyQHQORVHOHPHQWRV
&RQ UHVSHFWR DO HOHPHQWR 6 VH REVHUYD TXH HO FRPSRUWDPLHQWR GH
UHFXSHUDFLyQHOiVWLFDVHSURGXFHKDVWDXQHVIXHU]RGH03DTXHFRUUHVSRQGH
DOYDORUGHOOtPLWHGHÀXHQFLDGHOPDWHULDOFRQXQGHVSOD]DPLHQWRGHFP(O
FRPSRUWDPLHQWRSDUDHODMXVWHOLQHDOSOiVWLFRLVRWUySLFROOHJDKDVWDXQHVIXHU]RGH
03DHQXQWLHPSRGHVGHLQLFLDGRHOLPSDFWROXHJRGHOFXDOVXIUHXQD
GLVPLQXFLyQEUXVFDGHOHVIXHU]RKDVWDXQYDORUGH03DDXQWLHPSRGHV
GHLQLFLDGRHOLPSDFWRVHJ~QOD)LJXUDORTXHLQGLFDHOFRODSVRGHOHOHPHQWR
(QHVWHHOHPHQWRKDVWDOOHJDUDXQYDORUGH03DVHWLHQHXQDGHIRUPDFLyQGH
FP
&RQ UHVSHFWR DO ORV HOHPHQWRV 6 6 \ 6 VH REVHUYD TXH HO
comportamiento de los elementos es muy similar, no se puede diferenciar entre el
FRPSRUWDPLHQWRHOiVWLFRHODVWRSOiVWLFR\SOiVWLFRGHORVHOHPHQWRV
(Q OD )LJXUD VH REVHUYD HO FRPSRUWDPLHQWR GHO HVIXHU]R GH 9RQ PLVHV FRQ
UHVSHFWRDOGHVSOD]DPLHQWRGHORVHOHPHQWRV(QODPD\RUtDGHORVHOHPHQWRVVH
SURGXFHODGLVPLQXFLyQGHOYDORUGHHVIXHU]RHQXQYDORUFHUFDQRDOOtPLWHGHURWXUD
GHOPDWHULDO03DSURGXFLpQGRVHHOFRODSVRGHORVHOHPHQWRV
Figura 3.46 Esfuerzo V-M vs. desplazamiento en los elementos seleccionados
/RVGDWRVSHUPLWHQFRQFOXLUTXH(QHOFDVRGHOHVIXHU]RSUHVHQWHHQORVHOHPHQWRV
VHOHFFLRQDGRV SDUD HO DQiOLVLV GHVGH HO WLHPSR LQLFLDO KDVWD HO ¿QDO GHO VXFHVR
UHSUHVHQWDGR SRU XQ WLHPSR GH V H[LVWH XQ LQFUHPHQWR EUXVFR GHO YDORU GHO
HVIXHU]R DSUR[LPDGDPHQWH KDVWD V HV HO PRPHQWR PLVPR GHO LPSDFWR
SRVWHULRU D HVWH HO HVIXHU]R WLHQGH D RVFLODU HQWUH YDORUHV TXH VH FRQVLGHUDQ
DSUR[LPDGDPHQWHSURPHGLRVKDVWDFXDQGRHOVXFHVRWHUPLQD6HSXHGHDSUHFLDUHO
FRPSRUWDPLHQWRSOiVWLFRGHOPDWHULDOGXUDQWHHVWDVIDVHVHQYLUWXGTXHHOHVIXHU]R
\ODGHIRUPDFLyQVRQSURSRUFLRQDOHV
(QHOFDVRGHODGHIRUPDFLyQVHSXHGHREVHUYDUTXHHQORVFXDWURHOHPHQWRVHO
FRPSRUWDPLHQWRHVVLPLODUDXQTXHORVYDORUHVWLHQGHQDYDULDU6LPLODUHQHOVHQWLGR
GHOSLFREUXVFRGHLQFUHPHQWRTXHPXHVWUDQODVJUi¿FDVORTXHSHUPLWHVXSRQHU
HOPRPHQWRPLVPRGHOLPSDFWROXHJRODGHIRUPDFLyQSHUPDQHQWHTXHVHSUHVHQWD
SRUTXHHOPDWHULDOWUDEDMDHQ]RQDSOiVWLFD
6H UHODFLRQDQ ORV GRV UHVXOWDGRV DQWHULRUHV \ VH YHUL¿FD TXH ODV FXUYDV GHO
HVIXHU]R YHUVXV OD GHIRUPDFLyQ HQ FDGD XQR GH ORV HOHPHQWRV WLHQGHQ DO PLVPR
FRPSRUWDPLHQWR DXQTXH ORV YDORUHV FDPELDQ 'H WDO PDQHUD VH REVHUYD TXH OD
UHODFLyQ GHO HVIXHU]R \ OD GHIRUPDFLyQ HQ ORV HOHPHQWRV VHOHFFLRQDGRV WLHQGH D
VHUSURSRUFLRQDOPLHQWUDVHOVXFHVRHVWDSUHVHQWHVHKDJHQHUDGRXQDDEVRUFLyQ
GHODHQHUJtDGHGHIRUPDFLyQSRUSDUWHGHOPDWHULDOTXHFRPSRQHORVHOHPHQWRV
HVWUXFWXUDOHVSRVWHULRUDFLHUWRWLHPSRGHVXFHVROOHJDDXQSLFRDSDUWLUGHOFXDO
WLHQGHDEDMDUEUXVFDPHQWHODFXUYDGDGRTXHODFDUJDGHLPSDFWRKDVLGRDEVRUELGD
SRUGHIRUPDFLyQSOiVWLFD
6HFRQVLGHUDLPSRUWDQWHHVWXGLDUODYDULDFLyQGHUHVXOWDGRVDOFRQ¿JXUDUHOVRIWZDUH
LS '<1$SDUDWUDEDMDUFRQGLVWLQWRVPpWRGRVGHFRQWUROGHUHORMGHDUHQD
6HUHDOL]DVLPXODFLRQHVFRQ¿JXUDGDVFRQRWURVGRVPpWRGRVDGLFLRQDOHVGHFRQWURO
GHO+RXUJODVVFRQHO¿QGHHVWDEOHFHUFRPSDUDFLRQHVFRQHOPpWRGRXWLOL]DGRHQ
ORVUHVXOWDGRVDQWHVSUHVHQWDGRVEDVDGRVHQ)ODQDJDQ%HO\WVFKNR6WLႇQHVHVWH
PpWRGR VHJ~Q ORV HVSHFLDOLVWDV \ DXWRUHV GHO iUHD GH PHFiQLFD FRPSXWDFLRQDO
SDUDLPSDFWRVORUHFRPLHQGDQSDUDHVWUXFWXUDVGHOWLSRVXSHU¿FLH(VGHLQWHUpV
HVWDEOHFHUGLIHUHQFLDVHQWUH)ODQDJDQ%HO\WVFKNR6WLႇQHV\ORVRWURVGRVPpWRGRV
TXHVRQ
)ODQDJDQ%HO\WVFKNR9LVFRXV)RUP
%HO\WVFKNR%LQGHPDQ
/D 7DEOD SUHVHQWD ORV UHVXOWDGRV REWHQLGRV HQ GHIRUPDFLyQ GLUHFFLRQDO FRQ
UHVSHFWRDOHMH=HMHGHLPSDFWR\HOHVIXHU]RGH9RQ0LVHVFRQORVWUHVPpWRGRV
GHKRXUJODVVDQWHVLQGLFDGRV
Tabla 3.2
&XDGURFRPSDUDWLYRGHUHVXOWDGRVGHKRXUJODVVSDUDGLVWLQWRPpWRGRVGHFiOFXOR
MÁXIMO
MÍNIMO
MÁXIMO
MÍNIMO
MÁXIMO
MÍNIMO
DEFORMACIÓN TOTAL [m]
ESFUERZO VON MISES [Pa]
BELYTSCHKO - BINDEMAN
(
(
FLANAGAN - BELYTSCHKO - VISCOUS FORM
(
1,52E+05
FLANAGAN - BELYTSCHKO STIFFNESS
(
(
$VtWDPELpQVHKDQREWHQLGRODVFXUYDVGHKRXUJODVV\GHHQHUJtDLQWHUQDSDUDORV
PpWRGRV)ODQDJDQ%HO\WVFKNR9LVFRXV)RUP\%HO\WVFKNR%LQGHPDQODV)LJXUDV
PXHVWUDQODVJUi¿FDVGHLQWHUpV
)LJXUD&XUYDGHODHQHUJtDLQWHUQD)ODQDJDQ%HO\WVFKNR6WL൵QHVV
)LJXUD&XUYDGHKRXUJODVV)ODQDJDQ%HO\WVFKNR6WL൵QHVV
Figura 3.49 Curva de energía interna Flanagan Belytschko Viscous Form
Figura 3.50 Curva de hourglass Flanagan Belytschko Viscous Form
Figura 3.51 Curva de energía interna Belytschko Bindeman
Figura 3.52 Curva de hourglass Belytschko Bindeman
/D7DEODUHVXPHORVUHVXOWDGRVHQFRQWUDGRV
Tabla 3.3
9DULDFLyQGHODHQHUJtDLQWHUQDYVKRXUJODVVSDUDGLIHUHQWHVPpWRGRVGHFRQWURO
MÉTODO DE HOURGLASS
)ODQDJDQ%HO\WVFKNR6WLIQHVV
)ODQDJDQ%HO\WVKFNR9LVFRXV
%HO\WVFKNR%LQGHPDQ
PORCENTAJE
/DFRPSDUDFLyQHQWUHODVJUi¿FDVSHUPLWHHVWDEOHFHUTXHORVSRUFHQWDMHVUHVXOWDQWHV
GH OD UHODFLyQ HQHUJtD LQWHUQD YHUVXV KRXUJODVV HQWUH ORV PpWRGRV )ODQDJDQ
%HO\VWFKNR 6WLႇQHVV \ )ODQDJDQ %HO\VWFKNR 9LVFRXV )RUP WLHQH XQ YDORU GH
GLIHUHQFLDPD\RUDOTXHVHGHWHUPLQDGDHQWUHORVPpWRGRV)ODQDJDQ%HO\VWFKNR
6WLႇQHVV \ %HO\VWFKNR %LQGHPDQ (VWR VH GHEH D TXH JHQHUDOPHQWH )ODQDJDQ %HO\VWFKNR9LVFRXV)RUPXVXDOPHQWHVHDSOLFDSDUDFDVRVGHDOWDVYHORFLGDGHV
\ DOWDV WDVDV GH GHIRUPDFLyQ PLHQWUDV TXH )ODQDJDQ %HO\VWFKNR 6WLႇQHVV VRQ
XWLOL]DGDV SDUD WDVDV PiV EDMDV GH GHIRUPDFLyQ LQFOX\HQGR VLPXODFLRQHV GH
DFFLGHQWHVGHYHKtFXORV
6HFRQFOX\HTXHODXWLOL]DFLyQGHOPpWRGR)ODQDJDQ%HO\VWFKNR6WLႇQHVVHVHOPiV
DSURSLDGRSDUDHVWDEOHFHUXQFRQWUROGHKRXUJODVVHQLPSDFWRVGHHVWUXFWXUDVGH
buses
69
CAPÍTULO IV
MODELOS MATEMÁTICOS PARA EL ANÁLISIS DE
IMPACTO FRONTAL
4.1 MODELOS MATEMÁTICOS
El desarrollo de modelos matemáticos y su resolución para análisis de impacto
IURQWDOUHTXLHUHQFRQRFHUHLGHQWL¿FDUODVOH\HV\SULQFLSLRVPDWHPiWLFRV\ItVLFRV
TXHUHSUHVHQWDQHOIHQyPHQRItVLFRHVWDEOHFLHQGRFRQSUHFLVyQODVFRQGLFLRQHVGH
ERUGHGHODQiOLVLVHOFRPSRUWDPLHQWR\YDULDFLyQGHODVIXHU]DVH[WHUQDVHLQWHUQDV
ODVSURSLHGDGHVPHFiQLFDVGHORVHOHPHQWRVLQYROXFUDGRVGLPHQVLRQHVWLSRVGH
IXHU]DVFRQGLFLRQHVGHFRQWDFWRHQWUHRWUDVPLVPDVTXHSXHGHQYDULDUHQIXQFLyQ
del tiempo y que permiten la formulación de ecuaciones diferenciales que pueden
ser resueltas mediante métodos de integración; según el tiempo de su resolución
SXHGHQVHUGHOWLSRLPSOtFLWRRH[SOtFLWRSDUDHOSUHVHQWHSUR\HFWRHQHOTXHODV
FRQGLFLRQHV GHO SUREOHPD GH LPSDFWR VRQ GLQiPLFDV VH DSOLFDQ ORV PRGHORV GH
UHVROXFLyQ H[SOLFLWD /RV WpUPLQRV LPSOtFLWR \ H[SOLFLWR VH UH¿HUH D GRV WLSRV GH
PpWRGRVGHLQWHJUDFLyQHQIXQFLyQGHOWLHPSRXWLOL]DGRSDUDUHDOL]DUVLPXODFLRQHV
GLQiPLFDV
(OHQIRTXHLPSOtFLWRHV~WLOHQSUREOHPDVHQORVTXHODGHSHQGHQFLDGHWLHPSRGH
ODVROXFLyQQRHVXQIDFWRULPSRUWDQWHHQHOFDVRSUHVHQWHHOWLHPSRVLHVIDFWRU
LPSRUWDQWH HV SRU HOOR TXH VH GHVFULEH HO HQIRTXH H[SOLFLWR FRPR PpWRGR SDUD
VLPXODUHOFRPSRUWDPLHQWRGHODFDUURFHUtDGHEXVDLPSDFWR
4.1.1 CARACTERÍSTICA DE LA DINÁMICA EXPLICITA
(OFiOFXORH[SOLFLWRHVXQPpWRGRQXPpULFRGHLQWHJUDFLyQPiVSUHFLVR\H¿FLHQWH
SDUD OD UHVROXFLyQ \ DQiOLVLV GH SUREOHPDV GH VLPXODFLRQHV GLQiPLFDV HQ FDVRV
TXH GHSHQGHQ GH DOWD IUHFXHQFLD YLEUDWRULD \ GHO WLHPSR GRQGH VH SURGXFHQ
DOWDV GHIRUPDFLRQHV \ HVIXHU]RV 6H XWLOL]D HQ PDWHULDOHV FRQ FRPSRUWDPLHQWRV
QR OLQHDOHV FRQ FRQWDFWRV FRPSOHMRV HQ SURFHVRV TXH LQYROXFUDQ IHQyPHQRV
GH PDTXLQDGR FRPR FRQIRUPDGR URODGR H[WUXVLyQ HVWDPSDGR WDODGUDGR R
IUDJPHQWDFLyQFRPRHQFKRTXHVH[SORVLRQHVLPSDFWRVHQWUHRWURV
'HSHQGH ~QLFDPHQWH GH ODV IUHFXHQFLDV QDWXUDOHV PiV DOWDV GHO PRGHOR HV
LQGHSHQGLHQWHGHOWLSR\ODGXUDFLyQGHODFDUJDODLQHUFLDSXHGHGHVHPSHxDUXQ
70
SDSHOGRPLQDQWHHQODVROXFLyQ(OGHVHTXLOLEULRGHIXHU]DVVHSURSDJDQHQIRUPD
GHRQGDVGHWHQVLyQHQWUHHOHPHQWRVYHFLQRV
4.1.1.1 Formulación básica
/DVHFXDFLRQHVEiVLFDVUHVXHOWDVSRU<XFKHQJ/LX6WHIDQ-&KX5DXO9LHUD
SDUDDQDOL]DUHOVLVWHPDGLQiPLFRH[SOLFLWRH[SUHVDQODFRQVHUYDFLyQGHODPDVD
FDQWLGDGGHPRYLPLHQWR\HQHUJtDHQFRRUGHQDGDVGH/DJUDQJH(VWDVMXQWRFRQ
XQPRGHORGHOPDWHULDO\XQFRQMXQWRGHFRQGLFLRQHVLQLFLDOHV\GHIURQWHUDGH¿QH
ODVROXFLyQFRPSOHWDGHOSUREOHPD3DUDODVIRUPXODFLRQHVGH/DJUDQJHODPDOOD
VHPXHYH\VHGLVWRUVLRQDFRQORVPRGHORVGHOPDWHULDOSRUORTXHODFRQVHUYDFLyQ
GH OD PDVD HV VDWLVIHFKD DXWRPiWLFDPHQWH /D GHQVLGDG HQ FXDOTXLHU WLHPSR R
PRPHQWRVHSXHGHGHWHUPLQDUDSDUWLUGHOYROXPHQDFWXDOGHOD]RQD\VXPDVD
LQLFLDOGHVGHHOYROXPHQDFWXDO
ρ0V0 m
=
V
V
Donde:
r0 = es la densidad inicial
90 HVHOYROXPHQLQLFLDO
V HVHOYROXPHQDFWXDOGHOD]RQD
m = es la masa
/DV HFXDFLRQHV GLIHUHQFLDOHV SDUFLDOHV ODV FXDOHV H[SUHVDQ OD FRQVHUYDFLyQ GH
ODFDQWLGDGGHPRYLPLHQWRUHODWLYDVDODDFHOHUDFLyQ\DOWHQVRUGHOHVIXHU]RHVWD
GH¿QLGDVSRU
∂σ xx ∂σ xy ∂σ xz
+
+
∂y
∂x
∂z
∂σ
∂σ
∂σ
ρ y = by + yx + yy + yz
∂z
∂y
∂x
∂σ
∂σ
∂σ
ρ z = bz + zx + zy + zz
∂y
∂x
∂z
/DFRQVHUYDFLyQGHODHQHUJtDHVWDH[SUHVDGDSRU
ρ x = bx +
1
e = ( σ xx εxx + σ yy εyy + σ zzεzz + 2σ xy εxy + 2σ yzεyz + 2σ zx εzx )
ρ
3DUD FDGD SDVR GHO WLHPSR HVWDV HFXDFLRQHV VRQ UHVXHOWDV H[SOtFLWDPHQWH SDUD
FDGDHOHPHQWRHQHOPRGHOREDVDQGRORVYDORUHVGHLQJUHVRHQORVYDORUHV¿QDOHV
GHOSDVRGHOWLHPSRSUHYLR
(QHOPRGHORVRODPHQWHODFRQVHUYDFLyQGHODPDVD\GHOPRPHQWRVHFXPSOHQ
6LQHPEDUJRHQODVVLPXODFLRQHVH[SOtFLWDVSUHSDUDGDVODPDVDFRQVHUYDFLyQGH
GHOPRPHQWR\HQHUJtDSXHGHQVHUFRQVHUYDGRV
(OUHVROYHGRUGHODGLQiPLFDH[SOLFLWDXVDHOHVTXHPDGHLQWHJUDFLyQGHGLIHUHQFLDV
FHQWUDOHVODVHFXDFLRQHVVHPLGLVFUHWDVGHOPRYLPLHQWRDOWLHPSRn HVWDGH¿QLGR
por:
Mx
n =
P n − F n + H n Donde:
M : es la matriz diagonal de la masa.
xn : componente de la aceleración nodal
P n : son las fuerzas externas en el cuerpo
F n : el vector de esfuerzo divergente.
H n : es la resistencia del reloj de arena.
&RQODDFHOHUDFLyQGHWHUPLQDGDDOWLHPSRn- 1/2ODVYHORFLGDGHVDOWLHPSR n + 1/2
en la dirección i (i=1,2,3) son encontradas a partir de:
i 't
x i
x
n 1/ 2
n
n
)LQDOPHQWHODVSRVLFLRQHVVRQDFWXDOL]DGRVSDUDHOWLHPSRQ
n 1
x
xi n x i n 1/ 2 't n 1/ 2
i
/DVYHQWDMDVGHOXVRGHHVWHPpWRGRSDUDSUREOHPDVQROLQHDOHVVRQ
•
•
•
/DVHFXDFLRQHVOOHJDQDVHUGHVDJUHJDGDV\SXHGHQVHUUHVXHOWDVGLUHFWDPHQWH
H[SOtFLWDPHQWH1RKD\UHTXHULPLHQWRVSDUDODLQWHUDFFLyQGXUDQWHHOWLHPSR
GHLQWHJUDFLyQ
1LQJ~Q FRQWURO GH FRQYHUJHQFLD HV QHFHVDULR GHVGH TXH ODV HFXDFLRQHV VRQ
GHVDFRSODGDV
1RVHUHTXLHUHQLQJXQDLQYHUVLyQGHODPDWUL]GHULJLGH]7RGDVODVOLQHDOLGDGHV
LQFOX\HQGRORVFRQWDFWRVHVWiQLQFOXLGRVHQHOYHFWRUGHIXHU]DLQWHUQD
•
)LQDOPHQWHODVSRVLFLRQHVVRQDFWXDOL]DGDVSDUDHOWLHPSRQSRUODVYHORFLGDGHV
GHLQWHJUDFLyQ
4.1.1.2 Estabilidad del paso del tiempo
3DUD DVHJXUDU OD HVWDELOLGDG \ SUHFLVLyQ GH OD VROXFLyQ HO WDPDxR GHO SDVR GHO
WLHPSR XVDGR D OD YH] HQ HO WLHPSR GH LQWHJUDFLyQ H[SOLFLWR HV OLPLWDGR SRU OD
FRQGLFLyQGH&RXUDQW)ULHGULFKV/HY\HWDOO
Esta condición implica que el paso del tiempo se limitará de manera que una
SHUWXUEDFLyQRQGDGHHVIXHU]RQRSXHGHYLDMDUPiVKDOODGHODVGLPHQVLRQHVPiV
SHTXHxDVGHOHOHPHQWRGHODPDOODHQXQVRORSDVRGHOWLHPSR
3RUORWDQWRHOFULWHULRGHOSDVRGHOWLHPSRGHHVWDELOLGDGGHODVROXFLyQHV
h
c
't d f * [ ] min
Donde :
DtHVHOLQFUHPHQWRGHOWLHPSR
fHVHOIDFWRUGHHVWDELOLGDGGHOWLHPSR
h HVODGLPHQVLyQFDUDFWHUtVWLFDGHXQHOHPHQWR
cHVODYHORFLGDGGHOVRQLGRORFDOHQHOHOHPHQWR
(OSDVRGHOWLHPSRXWLOL]DGRHQHOWLHPSRGHLQWHJUDFLyQH[SOLFLWDJHQHUDOPHQWHHV
PXFKRPDVSHTXHxRTXHHOWLHPSRXWLOL]DGRHQODLQWHJUDFLyQLPSOtFLWD
/D¿JXUDPXHVWUDXQUHVXPHQGHORTXHUHSUHVHQWDHOSURFHVRGHFiOFXORSDUD
HODQiOLVLVGHXQSUREOHPDGHGLQiPLFDH[SOtFLWD
5&RXUDQW.)ULHGULFKVDQG+/HZ\³2QWKHSDUWLDOGLႇHUHQFHHTXDWLRQVRIPDWKHPDWLFDO
SK\VLFV´,%0-RXUQDO0DUFKSS
Figura 4.1 Algoritmos de cálculo para Dinámica Explícita17
4.1.2 LAGRANGE EXPLICITO
&RQHO¿QGHPHMRUDUODGHVFULSFLyQGHOPRGHORVHFRQVLGHUDODYDULOODTXHVHPXHVWUD
HQ OD )LJXUD /D FRQ¿JXUDFLyQ LQLFLDO WDPELpQ GHQRPLQDGD FRQ¿JXUDFLyQ
QR GHIRUPDGD GH OD EDUUD VH PXHVWUD HQ OD SDUWH VXSHULRU GH OD JUi¿FD (VWD
FRQ¿JXUDFLyQ MXHJD XQ SDSHO LPSRUWDQWH HQ HO DPSOLR DQiOLVLV GH OD GHIRUPDFLyQ
GHVyOLGRV7DPELpQVHODFRQRFHFRPRFRQ¿JXUDFLyQGHUHIHUHQFLD\DTXHWRGDV
ODV HFXDFLRQHV WRWDOHV HQ OD IRUPXODFLyQ GH /DJUDQJH KDFHQ UHIHUHQFLD D HVWD
FRQ¿JXUDFLyQ/DFRQ¿JXUDFLyQGHIRUPDGDVHPXHVWUDHQODSDUWHLQIHULRUGHOD
)LJXUD
(QODFRQ¿JXUDFLyQGHUHIHUHQFLDODFRRUGHQDGDHVSDFLDOHXOHULDQRVHGHQRWDSRU
x PLHQWUDVTXHODFRRUGHQDGDGHUHIHUHQFLDItVLFDV/DJUDQJHVHGHQRWDSRUX. El
iUHDLQLFLDOGHODVHFFLyQWUDQVYHUVDOGHODYDULOODGHGHQRWDSRUA0(X) y la densidad
inicial por r0(X);ODVYDULDEOHVGHUHIHUHQFLDUHODWLYDVLQLFLDOQRGHIRUPDGRGHOD
FRQ¿JXUDFLyQ VHUiQ VLHPSUH LGHQWL¿FDGDV SRU XQ FHUR VXEtQGLFH R VXSHUtQGLFH
(QHVWDFRQYHQFLyQVHSRGUtDLQGLFDUODVFRRUGHQDGDVItVLFDVSRUx0 mismas que
FRUUHVSRQGHQDODVFRRUGHQDGDVItVLFDVLQLFLDOHVVLQHPEDUJRHQODPD\RUtDGHOD
6+(15:8DQG/(,*8,QWURGXFWLRQWRWKHH[SOLFLW¿QLWHHOHPHQWPHWKRGIRUQRQOL
QHDUWUDQVLHQWG\QDPLFV(GLWRULDO:,/(<
7HG%HO\WVFKNR:LQJ.DP/LX%ULDQ0RUDQ.KDOLO,(ONKRGDU\1RQOLQHDU)LQLWH(OH
PHQWVIRU&RQWLQXDDQG6WUXFWXUHV6HFRQG(GLWLRQ
OLWHUDWXUDPHFiQLFDGHPHGLRVFRQWLQXRVVLHPSUHVHXWLOL]DUiX para las coordenadas
ItVLFDV
)LJXUD&RQ¿JXUDFLyQLQGHIRUPDEOHUHIHUHQFLD\GHIRUPDEOHDFWXDOSDUDXQDEDUUDFDUJDGD
Deformación y medición de la deformación unitaria
6H GHVFULEHQ SULPHUDPHQWH ODV YDULDEOHV TXH HVSHFL¿FDQ OD GHIRUPDFLyQ \ HO
HVIXHU]RHQHOFXHUSR(OPRYLPLHQWRGHOFXHUSRVHPXHVWUDPHGLDQWHXQDIXQFLyQ
GHODVFRRUGHQDGDVGH/DJUDQJH\HOVXFHVRTXHHVSHFL¿FDODSRVLFLyQGHFDGD
SXQWRItVLFRHQIXQFLyQGHOWLHPSR
x=φ(X,t)
X ∈ [X a ,X b ]
Donde f (x, t) VHOODPDIXQFLyQGHODGHIRUPDFLyQ(VWDIXQFLyQDPHQXGRUHSUHVHQWD
XQLQWHUYDORRPDSDHQWUHORVGRPLQLRVLQLFLDOHV\DFWXDOHV/DVFRRUGHQDGDVItVLFDV
VHGDQSRUODGHIRUPDFLyQHQIXQFLyQGHOWLHPSRW SRUORWDQWR
X = φ( X , 0 )
&RPRVHSXHGHREVHUYDUHQODH[SUHVLyQDQWHULRUODIXQFLyQGHODGHIRUPDFLyQD
W HVHOPDSDGHLGHQWLGDG
(OGHVSOD]DPLHQWRu (x, t) YLHQHGDGRSRUODGLIHUHQFLDHQWUHODSRVLFLyQDFWXDO\OD
SRVLFLyQRULJLQDOGHXQSXQWRItVLFRSRUORTXH
u( X , t ) = φ( X , t ) − X o u = x − X
(OJUDGLHQWHGHGHIRUPDFLyQVHGH¿QHSRU
F=
∂φ ∂x
=
∂X ∂X
,QWURGXFLHQGR HO -DFRELDQR J HQWUH OD FRQ¿JXUDFLyQ DFWXDO \ OD GH UHIHUHQFLD \
GH¿QLHQGRDO-DFRELDQRFRPRODUD]yQGHXQYROXPHQLQ¿QLWHVLPDOHQHOFXHUSR
GHIRUPDGR $ǻ[ SDUD HO FRUUHVSRQGLHQWH YROXPHQ HQ HO VHJPHQWR GHO FXHUSR
LQGHIRUPDGRA0ǻ[DVtHVWDGDGRSRU
J=
∂x A F .A
=
∂X A0
A0
El gradiente de deformación FHVXQDPHGLGDLQXVXDOGHOHVIXHU]RDXQTXHVXYDORU
HVXQRFXDQGRHOFXHUSRHVWDLQGHIRUPDGR6HSXHGHGH¿QLUODPHGLGDGHOHVIXHU]R
como:
ε( X , t ) = F ( X , t ) − 1 ≡
∂x
∂u
−1 =
∂X
∂X
'HPRGRTXHGHVDSDUHFHHQODFRQ¿JXUDFLyQQRGHIRUPDGD+D\PXFKDVPDQHUDV
GHPHGLUHOHVIXHU]RSHURHVWDHVODPiVFRQYHQLHQWH\FRUUHVSRQGHDOWHQVRUGH
HVWLUDPLHQWRHQSUREOHPDVPXOWLGLPHQVLRQHV(QXQDGLPHQVLyQHVHTXLYDOHQWHDO
HVIXHU]RLQJHQLHULOHQJLQHHULQJVWUDLQ
4.1.2.1 Medición del esfuerzo
/D PHGLGD GHO HVIXHU]R HO FXDO HV XVDGR HQ OD IRUPXODFLyQ WRWDO /DJUDQJLDQD QR
FRUUHVSRQGHDOELHQFRQRFLGRHVIXHU]RItVLFR3DUDH[SOLFDUODPHGLFLyQGHOHVIXHU]R
DVHUXVDGRSULPHURVHGHEHGH¿QLUHOHVIXHU]RItVLFRHOFXDOHVFRQRFLGRFRPR
HOHVIXHU]RGH&DXFK\&RQVLGHUDQGRTXHODIXHU]DWRWDODORODUJRGHXQDVHFFLyQ
esta designado por T\DVXPLHQGRTXHHOHVIXHU]RHVFRQVWDQWHDORODUJRGHOD
VHFFLyQWUDQVYHUVDO(OHVIXHU]RGH&DXFK\HVWDGDGRSRU
σ=
T
A
(VWDPHGLGDGHOHVIXHU]RVHUH¿HUHDOiUHDDFWXDOA(QODIRUPXODFLyQ/DJUDQJLDQD
WRWDOVHXVDHOHVIXHU]RQRPLQDOTXHGHQRWDGRSRUP y esta dado por:
P
T
A0
&RPSDUDQGR(F\(FVHREVHUYDUTXHHOHVIXHU]RItVLFR\QRPLQDO
HVWiQUHODFLRQDGRPHGLDQWHODHFXDFLyQ
76
A0
A
A
A0
σ=
P
P=
σ
$VtVLXQRGHORVHVIXHU]RVHVFRQRFLGRHORWURSXHGHVHUVLHPSUHFDOFXODGRVLOD
VHFFLyQWUDQVYHUVDODFWXDOHLQLFLDOVRQFRQRFLGDV
/DEDUUDQROLQHDOHVWDJREHUQDGDSRUODVVLJXLHQWHVHFXDFLRQHV
&RQVHUYDFLyQGHODPDVD
&RQVHUYDFLyQGHOPRPHQWR
&RQVHUYDFLyQGHODHQHUJtD
8QD PHGLGD GH OD GHIRUPDFLyQ D PHQXGR OODPDGD HFXDFLyQ GH HVIXHU]R
GHVSOD]DPLHQWR
8QD HFXDFLyQ FRQVWLWXWLYD OD FXDO GHVFULEH HO FRPSRUWDPLHQWR GHO PDWHULDO \
UHODFLRQDHOHVIXHU]RSDUDODGHIRUPDFLyQPHGLGD
$GLFLRQDOPHQWHVHUHTXLHUHTXHODGHIRUPDFLyQVHDFRQWLQXDORFXDODPHQXGRHV
OODPDGRXQUHTXHULPLHQWRGHFRPSDWLELOLGDG
4.1.2.2
Conservación de la masa
/DHFXDFLyQGHODFRQVHUYDFLyQGHODPDVDSDUDIRUPXODFLyQ/DJUDQJLDQDSXHGH
ser escrita como:
ρJ = ρ0 J0
ó
ρ( X , t )J ( X , t ) = ρ0 ( X )J0 ( X )
'RQGHODVHJXQGDH[SUHVLyQHVWDGDGDSDUDHQIDWL]DUTXHODVYDULDEOHVVRQWUDWDGDV
FRPRIXQFLyQGHODVFRRUGHQDGDV/DJUDQJLDQDV/DFRQVHUYDFLyQGHODPDVDHVXQD
HFXDFLyQDOJHEUDLFDVRODPHQWHFXDQGRVHH[SUHVDHQWpUPLQRVGHODVFRRUGHQDGDV
PDWHULDOHV'HRWUDPDQHUDHVXQDHFXDFLyQGLIHUHQFLDOSDUFLDO3DUDODEDUUDVH
SXHGHXVDUODHFXDFLyQSDUDHVFULELUFRPR
ρFA = ρ0 A0 'RQGHVHKDXVDGRHOIDFWRUGHO-DFRELDQRLJXDODXQRJo=0.
4.1.2.3
Conservación del momento
/DFRQVHUYDFLyQGHODFDQWLGDGGHPRYLPLHQWRHVFULWDHQWpUPLQRVGHHVIXHU]R\GH
ODVFRRUGHQDGDV/DJUDQJLDQDVHVGH¿QLGDFRPR
77
( A0 P ),x +ρ0 A0 b = ρ0 A0 ü
'RQGH ORV SXQWRV VXSHUSXHVWRV GHQRWD HO WLHPSR GHULYDWLYR PDWHULDO (O WLHPSR
GHULYDWLYR PDWHULDO GH OD YHORFLGDG OD DFHOHUDFLyQ HV HVFULWR FRPR D2u/Dt2. El
VXEtQGLFHVHJXLGRSRUXQDFRPDGHQRWDGLIHUHQFLDFLyQSDUFLDOFRQUHVSHFWRDHVD
YDULDEOHSRUHMHPSOR
∂P ( X , t )
), X ≡
P ( X , t
∂X
6LHOiUHDGHODVHFFLyQWUDQVYHUVDOHVFRQVWDQWHHQHVSDFLRODFRQVHUYDFLyQGHOD
FDQWLGDGGHPRYLPLHQWROOHJDDVHU
P , x + ρ0 b = ρ0 ü
4.1.2.4.
Conservación de la energía
/DHFXDFLyQGHODFRQVHUYDFLyQGHODHQHUJtDSDUDODEDUUDGHXQDiUHDFRQVWDQWH
esta dada por:
x int
U0 w
x
F P q x ,X U0 S
Donde:
qx HVHOÀXMRGHFDORU
s es la fuente de calor por unidad de masa y
x int
w HVODUD]yQGHFDPELRGHODHQHUJtDLQWHUQDSRUXQLGDGGHPDVD
(QDXVHQFLDGHFDORUGHFRQGXFFLyQRIXHQWHVGHFDORUODHFXDFLyQGHODHQHUJtDHV
x int
U0 w
x
FP
/RFXDOGHPXHVWUDTXHHOWUDEDMRLQWHUQRHVWDGDGRSRUHOSURGXFWRGHODUD]yQGH
la deformación F \HOHVIXHU]RQRPLQDOP
4.1.2.5.
Ecuaciones constitutivas
/D HFXDFLyQ FRQVWLWXWLYD UHÀHMD ORV HVIXHU]RV TXH VRQ JHQHUDGRV HQ HO PDWHULDO
FRPRUHVSXHVWDDODGHIRUPDFLyQUHODFLRQDODVPHGLGDVGHWHQVLyQHQXQSXQWR
PDWHULDO$GHPDVSXHGHQVHHVFULWDVHQXQIRUPDWRWDOODFXDOUHODFLRQDODWHQVLyQ
DFWXDODODGHIRUPDFLyQDFWXDO
P ( X , t ) = S PF ( F ( X , t ), F ( X , t ), etc ., t ≤ t )
−
•
−
−
2HQIRUPDGHWDVD
•
•
−
−
−
−
P ( X , t ) = St PF ( F ( X , t ), F (
x , t ), P ( X , t ), etc ., t ≤ t )
$TXt SPF y StPF VRQ ODV IXQFLRQHV GH OD GHIRUPDFLyQ GDQ HO HVIXHU]R \ OD WDVD
GHHVIXHU]RUHVSHFWLYDPHQWH/RVVXSHUtQGLFHVDTXtDQH[DGRVSDUDODVIXQFLRQHV
FRQVWLWXWLYDVLQGLFDQFRPRODVPHGLGDVGHODWHQVLyQ\HOHVIXHU]RHVWiQUHODFLRQDGDV
/DHFXDFLyQFRQVWLWXWLYDGHXQVyOLGRHVWiH[SUHVDGRHQFRRUGHQDGDVPDWHULDOHV
porque la tensión en un sólido usualmente depende de la historia de deformación
HQ HO SXQWR PDWHULDO /DV IXQFLRQHV DQWHULRUHV SRGUtDQ VHU IXQFLRQHV FRQWLQXDV
GH YDULDEOHV LQGHSHQGLHQWHV 3UHIHULEOHPHQWH GHEHUtDQ VHU FRQWLQXDPHQWH
GLIHUHQFLDEOHVGHHVWDPDQHUDODWHQVLyQHVPHQRVVXDYHTXHORVGHVSOD]DPLHQWR
ORFXDOSXHGHFDXVDUGL¿FXOWDGHV
(MHPSORVGHHFXDFLRQHVFRQVWLWXWLYDVVRQ
D0DWHULDOHOiVWLFROLQHDO
P ( X , t ) = E PF ε( X , t ) = E PF ( F ( X , t ) − 1 )
forma total
forma
derivada P ( X , t ) = E PF ε( X , t ) = E PF F ( X , t )
•
•
•
E9LVFRHOiVWLFROLQHDO
•
P ( X , t ) = E PF [( F ( X , t ) − 1 ) + α F ( X , t )]
ó
•
P = E PF ( ε + α ε )
3DUDSHTXHxDVGHIRUPDFLRQHVHOSDUiPHWURPDWHULDOEPF corresponde al modulo de
<RXQJVODFRQVWDQWHaGHWHUPLQDODPDJQLWXGGHODPRUWLJXDPLHQWR
4.1.2.6.
Ecuación del momento en términos del desplazamiento
8QDHFXDFLyQLQGLYLGXDOSDUDODEDUUDSXHGHVHUREWHQLGDVXVWLWX\HQGRODHFXDFLyQ
FRQVWLWXWLYDUHOHYDQWHRHQODHFXDFLyQGHOPRPHQWR\H[SUHVDQGR
79
OD GHIRUPDFLyQ XQLWDULD HQ WpUPLQRV GHO GHVSOD]DPLHQWR D SDUWLU GH OD HFXDFLyQ
/DIRUPDWRWDOGHODHFXDFLyQFRQVWLWXWLYDSXHGHHVFULELUVHFRPR
( A0
P ),x+ρ0 A0 b = ρ0 A0 ü
/DFXDOHVXQDHFXDFLyQGLIHUHQFLDOSDUFLDOQROLQHDO3'(HQHOGHVSOD]DPLHQWR
u(X,t). HO FDUiFWHU GH HVWD HFXDFLyQ GLIHUHQFLDO SDUFLDO QR HV IiFLOPHQWH HYLGHQWH
DSDUWLUGHORDQWHULRU\GHSHQGHGHORVGHWDOOHVGHODHFXDFLyQFRQVWLWXWLYD3DUD
LOXVWUDUXQDIRUPDGHHVWD3'(VLVHFRQVLGHUDXQPDWHULDOHOiVWLFROLQHDOHFXDFLyQ
ODHFXDFLyQFRQVWLWXWLYDVHWLHQH
( A0 E PF u ,X ),X +ρ0 A0 b = ρ0 A0 ü
6H SXHGH REVHUYDU TXH HQ HVWH 3'( OD GHULYDGD PiV DOWDV FRQ UHVSHFWR D OD
coordenada material XHVGHVHJXQGRRUGHQ\ODPiVDOWDGHULYDGDFRQUHVSHFWR
DOWLHPSRHVWDPELpQGHVHJXQGRRUGHQSRUORTXHHO3'(HVGHVHJXQGRRUGHQ
en X y en el tiempo t.6LODWHQVLyQHQODHFXDFLyQFRQVWLWXWLYDVyORGHSHQGHGHODV
SULPHUDVGHULYDGDVGHORVGHVSOD]DPLHQWRVFRQUHVSHFWRDX y T como se indica
HQ\VHHPSOHDHQWRQFHVODHFXDFLyQGHPRPHQWRGHPDQHUDVLPLODU
VHUiXQD3'(GHVHJXQGRRUGHQHQHOHVSDFLR\WLHPSR
3DUDXQDYDULOODGHVHFFLyQWUDQVYHUVDO\PRGXORFRQVWDQWH\VLODIXHU]DGHOFXHUSR
GHVDSDUHFHSRUHMHPSORFXDQGRE ODHFXDFLyQGHPRPHQWRSDUDXQPDWHULDO
OLQHDOVHFRQYLHUWHHQODFRQRFLGDHFXDFLyQGHODRQGDOLQHDO
1
C
u, xx
ü
2
Donde cHVODYHORFLGDGGHODRQGDUHODWLYDDODFRQ¿JXUDFLyQ\HVWDGDGDSRU
c2 =
E PF
ρ0
4.1.2.7.
Condiciones de contorno
/DVYDULDEOHVLQGHSHQGLHQWHVGHODHFXDFLyQGHPRPHQWRVRQODFRRUGHQDGDX y
el tiempo t (VWR HV XQ SUREOHPD GH YDORU LQLFLDOOtPLWH ,%93 3DUD FRPSOHWDU OD
GHVFULSFLyQGHOD,%93ODVFRQGLFLRQHVGHFRQWRUQR\FRQGLFLRQHVLQLFLDOHVGHEHQ
VHUGDGDV
(O OtPLWH HQ XQ SUREOHPD XQLGLPHQVLRQDO VH FRPSRQH GH ORV GRV SXQWRV HQ ORV
H[WUHPRVGHOGRPLQLRTXHHQHOSUREOHPDGHOPRGHORVRQORVSXQWRVGH;a\;E
'HODIRUPDOLQHDOGHODVHFXDFLRQHVGHPRPHQWRODHFXDFLyQVHSXHGH
REVHUYDUTXHODHFXDFLyQGLIHUHQFLDOSDUFLDOHVGHVHJXQGRRUGHQHQ;3RUORWDQWR
HQ FDGD H[WUHPR \D VHD X R X ; GHEH VHU SUHVFULWR FRPR XQD FRQGLFLyQ OtPLWH
VH SUHVFULEH Q0
(Q OD PHFiQLFD GH VyOLGRV HQ OXJDU GH X ; OD WUDFFLyQ
HVODXQLGDGQRUPDODOFXHUSRTXHHVGDGRSRUQ HQ;D n0 HQXb3XHVWR
TXHHOHVIXHU]RHVXQDIXQFLyQGHODPHGLGDGHODGHIRUPDFLyQXQLWDULDTXHDVX
YH] GHSHQGH GH OD GHULYDGD GH OD GHVSOD]DPLHQWR GDGD SRU OD HFXDFLyQ SUHVFULELHQGRW[0 FRPRHTXLYDOHQWHDODSUHVFULSFLyQX;HOVXSHUtQGLFH³QXOR´HQODW
LQGLFDTXHODWUDFFLyQVHGH¿QHVREUHHOiUHDQRGHIRUPDGDHOVXSHUtQGLFHVLHPSUH
VHLQFOX\HH[SOtFLWDPHQWHHQODWUDFFLyQW[0SDUDGLVWLQJXLUORGHOWLHPSRW3RUORWDQWR
RELHQODWUDFFLyQRHOGHVSOD]DPLHQWRGHEHQVHUSUHVFULWRVHQFDGDOtPLWH
8QDIURQWHUDHVOODPDGDFRPRXQOtPLWHGHGHVSOD]DPLHQWR\VHGHQRWDSRUīu si
HOGHVSOD]DPLHQWRHVSUHVFULWRVHOODPDXQOtPLWHGHWUDFFLyQ\GHQRWDSRUīt6LOD
WUDFFLyQHVSUHVFULWD
/RVYDORUHVSUHVFULWRVVRQGHVLJQDGRVSRUXQDEDUUDVXSHUSXHVWD/DVFRQGLFLRQHV
de contorno son:
−
o′
u =u
Γu
−0
n0 P = t x o Γt
&RPRXQHMHPSORGHODVFRQGLFLRQHVGHFRQWRUQRHQODPHFiQLFDGHVyOLGRVSDUD
ODYDULOODHQOD)LJXUDODFRQGLFLRQHVGHFRQWRUQRVRQ
u( X a , t ) 0
n 0 ( X b )P ( X b , t ) P ( X b , t )
T(t )
A0 ( X b )
/DWUDFFLyQ\HOGHVSOD]DPLHQWRQRSXHGHQVHUSUHVFULWRVHQHOPLVPRSXQWRSHUR
XQRGHHOORVGHEHVHUSUHVFULWRHQFDGDSXQWROtPLWHHVWRVHLQGLFDPHGLDQWH
Γu ∩ Γ t = 0
Γu ∪ Γ t = Γ
$VtHQXQSUREOHPDGHPHFiQLFDGHVyOLGRVXQLGLPHQVLRQDOFXDOTXLHUIURQWHUDHVR
ELHQXQOtPLWHGHWUDFFLyQRXQOtPLWHGHGHVSOD]DPLHQWRSHURQRKD\IURQWHUDSDUD
DPERVDODYH]
4.1.2.8.
Condiciones iniciales
3XHVWRTXHODHFXDFLyQTXHULJHSDUDODYDULOODHVGHVHJXQGRRUGHQHQHOWLHPSR
VHQHFHVLWDQGRVFRQMXQWRVGHFRQGLFLRQHVLQLFLDOHV([SUHVDQGRODVFRQGLFLRQHV
LQLFLDOHVHQWpUPLQRVGHORVGHVSOD]DPLHQWRV\YHORFLGDGHV
u( X , 0 ) = u0 ( X ) para X ∈ [ X a , X b ]
•
u( X , 0 ) = ν0 ( X ) para X ∈ [ X a , X b ]
6LHOFXHUSRHVWDLQLFLDOPHQWHHQUHSRVR\QRGHIRUPDGRODVFRQGLFLRQHVLQLFLDOHV
VHSXHGHQHVFULELUFRPR
u( X , 0 ) = 0
•
u = ( X ,0 ) = 0
Condiciones de Salto
$¿QGHTXHH[LVWDODGHULYDGDHQOD(FODFDQWLGDG$03GHEHVHUFRQWLQXD
6LQHPEDUJRQL$0QL3WLHQHQTXHVHUFRQWLQXDHQWRGRHOLQWHUYDOR3RUORWDQWRHO
EDODQFHGHOPRPHQWXPUHTXLHUHTXH
A0 P
0
Donde: <f> designa el salto de f (X)HVGHFLU
f( X ) = f( X + ε) − f( X − ε)
4.1.2.9.
ε→0
Formulación débil para la formulación Lagrangiana total
/D HFXDFLyQ GH PRPHQWR QR SXHGH VHU GLVFUHWL]DGR GLUHFWDPHQWH SRU HO PpWRGR
GH HOHPHQWRV ¿QLWRV &RQ HO ¿Q GH GLVFUHWL]DU HVWD HFXDFLyQ XQD IRUPD GpELO D
PHQXGROODPDGRIRUPDYDULDFLRQDOHVQHFHVDULD
(O SULQFLSLR GHO WUDEDMR YLUWXDO R IRUPD GpELO HV HTXLYDOHQWH D OD HFXDFLyQ GH
PRPHQWR\DODVFRQGLFLRQHVGHIURQWHUDGHODHFXDFLyQ(QFRQMXQWRHVWDV
GRV HFXDFLRQHV VH OODPDQ OD IRUPD IXHUWH /D IRUPD GpELO VH SXHGH XWLOL]DU SDUD
DSUR[LPDUODIRUPDIXHUWHSRUHOHPHQWRV¿QLWRVVROXFLRQHVREWHQLGDVSRUHOHPHQWRV
¿QLWRVVRQVROXFLRQHVDSUR[LPDGDVDODIRUPDIXHUWH
1.2.1 Forma Fuerte a la forma débil
/D IRUPD GpELO VH REWLHQH WRPDQGR HO SURGXFWR GH OD HFXDFLyQ GH PRPHQWR
H[SUHVDGDHQWpUPLQRVGHODIXQFLyQGHHYDOXDFLyQu(X, t)FRQODIXQFLyQGHSUXHED
‡X;HVWRGD
Xb
∫ δu [( A P ),
0
X
+ρ0 A0 b − ρ0 A0 ü ] dX = 0
Xa
8VDQGRODGHULYDGDGHOSURGXFWRHQSULPHUWpUPLQRGHVHWLHQH
Xb
∫
Xa
Xb
δu [( A0 P ),
X dX = ∫ [( δuA0 P ),X −δu ,X A0 P ] dX
Xa
Aplicando el teorema fundamental del cálculo de lo anterior se tiene:
Xb
∫ δu [( A P ),
0
X
Xb
dX = −
∫ δu ,
X
( A0 P )dx + ( δuA0 n 0 P )
X
( A0 P )dx + ( δuA0 t −0 )
Γ
X
Xa
a
Xb
=−
∫ δu ,
Xa
Γt
&RQVLGHUDQGR ODV FRQGLFLRQHV GH FRPSOHPHQWDULHGDG HQ OD IURQWHUD \ ODV
FRQGLFLRQHV GH WUDFFLyQ HQ OD IURQWHUD 6XVWLWX\HQGR OD (T HQ HO SULPHU
WpUPLQRGHOD(TFRQXQFDPELRGHVLJQRVHWLHQH
Xb
−0
∫ [ δu ,X A0 P − δu( ρ0 A0 b − ρ0 A0ü )] dX − ( δuA0 t x ) = 0
Xa
Γt
/DDQWHULRUH[SUHVLyQHVODIRUPDGpELOGHODHFXDFLyQGHPRPHQWR\ODFRQGLFLyQGH
IURQWHUDDWUDFFLyQSDUDODIRUPXODFLyQGH/DJUDQJHWRWDO
4.1.2.11. Suavizado en las funciones de prueba y de la evaluación
/D IRUPD GpELO HVWi ELHQ GH¿QLGD SDUD ODV IXQFLRQHV GH SUXHED \ GH HYDOXDFLyQ
TXH VRQ PXFKR PHQRV VXDYHV 'H KHFKR ODV IXQFLRQHV GH SUXHED \ HYDOXDFLyQ
SDUDVHUXWLOL]DGDVHQORVPpWRGRVGHHOHPHQWRV¿QLWRVHVPiViVSHUD/DIRUPD
GpELOLPSOLFDVyORODSULPHUDGHULYDGDGHODIXQFLyQGHSUXHED\ODIXQFLyQ
GHHYDOXDFLyQDSDUHFHGLUHFWDPHQWHRFRPRXQDSULPHUDGHULYDGDGHODIXQFLyQGH
SUXHEDDWUDYpVGHODWHQVLyQQRPLQDO3RUORWDQWRODLQWHJUDOHQODIRUPDGpELOHV
LQWHJUDEOHVLDPEDVIXQFLRQHVVRQC0.
/DIRUPDGpELOHVELHQGH¿QLGDVLODIXQFLyQGHSUXHEDX;WHVXQDIXQFLyQFRQWLQXD
FRQ WUD]RV GH GHULYDGDV FRQWLQXDV OR FXDO HV VLPEyOLFDPHQWH UHSUHVHQWDGR SRU
u(X,t) ฮC0 (X) donde XeLQGLFDTXHHVSHUPDQHQWH\FRQWLQXDHQ;(VWRHVORPLVPR
FRPRODFRQWLQXLGDGGHODVDSUR[LPDFLRQHVGHHOHPHQWRV¿QLWRVHQHOSURFHVRVGH
HOHPHQWRV¿QLWRVOLQHDOHV
(OGHVSOD]DPLHQWRHVFRQWLQXR\GLIHUHQFLDEOHFRQWLQXDPHQWHHQWUHHOHPHQWRVSHUR
ODGHULYDGDuXHVGLVFRQWLQXDDORODUJRGHODIURQWHUDGHOHOHPHQWR(VWDVFRQGLFLRQHV
VREUHORVGHVSOD]DPLHQWRVGHSUXHEDVRQVLPEyOLFDPHQWHUHSUHVHQWDGRVSRU
u( X , t ) ∈ U
•
donde U = { u( X , t ) ∈ C 0 ( X ), u = u en Γu }
/DVIXQFLRQHVGHSUXHEDHVWiVGH¿QLGDVSRU‡X;HOODVno sonIXQFLRQHVGHOWLHPSR
/DVIXQFLRQHVGHSUXHEDUHTXLHUHQVHUC0 en X HQORVOtPLWHVGHGHVSOD]DPLHQWR
3RUHMHPSOR
0
δu( X ) ∈ U0 donde U0 = { δu( X ) δ( X )u ∈ C ( X ), δ u = 0 en Γu
4.1.2.12.
Forma débil a la forma fuerte
3DUDGHVDUUROODUODVHFXDFLRQHVLPSOtFLWDVSDUDODVIRUPDVGpELOHVFRQODIXQFLyQGH
SUXHED\GHHYDOXDFLyQPHQRVVXDYH\UHVSHFWLYDPHQWH/DIRUPD
GpELOHVWiGDGDSRU
Xb
∫
−0
δu [( A0 P ),X +ρ0 A0 b − ρ0 A0 ü ] dX + δuA0 ( n 0 P − t
x
+ ∑ δu A0 P Γ i = 0 ∀δu( X ) ∈ U0
)
Γt
Xa
i
3DUD H[WUDHU OD IRUPD IXHUWH VH WLHQH TXH HOLPLQDU OD GHULYDGD GH ‡u (X ) de la
integral Esto se logra mediante la integración por partes y aplicando teoremas
IXQGDPHQWDOHVGHFiOFXOR7RPDQGRODGHULYDGDGHOSURGXFWR‡u A0P se tiene:
Xb
Xb
Xb
Xa
Xa
Xa
∫ ( δuA0 P ),X dX = ∫ δu ,X A0 PdX + ∫ δu( A0 P ),X dX
(OVHJXQGRWpUPLQRSXHGHVHUFRQYHUWLGRHQYDORUHVSXQWXDOHVXVDQGRWHRUHPDV
IXQGDPHQWDOHVGHFDOFXOR3HUPLWLHQGRTXHODIXQFLyQFRQWLQXDA0P; sea continua
HQORVLQWHUYDORV>;i;[email protected] DQHQWRQFHVSRUORVWHRUHPDVIXQGDPHQWDOHV
del cálculo se tiene:
X2e
∫ ( δuA0 P ),X dX = ( δuA0 P ) X − ( δu A0 P ) X ≡ ( δuA0 n P ) Γ
0
i
i
2
X1e
1
i
Donde n0 es la normal a los segmentos n;i n;i \ni denota los dos
puntos de frontera de los segmento i VREUH OD FXDO OD IXQFLyQ HV FRQWLQXDPHQWH
HQWRQFHV DSOLFDQGR GLIHUHQFLDEOHV &RQVLGHUDQGR TXH
VREUHHOWRGRHOGRPLQLRVHWLHQH
Xb
∫ ( δuA0 P ),X dX = ( δuA0 P ) Γ − ∑ δu A0 P Γ
t
Xa
i
i
Donde ni son las interfaces entre los segmentos en los cuales la integral es
FRQWLQXDPHQWHGLIHUHQFLDEOH/DVFRQWULEXFLRQHVGHORVSXQWRGHIURQWHUDVREUHHO
lado derecho en la ecuación anterior aparecen solamente en la frontera de tracción
de nt desde ‡u =0 VREUHnu y nu= nint YHDHF\HQWRQFHV
Xb
Xb
∫ δu ,x ( A0 P )dX = − ∫ δu ,x ( A0 P ),x dX + ( δuA0 n P ) Γ − ∑ δu A0 P Γ
0
Xa
t
Xa
i
i
6XVWLWX\HQGRHQVHWLHQH
Xb
∫
−0
δu [( A0 P ),X +ρ0 A0 b − ρ0 A0 ü ] dX + δuA0 ( n 0 P − t
Xa
x
+ ∑ δu A0 P Γ i = 0 ∀δu( X ) ∈ U0
)
Γt
i
/DFRQYHUVLyQGHODIRUPDGpELODXQDIRUPDDPLJDEOHSDUDXVDUODHFXDFLyQ
\HVWiFRPSOHWD
4.1.2.13. Nombres físicos de los términos de trabajo virtuales
(OWUDEDMRYLUWXDOGHODVIXHU]DVGHOFXHUSRb(X,t) y las tracciones prescritos t;TXH
FRUUHVSRQGHDOVHJXQGR\FXDUWRWpUPLQRVGHHVOODPDGRHOWUDEDMRH[WHUQR
YLUWXDO\DTXHUHVXOWDGHODVFDUJDVH[WHUQDV(VGHVLJQDGRSRUHOVXSHUtQGLFH³H[W´
y esta dado por:
Xb
δW ext =
∫
−0
δuρ0 bA0 dX + ( δuA0 t
x
)
Γt
Xa
(OSULPHUWpUPLQRGHOD(THVHOOODPDGRWUDEDMRLQWHUQRYLUWXDO\DTXHVXUJH
GHODVWHQVLRQHVHQHOPDWHULDO6HSXHGHHVFULELUHQGRVIRUPDVHTXLYDOHQWHV
Xb
Xb
0
∫ X 0
∫
X
X
δW
int
δu , PA dX =
=
a
δFPA dX
a
'RQGHOD~OWLPDIRUPDWRPDGDGHOD(FDVXPHODIRUPDVLJXLHQWH
δ( δx )
δu ,X ( X ) = δ( φ( X ) − X ),X =
= δF
∂X
(VWD GH¿QLFLyQ GH WUDEDMR LQWHUQR GDGD HQ OD (F HV FRQVLVWHQWH FRQ OD
H[SUHVLyQ GHO WUDEDMR LQWHUQR H[SUHVDGR HQ OD HFXDFLyQ GH FRQVHUYDFLyQ GH OD
HQHUJtD(FVLVHFDPELDODVUD]RQHVHQOD(FDLQFUHPHQWRV
YLUWXDOHVHQWRQFHVr0 ‡wint = ‡FP(OWUDEDMRLQWHUQRYLUWXDOHV‡W intHVGH¿QLGD
VREUHWRGRHOGRPLQLRSRUORTXHVHWLHQH
Xb
δW int =
∫
Xb
δw int ρ0 A0 dX =
Xa
∫ δFPA dX
0
Xa
(OFXDOHVHOPLVPRWHUPLQRTXHDSDUHFHHQODIRUPDGpELOHQ
El termino r0AoଚSXHGHVHUFRQVLGHUDGRFRPRXQDIXHU]DVREUHHOFXHUSRTXHDFW~D
HQODGLUHFFLyQRSXHVWDDODDFHOHUDFLyQSRUHMHPSORHQXQVHQWLGRG¶$OHPEHUW
'HVLJQDQGRDOFRUUHVSRQGLHQWHWUDEDMRYLUWXDOSRU‡Winert y designando esto como
HOWUDEDMRYLUWXDOLQHUFLDOVHWLHQH
Xb
δW in er t =
∫ δuρ A üdX
0
0
Xa
(VWHHVHOWUDEDMRGHELGRDODVIXHU]DVGHLQHUFLDVREUHHOFXHUSR
4.1.2.14. Principio del trabajo virtual
(OSULQFLSLRGHOWUDEDMRYLUWXDODKRUDHVLQGLFDGRXVDQGRORVQRPEUHVItVLFDPHQWH
0HGLDQWHHOXVRGHODVHFXDFLRQHVD(FHQWRQFHVVHSXHGH
HVFULELUFRPR
δW ( ∂u , u ) ≡ δW int − δW ext + δW inert = 0 ∀δu ∈ U0
4.1.3 EULER EXPLICITO
(Q XQD IRUPXODFLyQ HXOHULDQD ORV QRGRV VRQ ¿MRV HQ HO HVSDFLR \ ODV YDULDEOHV
independientes son funciones de la coordenada espacial Euleriana x y del tiempo
t/DPHGLGDGHOHVWUpVHVHOHVIXHU]RGH&DXFK\ItVLFRı[WODPHGLGDGHOD
GHIRUPDFLyQHVODUD]yQGHODGHIRUPDFLyQGHODYHORFLGDGGHDx(x,t).(OPRYLPLHQWR
VHGHVFULELUiSRUODYHORFLGDGv(x,t)(QODVIRUPXODFLRQHVGH(XOHUODGHIRUPDFLyQ
QR VH H[SUHVD FRPR XQD IXQFLyQ GH OD UHIHUHQFLD GH FRRUGHQDGDV GHVGH XQD
FRQ¿JXUDFLyQQRGHIRUPDGDODFRQ¿JXUDFLyQLQLFLDOQRSXHGHVHUHVWDEOHFLGD\
QLQJXQDKRPRORJDFLyQGHHVGLVSRQLEOH
Ecuaciones que gobiernan la Formulación Euleriana.19
4.1.3.1.
Ecuación de la continuidad ( conservación de masa ) :
∂ρ ∂( ρν )
+
=0
∂t
δx
Ecuación de momento :
∂ν
∂( Aσ )
∂ν δν
∂σ
∂ν
σ
ρA(
∂t
+ν
∂x
)=
∂x
+ ρAb
ρ(
δt
+
∂x
)=
∂x
+ ρb
Medición del esfuerzo ( radio de deformación ) : Dx = ν,x
La ecuación constitutiva en forma de ratio :
−
−
−
Dσ
σD
Dt
= σ,t ( x , t ) + σ,x ( x , t )ν( x , t ) = St ( Dx( X , t ), σ( X , t ), etc ., t ≤ t )
Ecuación de conservación de la energía:
δW ( ∂u , u ) ≡ δW int − δW ext + δW inert = 0 ∀δu ∈ U0
7HG%HO\WVFKNR:LQJ.DP/LX%ULDQ0RUDQ.KDOLO,(ONKRGDU\1RQOLQHDU)LQLWH(OH
PHQWVIRU&RQWLQXDDQG6WUXFWXUHV6HFRQG(GLWLRQ
/DVHFXDFLRQHVTXHVHLQGLFDURQDQWHULRUPHQWHHQFRPSDUDFLyQFRQODDFWXDOL]DFLyQ
GHOD)RUPXODFLyQGH/DJUDQJHSUHVHQWDFXDWURSXQWRVTXHVRQGLJQRVGHPHQFLyQ
/D HFXDFLyQ GH FRQVHUYDFLyQ GH OD PDVD HVWi HVFULWD FRPR XQD HFXDFLyQ HQ
GHULYDGDVSDUFLDOHVODIRUPDXVDGDFRQPDOODVGH/DJUDQJHQRHVDSOLFDEOH\D
TXHVyORVHDSOLFDDSXQWRVPDWHULDOHV
/DGHULYDGDGHOWLHPSRPDWHULDOSDUDODYHORFLGDGHQODHFXDFLyQGHOPRPHQWRKD
VLGRHVFULWDHQWpUPLQRVGHODGHULYDGDHQHOWLHPSR\HQHOWUDQVSRUWHHVSDFLDO
/DHFXDFLyQFRQVWLWXWLYDVHH[SUHVDHQIRUPDGHWDVDODIRUPDWRWDOQRSXHGH
VHUXWLOL]DGR\DTXHHOHVIXHU]R\ODYHORFLGDGGHGHIRUPDFLyQVRQIXQFLRQHVGH
ODVFRRUGHQDGDVPDWHULDOHVHQXQKLVWRULDGHSHQGLHQWHGHPDWHULDO
/DVFRQGLFLRQHVGHIURQWHUDVRQDKRUDLPSXHVWDVDSXQWRVHVSDFLDOHVTXHQRVH
PXHYHQFRQHOWLHPSR
/DHFXDFLyQGHFRQWLQXLGDGVHKDHVFULWRFRPRXQDHFXDFLyQGLIHUHQFLDOSDUFLDO
\DTXHHVQRHVSRVLEOHREWHQHUXQDIRUPDLQWHJUDOFRPRHQOD(FFXDQGROD
GHQVLGDGHVXQDIXQFLyQGHFRRUGHQDGDVHVSDFLDOHV3RUORWDQWRODHFXDFLyQGH
FRQWLQXLGDGGHEHVHUWUDWDGDFRPRXQHFXDFLyQGLIHUHQFLDOSDUFLDOVHSDUDGD
/D HFXDFLyQ FRQVWLWXWLYD QHFHVLWD VHU H[SUHVDGD HQ WpUPLQRV GH FRRUGHQDGDV
PDWHULDOHV SDUD KLVWRULD GHSHQGLHQWH GH PDWHULDOHV SRU OR TXH HV WUDWDGD HQ
IRUPDGHWDVDHQHVWDIRUPXODFLyQ(VSRUORWDQWRXQDHFXDFLyQGLIHUHQFLDOSDUFLDO
VHSDUDGD
4.2 APLICACIÓN DE UN MÉTODO PARA EL ANÁLISIS A IMPACTO
FRONTAL DE UNA CARROCERÍA
$QWHULRUPHQWHVHGHWHUPLQyTXHVHYDKDXWLOL]DUXQWHUFLRGHODFDUURFHUtDGHELGRDO
DOWRSURFHVDPLHQWRUHTXHULGRWDQWRHVDVtTXHVHHVWDEOHFHQFRQGLFLRQHVGHLPSDFWR
SDUDODVLPXODFLyQGHPRGRTXHODFDELQDVHGHQRPLQDDVtDOWHUFLRGHODQWHURGH
ODFDUURFHUtDWRPDGDHQFXHQWDSDUDHOHVWXGLRLPSDFWHFRQWUDXQDSDUHGUtJLGD
ULJLGZDOOTXH/6'<1$SURSRUFLRQDFRPRXQDUHVWULFFLyQ(OREMHWLYRGHOHVWXGLR
FRPSXWDFLRQDOHVLGHQWL¿FDUHQEDVHDUHVXOWDGRVOD]RQDFUtWLFD\HOSXQWRFUtWLFR
HQ OD FDUURFHUtD GH WDO PDQHUD TXH VH SXHGD HYDOXDU LQJHQLHULOPHQWH HO HIHFWR
ItVLFRVREUHODHVWUXFWXUD6HSODQWHDXQPpWRGRGHDQiOLVLVPDWHPiWLFRHQ]RQD
SOiVWLFDWHQGLHQWHDREWHQHUUHVXOWDGRVFRPSDUDEOHVFRQORVFRPSXWDFLRQDOHVHQ
XQHOHPHQWRVLPSOL¿FDGRSHUWHQHFLHQWHDOD]RQDFUtWLFDGHODFDUURFHUtDFRPROR
HVXQDYLJDGHODHVWUXFWXUDFRQHOREMHWLYRGHFRPSUHQGHUODGLIHUHQFLDHQWUHHO
DQiOLVLVFRP~Q\HOPpWRGRGHHOHPHQWRV¿QLWRV
(ODQiOLVLVPDWHPiWLFRVHORUHDOL]DHQHOIURQWDOGHODHVWUXFWXUDHOTXHVHGHWHUPLQy
UHVXOWDVHUOD]RQDFUtWLFDDOPRPHQWRGHOLPSDFWRHQOD¿JXUDVHREVHUYDHO
FRPSRQHQWHGHFDUURFHUtDHQPHQFLyQ
)LJXUD)URQWDOVHOHFFLRQDGRSDUDDSOLFDFLyQGHOPpWRGRGHDQiOLVLVGHLPSDFWRV
$SDUWLUGHOPRGHORVHOHFFLRQDGRVHGHWHUPLQDHOGLDJUDPDGLQiPLFRFRUUHVSRQGLHQWH
PLVPRTXHVHPXHVWUDHQOD¿JXUD
)LJXUD5HSUHVHQWDFLyQItVLFDGHOPRGHORDLPSDFWR
'HPRGHORGHOD¿JXUDDQWHULRUVHGHWHUPLQDODVVLJXLHQWHVFRQGLFLRQHVItVLFDV
•
•
∑ F = −k .( y − u ) − c.( y − u ) = m.u
y
m.u + c .u + k .u = k .y + c .y = F externa
/D IXHU]D HOiVWLFD \ GH DPRUWLJXDPLHQWR VRQ IXHU]DV TXH UHVLVWHQ DO VLVWHPD
HTXLOLEUDQGRDODIXHU]DLQHUFLDOGHOFXHUSRHQPRYLPLHQWR
6LVHFRQVLGHUDODVHFXDFLRQHVGHODFLQHPiWLFDGHXQDSDUWtFXODHQPRYLPLHQWR
uniformemente acelerado se tiene que:
uf = u0 + u.t
1
u = u .t + u.t 2
2
$KRUD VH HIHFWXDUi XQD DSUR[LPDFLyQ TXDVLHVWiWLFD GH ORV HIHFWRV GLQiPLFRV GHO
VLVWHPD(VWRVHIHFWRVVHDSOLFDDFRH¿FLHQWHVGHDPSOLDFLyQGLQiPLFDHTXLYDOHQWH
DGLFKDVDFFLRQHVHVWiWLFDV
1
: Factor de magnificación dinámica.
1+ β2
Aplicando el algoritmo para análisis transitorio estructural a partir de las ecuaciones
GHOPRYLPLHQWRXQLIRUPHPHQWHDFHOHUDGR0pWRGRGH1HZPDUN
/DVHFXDFLRQHVTXHVHSUHVHQWDQVRQLQFRQGLFLRQDOPHQWHHQHVWDGRHVWDEOH
un +1 − un = (1 − γ )un ∆t + γ un +1 ∆t
un +1 − un = un ∆t +
1
((1 − 2 β )u∆t 2 ) + β un +1 ∆t 2
2
,QWHJUDFLyQGHODUHVLVWHQFLDGH+RXUJODVV
[ M ] un = [ Fn externa ] − [ Fn int erna ] + Hn + [ Fn contacto ] + [ Fn flexión ]
+RXUJODVV VRQ ODV GHIRUPDFLRQHV GH HQHUJtD FHUR SDUD HO XQ SXQWR LQWHJUDURQ HO
HOHPHQWRVyOLGR
)LJXUD'HIRUPDFLRQHV+RXUJODVV
90
(VWDGHIRUPDFLyQGHPDOODQRSURGXFHQLQJXQDGHIRUPDFLyQRFDPELRGHYROXPHQ
GHODPDOOD(OFRQWUROGHO+RXUJODVVWUDHDODULJLGH]RDODPRUWLJXDPLHQWRYLVFRVR
XQIHQyPHQRQRItVLFRTXHGHEHVHHUPLQLPL]DGRPRGRVGHHQHUJtDFHUR
/RVSURJUDPDVGHHOHPHQWRV¿QLWRVXWLOL]DQODUHJODWUDSH]RLGDO\VHEDVDQHQODOH\
GHODFRQVHUYDFLyQGHHQHUJtD
6LODHQHUJtDGHO+RXUJODVVHVPHQRUDOGHODHQHUJtDLQWHUQDODVROXFLyQHV
DFHSWDEOH
$KRUD VH HIHFWXDUi XQD DSUR[LPDFLyQ FXDVLHVWiWLFD GH ORV HIHFWRV GLQiPLFRV GHO
VLVWHPD(VWRVHIHFWRVVHDSOLFDDFRH¿FLHQWHVGHDPSOLDFLyQGLQiPLFDHTXLYDOHQWH
DGLFKDVDFFLRQHVHVWiWLFDV
*
un +1 = u n + γ un +1 ∆t
*
un +1 = u n + β un +1 ∆t 2
)RUPXODFLyQ([SOtFLWD
'HODVROXFLyQDQWHULRUVHFRQVLGHUDTXHH[LVWHXQDHOHYDGDDPSOLWXGHQXQLQWHUYDOR
GHWLHPSRGHOWDWFRPRVHPXHVWUDHQOD)LJXUD
)LJXUD&RPSDUDFLyQHQWUHGLQiPLFDLPSOtFLWD\H[SOtFLWD
(QWRQFHV HV DSURSLDGR UHDOL]DU XQ DQiOLVLV H[SOtFLWR HQ FRQGLFLRQHV GH HOHYDGDV
IUHFXHQFLDVFXDQGRHOVLVWHPDHVLQHVWDEOHGRQGHHOLQWHUYDORGHWLHPSRGLVPLQX\H
RHVPX\SHTXHxR9HU7DEOD
7DEOD
Valores típicos para impacto de sólidos
VELOCIDAD
Deformación
Tiempo de respuesta
Tensión
Velocidad de deformación
Presión
BAJA
Global
ms - s
<10%
< 10 s -1
/LPLWHÀXHQFLD
ALTA
Local
µs - ms
>50%
> 10000 s -1
[/tPLWHÀXHQFLD
3DUDHOFDVRFRQWUDULRHODQiOLVLVHVLPSOtFLWRGRQGHODVIUHFXHQFLDVVRQEDMDV\HO
VLVWHPDHVHVWDEOHFRQWLHPSRVPiVJUDQGHV9HU7DEOD
(QODWDEODVHGHWDOODQORVUDQJRVGHYHORFLGDGGHLPSDFWRODVYHORFLGDGHVGH
GHIRUPDFLyQHOHIHFWRTXHVHSURGXFHHQORVPDWHULDOHVSRUHIHFWRGHOLPSDFWR\
TXHWLSRGHVROXFLyQVHHPSOHDQVHJ~QVHDHOFDVR
7DEOD
Respuesta de los Materiales al Impacto
Solución
Velocidad Impacto
(m/s)
,PSOtFLWD
([SOtFLWD
Velocidad de deformación (/s)
Efecto
(VWiWLFR&UHHS
Elástico
(ODVWR3OiVWLFRUHVLVWHQ
FLDGHOPDWHULDOVLJQL¿FD
WLYD
6
$QWHWRGRSOiVWLFRODSUH
sión es igual o mayor a la
UHVLVWHQFLDGHOPDWHULDO
6 +LGURGLQiPLFD
SUHVLyQPXFKDVYHFHVOD
UHVLVWHQFLDGHOPDWHULDO
!
!
9DSRUL]DFLyQGHORVVyOL
dos colisionados
2
&RPRGHOWDWHVPX\SHTXHxR\HOSURGXFWRGHORVWpUPLQRVγ∆t y β∆t HVGHVSUHFLDEOH
la ecuación resulta:
[ M ] un +1 = [ Fn +1residual ]
/DDFHOHUDFLyQDSUR[LPDGDHVFRUUHJLGDSRUHOPpWRGRGHGLIHUHQFLDFLyQFHQWUDO
[ M ] un [ Fn residual ]
/DHFXDFLyQJHQHUDOGHPRYLPLHQWRSDUDODVROXFLyQH[SOtFLWDHV
[ M ] un + [ C ] un + [ K ] un = [ Fn externa ]
)LJXUD'LVFUHWL]DFLyQSRUGLIHUHQFLDVFHQWUDOHV
Velocidad .
1
( un +1 − un −1 )
un =
2 ∆t
Aceleración.
1
un = ( u 1 − u 1 )
n−
∆t n + 2
2
1 un +1 − un un − un −1
−
(
)
∆t
∆t
∆t
1
un = 2 ( un +1 − 2un + un −1 )
∆t
un =
6XVWLWX\HQGRHQODHFXDFLyQJHQHUDOGHOPRYLPLHQWR
[ M ] un + [ C ] un + [ K ] un = [ Fn externa ]
([ M ]
2
1
1
1
1
)un −1 = [ Fn externa ]
+ [C ]
)un +1 + ([ K ] − [ M ] 1 )un + ([ M ] 2 − [ C ]
2
∆t
2 ∆t
∆t
∆t
2 ∆t
/DVPDWULFHV0\&VRQGLDJRQDOHV\VXVLQYHUVDVWLHQHQVROXFLyQWULYLDO
/D VROXFLyQ GDGD HQ OD HFXDFLyQ HV VyOR FRQGLFLRQDOPHQWH FRQYHUJHQWH HV
QHFHVDULRTXHHOSDVRGHOWLHPSRGHEHVHUPiVSHTXHxRTXHXQSDVRGHWLHPSR
FUtWLFRGDGRSRU :
∆t
cr =
T 2
m
= = 2
π ω
k
Donde: T es el periodo del sistema dinámico
(QWRQFHVFRQHO¿QGHUHDOL]DUODLQWHJUDFLyQHQHOWLHPSRVHWLHQH
$OJRULWPR SDUD DQiOLVLV H[SOtFLWR HVWDEOH R WDPELpQ FRQRFLGR FRPR 0pWRGR GH
GLIHUHQFLDFHQWUDO
∆t 2 u − 1 = u0 − ∆t .u0 +
u0
2
Figura 4.8 Algoritmo para análisis explícito
Fuente: SHEN R. WU and LEI GU, (2012) ,QWURGXFWLRQWRWKHH[SOLFLW¿QLWHHOHPHQWPHWKRGIRUQRQOLQHDU
transient dynamics, Editorial WILEY
+-%XQJH.3|KODQGW$(UPDQ7HNND\D)RUPDELOLW\RI0HWDOOLF0DWHULDOV3ODVWLF$QLVRWURS\
)RUPDELOLW\7HVWLQJ6SULQJHU
Lavelocidad no es diferencia centrada
1
u 1 =
( un +1 − un )
n+
2 ∆t 1
2
n+
2
La aceleración no es diferencia centrada
1
un =
( u 1 − u 1 )
n−
∆t n n + 2
2
u
1
n+
2
= u
1
n−
2
+ un ∆t n → u
un +1 = un + u
n+
1
2
.∆t n + 1
1
n+
2
= u
1
n−
2
+ un
1
( ∆t 1 + ∆t 1 )
n+
n−
2
2
2
2
4.3. &21752/'(+285*/$663$5$/$&219(5*(1&,$
4.3.1. 02'26'(/&21752/325+285*/$66
/RVPRGRVGHFRQWUROGHUHORMGHDUHQDPiVFRQRFLGRFRPR+RXUJODVVVRQPRGRV
QRItVLFRVGHGHIRUPDFLyQTXHVHSURGXFHQHQORVHOHPHQWRVQRLQWHJUDGRV\TXH
QRSURGXFHQHVIXHU]RV3RUQRLQWHJUDGRVVHUH¿HUHDORVVLJXLHQWHVFDVRV
•
•
/RVHOHPHQWRVVyOLGRVFRQXQ~QLFRSXQWRGHLQWHJUDFLyQ
6XSHU¿FLHV FRQ OD FDUDFWHUtVWLFD GH VHU HOHPHQWRV FRQ XQ ~QLFR SXQWR GH
LQWHJUDFLyQHQHOSODQR
•
(VPXFKRPiVUiSLGRLQWHJUDUHQXQSXQWRORFXDOJHQHUDUHVXOWDGRVDFHSWDEOHV
\TXHD\XGDQDPLQLPL]DUORVPRGRVGH+RXUJODVV
/RVPpWRGRVGHFRQWUROGH+RXUJODVVSRUORJHQHUDOORTXHKDFHQHVSHUPLWLUXQ
GRPLQLRGHPDOODPHGLDQWHODDSOLFDFLyQGHIXHU]DVLQWHUQDVSDUDUHVLVWLUORVPRGRV
GH GHIRUPDFLyQ GHO +RXUJODVV +* D WUDYpV GH XQR GH ORV YDULRV DOJRULWPRV GH
FRQWURO+*/DHQHUJtDGHUHORMGHDUHQDTXHUHSUHVHQWDHOWUDEDMRUHDOL]DGRSRU
ODVIXHU]DVFDOFXODGDVSDUDUHVLVWLUORVPRGRVGH+RXUJODVVORVTXHTXLWDQHQHUJtD
ItVLFDDOVLVWHPD
/RVPRGRVGHFRQWURODSOLFDEOHVItVLFDPHQWHVHJ~Q/LYHUPRUH6RIWZDUH7HFKQRORJ\
&RUSRUDWLRQ´ son los siguientes :
‡
6yOLGRVQRLQWHJUDGRVORVTXHWLHQHQPRGRV+* HMHPSORV GH HVWRV
modos se muestran a continuación:
)LJXUD0RGRVGH+RXUJODVV
/DVVXSHU¿FLHVQRLQWHJUDGDVTXHWLHQHQPRGRV+*$FRQWLQXDFLyQVHUHIHUHQFLD
WUHVFDVRVGHHVWHWLSRGHFRQWURO
)LJXUD0RGRVGH+RXUJODVVHQ6KHOO
/DGHIRUPDFLyQHYLGHQWHSRU+RXUJODVVSXHGHREVHUYDUVHVLQHVFDODSDUDGHWHUPLQDU
VXVGHVSOD]DPLHQWRV$OYLVXDOL]DUXQDGHIRUPDFLyQSRU+RXUJODVVPRGHUDGD\VL
VHUHTXLHUHDPSOLDUODHVFDODSDUDGHWHUPLQDUORVGHVSOD]DPLHQWRVVHXWLOL]DSRU
HMHPSORHOVRIWZDUH/635(3267
4.3.2. 02'263$5$0,1,0,=$52(9,7$5(/+285*/$66
/RV 6yOLGRV \ ODV VXSHU¿FLHV WRWDOPHQWH LQWHJUDGDV QR SHUPLWHQ OD IRUPDFLyQ GH
+RXUJODVV6LQHPEDUJRODLQWHJUDFLyQWRWDOHVPiVFDUDHQFXDQWRDUHFXUVRVVH
UH¿HUH
/RVHOHPHQWRVWRWDOPHQWHLQWHJUDGRVSXHGHQVHUPHQRVUREXVWRVSDUDHOFDVRGH
96
JUDQGHVGHIRUPDFLRQHV
(OHPHQWRV WHWUDHGURV \ WULDQJXODUHV QR VH UHFRPLHQGDQ SDUD +RXUJODVV GHELGR
D OD WHQGHQFLD GH EORTXHR TXH HVWRV SUHVHQWDQ /LYHUPRUH 6RIWZDUH 7HFKQRORJ\
&RUSRUDWLRQ
3DUD ORV HOHPHQWRV TXH VRQ VXVFHSWLEOHV D GHIRUPDFLRQHV SRU +RXUJODVV SDUD
UHGXFLUODGHIRUPDFLyQVHDSOLFDQIXHU]DVLQWHUQDVHQHOUHORMGHDUHQD
+D\YDULRVDOJRULWPRVIRUPXODFLRQHVGH+RXUJODVVGLVSRQLEOHVSDUDHOFiOFXORGH
HVWDVIXHU]DV
&RPRVHPHQFLRQyODVIXHU]DV+RXUJODVVVLUYHQSDUDUHVLVWLUPRGRVGHGHIRUPDFLyQ
SRU +RXUJODVV FRPR OR PXHVWUD OD )LJXUD SDUD HOOR VH UHTXLHUH LQWURGXFLU
IXHU]DVQRGDOHVLQWHUQDVTXHFRQWUDUUHVWHQPRGRVGH+RXUJODVV
)LJXUD)XHU]DVQRGDOHV+RXUJODVVTXHUHVLVWHQ+*
4.3.3. )250$6 '( &21752/ '(/ +285*/$66 67,))1(66 9(5686
VISCOUS
4.3.3.1.
Formas viscosas
/DVIRUPDVYLVFRVDVJHQHUDQIXHU]DVGH+RXUJODVVTXHUHVXOWDQSURSRUFLRQDOHVDODV
FRPSRQHQWHVGHODYHORFLGDGQRGDOSRUORFXDOFRQWULEX\HQDOPRGRGH+RXUJODVV$
ODYH]LQKLEHODGHIRUPDFLyQ+RXUJODVVDGLFLRQDOVLQHPEDUJRODGHIRUPDFLyQ+*
DFXPXODGD QR SXHGH UHFXSHUDUVH SUHYLDPHQWH /LYHUPRUH 6RIWZDUH 7HFKQRORJ\
&RUSRUDWLRQ
97
/DIRUPDYLVFRVDVHUHFRPLHQGDSDUDDOWDVYHORFLGDGHV\DOWDVWDVDVGHGHIRUPDFLyQ
SUREOHPDVUHODFLRQDGRVSRUHMHPSORFRQH[SORVLYRVGHDOWDSRWHQFLD
4.3.3.2.
Formas rígidas
/DV IRUPDV UtJLGDV JHQHUDQ IXHU]DV GH UHORM GH DUHQD SURSRUFLRQDOHV D ODV
FRPSRQHQWHVGHGHVSOD]DPLHQWRVQRGDOHVTXHFRQWULEX\HQDOPRGRGH+RXUJODVV
6RQFDSDFHVGHUHGXFLUODGHIRUPDFLyQWRWDODFXPXODGDHQHO+RXUJODVV6RQLGHDOHV
SDUDSUREOHPDVGHWDVDVPiVEDMDVGHGHIRUPDFLyQLQFOX\HQGRVLPXODFLRQHVGH
DFFLGHQWHVGHYHKtFXORV/LYHUPRUH6RIWZDUH7HFKQRORJ\&RUSRUDWLRQ
/DVIRUPDVUtJLGDVSXHGHQHQGXUHFHUDUWL¿FLDOPHQWHODUHVSXHVWD3RUORWDQWRVH
GHEHUHGXFLUHOFRH¿FLHQWHGHUHORMGHDUHQDVHUHFRPLHQGDGHVGHKDVWD
SDUDPLQLPL]DUODULJLGH]GHOHIHFWR/LYHUPRUH6RIWZDUH7HFKQRORJ\&RUSRUDWLRQ
4.4 IDEALIZACIÓN DEL MODELO
&RQVLGHUDGRDODLGHDOL]DFLyQGHXQSUREOHPDUHDOFRPRXQSURFHVRTXHSHUPLWH
JHQHUDUXQPRGHORGHFDUiFWHUFLHQWt¿FRVREUHHOPRGHORHQHVWXGLR/RVSULQFLSLRV
DVXPLGRVIUHFXHQWHPHQWHVHXWLOL]DQFRQHOREMHWLYRTXHORVPRGHORVLGHDOL]DGRV
VHDQ PiV IiFLOHV GH FRPSUHQGHU \ UHVROYHU $GHPiV OD LGHDOL]DFLyQ EXVFD QR
PRGL¿FDU OD H[DFWLWXG SUHGLFWLYD GHO PRGHOR SRU YDULDV UD]RQHV /D PD\RUtD GH
GHEDWHV VREUH OD H[DFWLWXG \ XWLOLGDG GH XQ PRGHOR VXHOHQ VHU VREUH VL VRQ R QR
DSURSLDGDVODVLGHDOL]DFLRQHVUHDOL]DGDV
6H LGHDOL]D XQD EDUUD TXH UHSUHVHQWD DO HOHPHQWR HVWUXFWXUDO IURQWDO FRQ VXV
FDUDFWHUtVWLFDV\SURSLHGDGHVPHFiQLFDVGHOPDWHULDODFHURJDOYDQL]DGRODVTXHVH
GHVFULELHURQHQHO&DStWXOR,,,
)LJXUD0RGHORGHOIURQWDO\ODEDUUDGHODFDUURFHUtDSDUDLGHDOL]DFLyQ
6HDVXPHSDUDHOHVWXGLR\VHJ~QORGHWHUPLQDODQRUPDV1&$3XQDYHORFLGDGGH
LPSDFWRGH.PKFRQWUDXQPXURUtJLGRODYHORFLGDGHVFRQVWDQWHDOPRPHQWR
GHOLPSDFWRVLQHPEDUJRH[LVWHXQDDFHOHUDFLyQTXHVHGHVDUUROODGHVGHHOUHSRVR
GHODFDUURFHUtD
6HFRQVLGHUDTXHODIXHU]DDSOLFDGDDOIURQWDOFRUUHVSRQGHDODUHDFFLyQJHQHUDGD
SRU HIHFWR GHO LPSDFWR FRQWUD OD SDUHG HVWD VHUi WRGD OD PDJQLWXG GH OD IXHU]D
HQVHQWLGRRSXHVWRDOFKRTXHGLFKDIXHU]DVHFDOFXOyDSDUWLUGHODVHJXQGDOH\
GH1HZWRQDVtODIXHU]DHVFRQVLGHUDGDFRPRXQLIRUPHPHQWHGLVWULEXLGDVREUHOD
EDUUDTXHUHSUHVHQWDDOIURQWDO
/DPDVDHQODHFXDFLyQVHUHHPSOD]yFRQHOYDORUGHODPDVDGHOIURQWDO(OREMHWLYR
GHODLGHDOL]DFLyQHVGHWHUPLQDUSRUPpWRGRDQDOtWLFRORVYDORUHVGHGHIRUPDFLyQ
TXHSHUPLWDQFRQFOXLUDFHUFDGHODYDOLGH]\IDFWLELOLGDGGHODDSOLFDFLyQGHOPpWRGR
GHOHOHPHQWR¿QLWRHQHOFiOFXORGHVXSHUHVWUXFWXUDV
/DPDVDGHOIURQWDOVHH[WUDHPHGLDQWHVRIWZDUHGHGLVHxRDVLVWLGRORTXHVHPXHVWUD
HQODV¿JXUDV\
99
Figura 4.13 Frontal a partir del cual se determina la masa de impacto
)LJXUD5HVXOWDGRGHOFiOFXORGHODPDVDGHOIURQWDOHQ6ROLG:RUNV
6HSUHVHQWDHOFiOFXORGHODIXHU]DGHLPSDFWRHQODEDUUDDSDUWLUGHODDFHOHUDFLyQ
Vf
15.5
m
s
m
s
x 15 m
Vf V0 2ax
V0
a
m
F
F
0
m
s2
37.61 Kg
7.75
m.a
291.478 N
4.4.1 CONTRASTE ENTRE CÁLCULO ELÁSTICO Y PLÁSTICO
6H GLVWLQJXH EiVLFDPHQWH GRV FDVRV GH DSR\R SDUD GLIHUHQFLDU OD LQÀXHQFLD GHO
FRPSRUWDPLHQWR HOiVWLFR HQ HO FRPSRUWDPLHQWR SOiVWLFR GHO PDWHULDO GH OD EDUUD
LGHDOL]DGD(OSULPHUFDVRGHQRPLQDGRµ¶FRQVLVWHHQXQDYLJDELDSR\DGDGRQGH
VHJHQHUDXQPRPHQWRÀHFWRUFDUDFWHUtVWLFRPtQLPRGHODVHFFLyQTXHSHUPLWDDOD
EDUUDVRSRUWDUXQDFDUJDXQLIRUPHw FXDQGRVHVXVWHQWDVREUHDSR\RVVLPSOHVR
VREUHHPSRWUDPLHQWRV
/DV )LJXUDV \ PXHVWUDQ ORV GLDJUDPDV GH FDUJD \ PRPHQWR ÀHFWRU GH
OD EDUUD UHVSHFWLYDPHQWH HQ ODV FXDOHV VH DVXPH TXH OD OH\ GH PRPHQWRV HV
SDUDEyOLFD\HVWiGHWHUPLQDGDSRU
w .L2
Mp
8
)LJXUD9LJDELDSR\DGDFRQFDUJDXQLIRUPH
)LJXUD/H\GHPRPHQWRVGHODYLJD
4XHVXFHGHUiVLVHJ~QHOLPSDFWRVHFRQWLQXDFDUJDQGRODYLJDHQIXQFLyQGHO
WLHPSR GHO VXFHVR DVXPLHQGR XQ FRPSRUWDPLHQWR HOiVWLFRSOiVWLFR SHUIHFWR HV
TXHVHIRUPDUiXQDUyWXODSOiVWLFDLQFDSD]GHDEVRUEHUPiVPRPHQWRTXHMp\VH
SURGXFLUiXQDGHÀH[LyQLQFRQWURODGDVLQLQFUHPHQWRGHFDUJD(VWDVLWXDFLyQGH¿QH
HO PHFDQLVPR GH FRODSVR 3RU HOOR OD FDUJD GH FRODSVR HOiVWLFR FRLQFLGH FRQ OD
FDUJDGHFRODSVRHQ]RQDSOiVWLFDDVtVHOOHJDTXH
8.Mp
we
wp
L2
(OFDVRGHLGHDOL]DFLyQVHUHSUHVHQWDHQHOGLDJUDPDGHOD¿JXUD
)LJXUD,GHDOL]DFLyQGHOGLDJUDPDGHFXHUSROLEUH
/DFRQGLFLyQGHDSR\RGHODEDUUDHVGHOWLSRHPSRWUDPLHQWRODOH\GHPRPHQWRV
HQ HO UpJLPHQ HOiVWLFR YLHQH GHVFULWD HQ OD )LJXUD (Q HO LQVWDQWH HQ HO TXH
HOPRPHQWRPi[LPRTXHVHVLW~DHQDPERVDSR\RVDOFDQ]DHOYDORUMp, dichas
VHFFLRQHVVHSODVWL¿FDQ\VXJLURDGRSWDUiFXDOTXLHUYDORUPLHQWUDVTXHHOPRPHQWR
SHUPDQHFHUiFRQYDORUMp.(QHVWHLQVWDQWHVHKDDOFDQ]DGRHOYDORUPi[LPRGHOD
carga wSDUDHOIDOORHOiVWLFR
)LJXUD/H\GHPRPHQWRVHQHOUpJLPHQHOiVWLFR
we
12.Mp
L2
(OPRPHQWRHQTXHVHSODVWL¿FDQODVVHFFLRQHVHPSRWUDGDVVHPXHVWUDHQOD)LJXUD
)LJXUD0RPHQWRHQTXHSODVWL¿FDQODVVHFFLRQHVHPSRWUDGDV
/DEDUUDVLJXHFRQVHUYDQGRHOHTXLOLEULRSXHVWRTXHQRKDDOFDQ]DGRODFRQGLFLyQ
GHPHFDQLVPRVyORKDSDVDGRGHKLSHUHVWiWLFDDLVRVWiWLFD6HJ~QHOIHQyPHQR
GHLPSDFWRFRQWLQXDLQFUHPHQWDQGRHOYDORUGHwFXDQGRHOPRPHQWRÀHFWRUHQ
HOFHQWURGHOYDQRDOFDQ]DHOYDORUMpGLFKDVHFFLyQWDPELpQSODVWL¿FDUi\ODYLJD
FRODSVDUiHQIRUPDGHPHFDQLVPRFRQWUHVUyWXODVGRVHQORVH[WUHPRV\XQDHQHO
FHQWUR(QHVHLQVWDQWHHOYDORUGHODFDUJDGHFRODSVRSOiVWLFRHV
wp
16.Mp
L2
'HWRGRHVWRVHGHGXFHTXHHQXQFiOFXORHOiVWLFRXQDYLJDELHPSRWUDGDVRSRUWDXQ
PiVGHFDUJDTXHXQDELDSR\DGD(VWRLPSOLFDTXHHQXQGLVHxRSOiVWLFRKDFH
IDOWDHQSURSRUFLyQXQDVHFFLyQGHVyORGHODQHFHVDULDHQXQGLVHxRHOiVWLFR
GDGRTXHVHDSURYHFKDODUHVHUYDUHVLVWHQWHTXHSURSRUFLRQDHOKLSHUHVWDWLVPR
$GHPiV GHO DKRUUR HFRQyPLFR TXH HVWR VXSRQH HO KHFKR GH GHVDSURYHFKDU HO
IXQFLRQDPLHQWRDxDGLGRGHORVJUDGRVGHKLSHUHVWDWLVPRUHÀHMDODQDWXUDOH]DLOyJLFD
GHOGLVHxREDVDGRH[FOXVLYDPHQWHHQHOOtPLWHHOiVWLFR
(QRWUDVSDODEUDVHOGLVHxRHOiVWLFRGHXQDHVWUXFWXUDLVRVWiWLFDJHQHUDXQPDUJHQ
GHVHJXULGDGLQIHULRUIUHQWHDOFRODSVRTXHHQHOFDVRGHXQDKLSHUHVWiWLFD(VWD
GLIHUHQFLDLQMXVWL¿FDGDVHGHEHDTXHQRVHWLHQHHQFXHQWDTXHPXFKDVHVWUXFWXUDV
SXHGHQVHJXLUIXQFLRQDQGRVDWLVIDFWRULDPHQWHSDVDGRHVWHOtPLWH
3DUDLGHDOL]DUHOFDVRGHOSUHVHQWHHVWXGLRVHWRPDHQFXHQWDXQDVRODGLUHFFLyQ\
VHQWLGRGHODIXHU]DGHLPSDFWRSRUORFXDOHOHMHUFLFLRVHFRQYLHUWHHQXQLGLPHQVLRQDO
(OFRPSRUWDPLHQWRSOiVWLFRVREUHODEDUUDHQXQHVWDGRGHWHQVLRQHVXQLD[LDOHV
DTXHO HQ HO TXH KD\ XQD VROD WHQVLyQ SULQFLSDO QR QXOD TXH SXHGH VHU SRVLWLYD
WUDFFLyQRQHJDWLYDFRPSUHVLyQ
4.4.2 CÁLCULO EN LA ZONA ELÁSTICA
6HXWLOL]D:ROIUDP0DWKHPDWLFDSDUDHOFiOFXOR/DGLVWULEXFLyQGHHVIXHU]RVHQOD
VHFFLyQDUpJLPHQHOiVWLFRVHPXHVWUDHQOD)LJXUD
)LJXUDD'LVWULEXFLyQGHWHQVLRQHVHQ]RQDSOiVWLFD
/DVSURSLHGDGHVGHODVVHFFLyQGHODEDUUDLGHDOL]DGDVHLQGLFDQHQODWDEOD
Tabla 4.3
Propiedades de la sección idealizada
Fuente6RIWZDUH5,6$6(&7,21SDUDHOSHU¿OGH[[PP
6HREWLHQHODGLVWULEXFLyQGHWHQVLRQHVQRUPDOHVGHOD)LJXUDDSDUDHOSHU¿O
GHWXERFXDGUDGRGH[[PPDSDUWLUGHODOH\GH1DYLHU%HUQRXOOLODWHQVLyQ
Pi[LPD FRUUHVSRQGH D OD ¿EUD PiV DOHMDGD 6H KDQ GHWHUPLQDGR ORV GLDJUDPDV
GH IXHU]D GH FRUWH \ PRPHQWR ÀHFWRU D SDUWLU GH ORV GDWRV DVXPLGRV SDUD HVWD
LGHDOL]DFLyQ
F
L
291.478 N
2463 mm
F
w
L
w 0.118 N.mm
ZHVODFDUJDXQLIRUPHPHQWHGLVWULEXLGD
VEd ,A
w .L
2
145.739 N
VEd ,B
145.739 N
VEd ,A
9Ed$\%VRQODVUHDFFLRQHVREWHQLGDV
(QHOGLDJUDPDGHIXHU]DVGHFRUWH\PRPHQWRÀHFWRUVHREWLHQHQORVYDORUHVSDUD
HO PRPHQWR ÀHFWRU HQ OD EDUUD 6H XWLOL]D HO VRIWZDUH 5,6$ ' SDUD JHQHUDU ODV
JUi¿FDV
)LJXUDE'LDJUDPDVGH)XHU]DGHFRUWHPRPHQWRÀHFWRU\'HIRUPDFLyQ
'HO GLDJUDPD VH FRQFHSWXDOL]D TXH HO PRPHQWR ÀHFWRU Pi[LPR VH HQFXHQWUD HQ
ORVHPSRWUDPLHQWRV\WLHQHXQYDORUGH1PPTXHWRPDODQRWDFLyQ0(G\
DGHPiVVHFRQRFHODVVLJXLHQWHVH[SUHVLRQHV
Wel .y
Iy
Cmáx
/DHFXDFLyQGHOHVIXHU]RVHUi
Vmáx
MEd .y
Wel .y
(O YDORU GHO PyGXOR UHVLVWHQWH HOiVWLFR GH ORV GLVWLQWRV SHU¿OHV ODPLQDGRV VH
HQFXHQWUDQ OD ELEOLRJUDItD GH SHU¿OHV GH DFHUR R WDPELpQ VH FDOFXOD PHGLDQWH OD
H[SUHVLyQGHODHFXDFLyQ
(Q HO OtPLWH FXDQGR OD WHQVLyQ Pi[LPD HQ OD ¿EUD PiV DOHMDGD HV LJXDO DO OtPLWH
HOiVWLFRPLQRUDGRGHODFHURGHOSHU¿OVHWHQGUiODVLJXLHQWHH[SUHVLyQUHVXOWDGRGH
sustituir sPi[ por fyd
MEd .y
fyd
Wel .y
6HGH¿QHHOPRPHQWRUHVLVWHQWHHOiVWLFRGHXQSHU¿OFRPRDTXHOTXHJHQHUDXQD
WHQVLyQPi[LPDHQOD¿EUDPiVDOHMDGDGHODVHFFLyQLJXDODfyd6HUHSUHVHQWDSRU
05GHO\\VXYDORUVHREWLHQHGHVSHMDQGRHOPRPHQWRVROLFLWDGRHQODHFXDFLyQ
MEd .el .y
fyd .Wel .y
3DUDODVHFFLyQGHOSHU¿OREMHWRGHHVWXGLR[[PPVHFDOFXODHOPRPHQWR
UHVLVWHQWHHOiVWLFRUHVSHFWRDOHMH³<´PLVPRTXHVHUiLJXDOD
L
2463 mm
Iy
1.477 x108 mm 4
Cmáx
25mm
Iy
Wel ,y
Cmáx
Wel ,y
0.05908 x108 0.5908 mm 3
MEd ,y
89605.5 N.mm
fyd
MEd ,y
Wel ,y
fyd
0.01513
N
mm 2
fyd
0.01513
N
mm 2
MRd .el .y
fyd .Wel .y
MRd .el .y
89605.5 N.mm
F1.L2
L
36.38 N
MRd .el .y
F1
4.4.3 CÁLCULO EN LA ZONA PLÁSTICA
/DGLVWULEXFLyQGHWHQVLRQHVQRUPDOHVHQUpJLPHQSOiVWLFRSUHVHQWDXQGLDJUDPDGH
WHQVLRQHVELUHFWDQJXODUDOVXSRQHUTXHWRGDVODV¿EUDVGHODVHFFLyQDOFDQ]DQHO
OtPLWHHOiVWLFRGHFiOFXORWDOFRPRVHPXHVWUDHQOD)LJXUD
)LJXUD'LVWULEXFLyQGHWHQVLRQHVHQOD]RQDSOiVWLFD
6HGH¿QHHOPRPHQWRUHVLVWHQWHSOiVWLFRGHXQSHU¿OGHDFHURFRPRDTXHOTXHHV
FDSD]GHSODVWL¿FDUWRGDV\FDGDXQDGHODV¿EUDVGHODVHFFLyQ6XYDORUHVLJXDOD
MRd ,pl ,y
fyd .Wpl
,y
6LHQGRWpl,y HOPyGXORUHVLVWHQWHSOiVWLFRGHODVHFFLyQ
El módulo resistente plástico se calcula considerando que la sección solicitada a
ÀH[LyQKDSODVWL¿FDGRHVWDQGRXQDSDUWHGHODPLVPDFRPSULPLGD\RWUDWUDFFLRQDGD
GH PRGR TXH SDUD TXH OD VHFFLyQ HVWp HQ HTXLOLEULR HV QHFHVDULR TXH OD IXHU]D
UHVXOWDQWHGHODSDUWHFRPSULPLGDVHDLJXDODODIXHU]DUHVXOWDQWHGHODWUDFFLRQDGD
)LJXUD(TXLOLEULRGHODVHFFLyQ
De modo que:
A
A1 .fyd . = A2 fyd → A1 =
A2 =
2
A1 .fyd .z1 + A2 .fyd .z2 = MRd ,pl o lo que es lo mismo :
fyd .
A
.( z1 + z2 ) =
MRd ,pl
2
6HGH¿QHHOPyGXORUHVLVWHQWHSOiVWLFRDOWpUPLQR Wpl = A .( z1 + z2 ) por similitud
2
FRQHOPyGXORUHVLVWHQWHHOiVWLFR
/RVPyGXORVUHVLVWHQWHVSOiVWLFRVGHORVSHU¿OHVODPLQDGRVVHHQFXHQWUDQWDEXODGRV
3DUDHO[[PPVHWLHQH:SO5G HPP
5HDOL]DQGRODVRSHUDFLRQHV\VXVWLWX\HQGRORVYDORUHVVHWLHQH
Wel .y
Wpl .Rd
MEd .y
0.5908 mm 3
89605.5 N.mm
MEd .y
fyd
Wel .y
MRd . pl .y
N
mm 2
fyd .Wpl .Rd
MRd . pl .y
89605.5 N.mm
fyd
L
151668
2463 mm
F1L2
L
36.38 N
MRd . pl .y
F1
4.4.4 ANÁLISIS DE LA BARRA EN RÉGIMEN PLÁSTICO
(QHOHStJUDIHDQWHULRUVHKDREWHQLGRHOYDORUGHODFDUJDXQLIRUPHPHQWHUHSDUWLGDTXH
SODVWL¿FDODVHFFLyQGHOHPSRWUDPLHQWRHVGHFLUTXHJHQHUDHQHOHPSRWUDPLHQWR
XQPRPHQWRVROLFLWDFLyQLJXDODOPRPHQWRUHVLVWHQWHSOiVWLFRGHODFHURJDOYDQL]DGR
[[PP
A
c
)LJXUD'LDJUDPDGHPRPHQWRÀHFWRU
(OPRPHQWRVHFDOFXODHQHOSXQWR%
'HOGLDJUDPDGHIXHU]DGHFRUWHVHWLHQH
)LJXUD'LDJUDPDGHIXHU]DVGHFRUWH
(OPRPHQWRHQHOSXQWR%VHUi
V
L
145.7 N
2463 mm
MEd .B
MEd .B
L
4
89717.9 N.mm
V*
(OPRPHQWRHQHOSXQWR&VHUi
MEd .C
MEd .C
L
4
89717.9 N.mm
V .
(Q OD )LJXUD VH REVHUYD TXH HQ OD VHFFLyQ % HO PRPHQWR PD\RU HV LJXDO D
1PPPRPHQWRUHVLVWHQWHSOiVWLFR\HQODVHFFLyQ&HVLJXDOD
1āPP
&XDQGRVHUHDOL]DXQDQiOLVLVJOREDOGHODEDUUDHQUpJLPHQSOiVWLFRVHVXSRQHTXH
ODVVHFFLRQHVTXHKDQSODVWL¿FDGRVHFRPSRUWDQFRPRUyWXODVGHPRGRTXHODYLJD
GHOD)LJXUDVRPHWLGDDXQDFDUJDXQLIRUPHPHQWHUHSDUWLGDGH1PPVH
PRGHOL]DFRPRELDUWLFXODGDWDO\FRPRVHPXHVWUDHQOD)LJXUDD
)LJXUDD%DUUDELDUWLFXODGD
(VWDYLJDELDUWLFXODGDHVFDSD]GHVRSRUWDUQXHYDVFDUJDVDXPHQWDQGRHOPRPHQWR
HQ HO FHQWUR GH YDQR \ SHUPDQHFLHQGR FRQVWDQWH \ FRQ YDORU LJXDO D Mpl,y,Rd el
PRPHQWRHQODVHFFLyQ%
3DUDREWHQHUODFDQWLGDGGHFDUJDDGLFLRQDOTXHSXHGHVRSRUWDUKD\TXHWHQHUHQ
FXHQWDTXHODVHFFLyQPiVVROLFLWDGDDÀH[LyQSRVLWLYDHVOD&FRQXQPRPHQWR
GHVROLFLWDFLyQLJXDO1āPPGHPRGRTXHHOPi[LPRPRPHQWRTXHSRGUi
VROLFLWDU D GLFKD VHFFLyQ FRQVHFXHQFLD GHO LQFUHPHQWR GH FDUJD VHUi LJXDO DO
PRPHQWRUHVLVWHQWHGHOSHU¿OPHQRVHOPRPHQWRTXH\DORHVWiVROLFLWDQGR
Es decir:
MEd ,max,admisible
MRd . pl .y MEd .B
MEd ,max,admisible
89605 ( 89717.9)
MEd ,max,admisible
179323 N.mm
&RQHOYDORUGHOPi[LPRPRPHQWRDGPLVLEOHFDOFXODGRVHREWLHQHHOLQFUHPHQWR
GHFDUJDTXHUHVLVWHODYLJDPRGHOL]DGDFRPRELDSR\DGDVLHQGRHOGLDJUDPDGH
ÀHFWRUHVFRUUHVSRQGLHQWHHOGHOD¿JXUDE
)LJXUDE'LDJUDPDGHEDUUDELDUWLFXODGD
MEd .max1
MEd .max1
89717.9 N.mm
' qd .L
12
L 2463 mm
L
MEd .max1 V .
12
' qd .L2
MEd .max1
12
' qd 0.059 N.mm
L
3DUDHOFDVRTXHQRVRFXSD MEd ,máx V . YDORUGHOPRPHQWRTXHVHLJXDODFRQ
12
HOPi[LPRDGPLVLEOHSDUDREWHQHUHOLQFUHPHQWRGHFDUJDDGPLVLEOHSRUHOSHU¿O,62
[[PRGHODGRFRPRXQDEDUUDELDSR\DGD
'H PRGR TXH VL VH DxDGHQ 1PP D ORV 1PP TXH VH WHQtD HQ OD FDUJD
DSOLFDGDSRULPSDFWRVHSURGXFHODSODVWL¿FDFLyQGHODVHFFLyQGHOFHQWURGHYDQR
GHODYLJDFRQYLUWLpQGRODHQXQPHFDQLVPRFRPRVHPXHVWUDOD¿JXUD
)LJXUD%DUUDSODVWL¿FDGDFRQYHUWLGDHQPHFDQLVPR
/RVYDORUHVREWHQLGRVSDUDODFDUJDGHDJRWDPLHQWRGHODEDUUDREMHWRGHODQiOLVLV
SHUPLWHQ REVHUYDU TXH ORV PpWRGRV SOiVWLFRV GH GLPHQVLRQDGR GH OD VHFFLyQ \
DQiOLVLVGHODHVWUXFWXUDSHUPLWHQFRQVLGHUDUXQDFDSDFLGDGGHFDUJDPD\RU
4.4.5 CÁLCULO DE ESFUERZOS PLÁSTICOS
c
25 mm
Iy
1.48 x105 mm 4
V plastico
MEd .max .c
Iy
V plasticoPa
N
mm 2
V plastico .1000000[Pa]
V plasticoPa
5051.68 Pa
V plastico 0.0050
4.4.6 SIMULACIÓN DE LA BARRA EN LS-DYNA
/DVFRQGLFLRQHVGHVLPXODFLyQKDQVLGRJHQHUDGDVHQIXQFLyQDODLGHDOL]DFLyQGHO
SUREOHPDHVGHFLU
• 6RSRUWH¿MRHQORVGRVH[WUHPRVGHODSDUHGUtJLGD
• &DUJD1ODTXHVHJHQHUDFRPRUHDFFLyQDOLPSDFWRGHODEDUUDFRQWUD
•
•
ODSDUHG
0DWHULDO$FHUR*DOYDQL]DGRQROLQHDO
+RXUJODVV)ODQDJDQ%HO\WVFKNR6WLႇQHVFRQXQFRH¿FLHQWH
•
•
6HFFLyQ&XDGUDGDGH[[PP
/RQJLWXGGHEDUUDPP
6HUHSLWHHOSURFHGLPLHQWRTXHVHLQGLFySDUDHOGLEXMRGHODFDELQD
6HGLEXMDODEDUUDSDUDHOHVWXGLRHQWUHVGLPHQVLRQHVFRQVXSHU¿FLHVHOUHVXOWDGR
VHPXHVWUDHQOD¿JXUD
)LJXUD%DUUDLGHDOL]DGDGLEXMDGDHQ6SDFH&ODLP
6H JHQHUD XQD PDOOD FRQ XQ UDGLR MDFRELDQR GH OR FXDO SHUPLWH YHUL¿FDU OD
EXHQDFDOLGDGGHOPRGHORODFDUDFWHUtVWLFDGHOPLVPRVHPXHVWUDHQOD)LJXUD
)LJXUD&RQ¿JXUDFLyQ\YHUL¿FDFLyQHVWDGtVWLFDGHODPDOOD
/DVFRGLFLRQHVGHERUGHSDUDODVLPXODFLyQGHODEDUUDVHPXHVWUDQHQOD¿JXUD
)LJXUD&RQGLFLRQHVGHERUGHSDUDODVLPXODFLyQGHODEDUUD
6H HIHFWXy HO SURFHVDPLHQWR GHO HVWXGLR D SDUWLU GHO FXDO VH KD REWHQLGR ORV
siguientes resultados:
)LJXUD(VIXHU]RGH9RQ0LVHVHQODEDUUD
(O HVIXHU]R GH 9RQ 0LVHV FDOFXODGR SRU HO PpWRGR GH HOHPHQWRV ¿QLWRV HV GH
03DORTXHHTXLYDOHVD3D
/D YHUL¿FDFLyQ VH UHDOL]D HQ IXQFLyQ D ORV YDORUHV GH OD WHQVLyQ GH 9RQ 0LVHV
FDOFXODGDDQDOtWLFDPHQWH\FRPSXWDFLRQDOPHQWH
6H GHWHUPLQDQ ORV HOHPHQWRV SDUD DQDOL]DUORV HQ /6 '<1$ EDMR HO FULWHULR GHO
HOHPHQWRPiVFUtWLFRTXHHQHVWHFDVRHVHOQ~PHURFX\DORFDOL]DFLyQ\GHWDOOH
VHREVHUYDHQOD¿JXUD
)LJXUD6HOHFFLyQGHORVHOHPHQWRVSDUDDQiOLVLVHQ/6'<1$
/RV HOHPHQWRV VHOHFFLRQDGRV SHUPLWHQ SRVSURFHVDU HQ HO VRIWZDUH SDUD REWHQHU
LQIRUPDFLyQHQTXHVHFRPSDUDODUHODFLyQHQWUHHO+RXUJODVV\ODHQHUJtDLQWHUQD
TXHDODYH]GDQOXJDUDODYDOLGDFLyQGHOHVWXGLRORFXDOVHPXHVWUDDFRQWLQXDFLyQ
Hourglass
Eint erna
%H
0.19 x10 7 [J ]
1.29 x10 6 [J ]
Hourglass
Eint erna
1.47%
(OSRUFHQWDMHGH+RXUJODVVHVPHQRUDOGHODHQHUJtDLQWHUQDSRUORFXDOHO
FiOFXORFRPSXWDFLRQDOTXHGDYDOLGDGR
(OFULWHULRGH+RXUJODVVDSOLFDGRVHEDVDHQORVYDORUHVPRVWUDGRVHQODV¿JXUDV
\TXHVHUH¿HUHQDODVFXUYDVGHODHQHUJtDLQWHUQD\GHODHQHUJtDGH
+RXUJODVVH[WUDtGDVGHOVRIWZDUH/6'<1$UHVSHFWLYDPHQWH
)LJXUD&XUYDFRUUHVSRQGLHQWHDODHQHUJtDLQWHUQDHQODEDUUD
)LJXUD&XUYDFRUUHVSRQGLHQWHDODHQHUJtDGH+RXUJODVVHQODEDUUD
6HKDREWHQLGRODVFXUYDVGHORVHOHPHQWRVVHOHFFLRQDGRVSDUDHOHVIXHU]RGH9RQ
0LVHVSOiVWLFRORFXDOSHUPLWHDQDOL]DUHOFRPSRUWDPLHQWRGHODEDUUDDQWHLPSDFWR
OD¿JXUDPXHVWUDHOSDUiPHWURPHQFLRQDGR
)LJXUD&XUYDVGHORVQRGRVVHOHFFLRQDGRVSDUDHOHVIXHU]RGH9RQ0LVHV
(O FRPSRUWDPLHQWR GH ODV FXUYDV KDFHQ QRWDU TXH HO HOHPHQWR FUtWLFR GH FRORU
URMR WLHQH XQ GLVWDQFLDPLHQWR HQ FXDQWR D FRPSRUWDPLHQWR HQ UHODFLyQ D ORV
RWURVHOHPHQWRVTXHSUHVHQWDQPD\RUXQLIRUPLGDGSRVLEOHPHQWHVHWUDWHGHXQD
singularidad que no se encuentra tan distante en resultados a los otros elementos
TXHVHFRPSRUWDQFRLQFLGHQWHPHQWHHOHVIXHU]RPi[LPRWLHQHXQYDORUGH3D
HQHOHOHPHQWRORFXDOVHSURGXFHDXQWLHPSRGHOVXFHVRGH[VHJXQGRV
SUHYLRDHVWHSXQWRHOPDWHULDOKDWHQLGRXQFRPSRUWDPLHQWRHOiVWLFRHQYLUWXGTXH
HOHVIXHU]RREWHQLGRQRHVVXSHULRUDOHVIXHU]RGHÀXHQFLDGHOPDWHULDOGHELGRDTXH
ODLQHUFLDGHODEDUUDHVUHODWLYDPHQWHSHTXHxDHQFRPSDUDFLyQFRQORDQDOL]DGR
HQODFDELQDGHODFDUURFHUtDVLQHPEDUJRHOSRUFHQWDMHGHGLIHUHQFLDHQWUHHOYDRU
DQDOtWLFR\HOFRPSXWDFLRQDOHVGHHOORFXDOHVDFHSWDEOH
/D YDOLGDFLyQ DQDOtWLFD VH SXHGH DERUGDU GHVGH YDULRV SXQWRV GH YLVWD WDO HV HO
FDVR GH OD FRPSDUDFLyQ GH HHUJtDV GH GHIRUPDFLyQ GHIRUPDFLRQHVWHQVLRQHV
GHVSOD]DPLHQWRV HWF SDUD HO SUHVHQWH FDVR VH KD WRPDGR ODV WHQVLRQHV FRPR
UHIHUHQWH
119
CAPÍTULO V
CONCLUSIONES Y RECOMENDACIONES
5.1 CONCLUSIONES
El análisis efectuado, permitió evaluar el comportamiento elastoplástico de la
superestructura de un bus tipo utilizada en transporte interprovincial, así como
generar una comparación de parámetros en relación a estudios matemáticos y
computacionales.
Se ha determinado que en Ecuador no existen normativas que sirvan de guía o
referencia para el análisis de superestructuras vehiculares sometidas a carga de
impacto, en contraste con el marco legal internacional, el que sí contempla en sus
normas este fenómeno físico. Tanto es así que existen varios autores de artículos
DQLYHOLQWHUQDFLRQDOWRGRVHOORVWHQGLHQWHVDYHUL¿FDUXQDPHWRGRORJtDGHDQiOLVLV
matemático y computacional para simulación de choques en buses y automóviles.
El modelado matemático idóneo a aplicarse para el análisis de la geometría
computacional es el de Lagrange que analiza explícitamente la deformación en
sólidos, desde un punto de vista de modelo dinámico, a diferencia del modelo de
Euler que considera unas sola variable en cada función y permite trabajar con nodos
HOHPHQWDOHV¿MRVHQUHODFLyQDOWLHPSRORFXDOHVWiOHMDQRDOFRPSRUWDPLHQWRGHO
modelo durante cierto suceso de impacto.
Existen varios softwares que son aplicables a procesos de análisis a impacto, lo que
ORVGLIHUHQFLDVRQORVUHVROYHGRUHVTXHFDGDXQRGHHOORVSRVHHTXHHQGH¿QLWLYDHV
el modo de solución de los distintos modelos matemáticos aplicables al fenómeno
físico, de tal manera que las herramientas computacionales más utilizadas son LSDYNA y Altair HyperWorks.
Las fuerzas generadas por las condiciones del impacto en la carrocería producen
altas deformaciones en periodos de tiempo muy pequeños, motivo que obligó
a desarrollar el estudio considerando la dinámica explicita como la física para
determinar parámetros de ingeniería y desarrollar la solución matemática y
computacional del presente trabajo.
La simulación computacional basada en dinámica explicita, permitió observar el
comportamiento de la superestructura de bus ante los efectos del impacto, que si
120
se describen como un proceso se tiene el siguiente orden: comportamiento elástico
GHOPDWHULDOFRPSRUWDPLHQWRHODVWRSOiVWLFR\¿QDOPHQWHHOFRPSRUWDPLHQWRSOiVWLFR
para luego pasar al colapso o falla del material; es decir la aplicación de grandes
cargas durante intervalos de tiempo pequeños, generan altas deformaciones
mediante distintos comportamientos del material, muchos de ellos impredecibles.
El control de reloj de arena (Hourglass) es un método que permite evitar en la malla
DQDOL]DGDXQWUDEDGRGHFLHUWRVHOHPHQWRV¿QLWRVORTXHDIHFWDUtDORVUHVXOWDGRVGH
manera incidente, la energía interna generada por impacto, deberá ser comparada
con el valor de energía desarrollado por efecto de Hourglass, así lo ideal es que
el valor de energía Hourglass obtenido sea menor al 10% de la energía interna a
impacto de todo el sistema.
Se determinó que la zona crítica de la carrocería en un estudio a impacto delantero,
es el componente denominado “frontal” o “para choque”, en base al cual se realizó
una idealización que permitió obtener expresiones matemáticas de los momentos
y esfuerzos plásticos, para establecer el comportamiento del elemento en zona
plástica. También se efectuó un análisis computacional en la misma estructura
frontal y se extrajo el esfuerzo plástico, así se estableció, que existe un percentil
de diferencia en el cálculo aproximadamente de 12.1%; sin embargo esto
corresponde a un análisis computacional de relativamente poco complejo, en el
caso de una estructura grande, el margen crece exponencialmente de forma que el
procesamiento del computador es difícilmente alcanzable por medios matemáticos
LQFOX\HQGRGHQWURGHHOORVHO0()PpWRGRGHOHOHPHQWR¿QLWR
Para efectuar el diseño estructural a gran escala, mediante asistencia computacional
por software de dinámica explícita, se debe tomar en cuenta los siguientes
pasos:
1. Establecer una geometría tridimensional “limpia”, sin errores i interferencias
SDUDORFXDOVHUHFRPLHQGDODDVLVWHQFLDGHXQVRIWZDUHGHYHUL¿FDFLyQ
2. 'H¿QLUREMHWLYDPHQWHODVFRQGLFLRQHVGHERUGHGHOPRGHORDDQDOL]DU(Q
el caso del presente estudio se ha permitido el choque de la estructura
contra una pared rígida propia de LS DYNA, sin embargo, en otros análisis
aplicados en otros países, se genera el choque de un péndulo contra la
carrocería.
3. Contar con un equipo de procesamiento de datos industrial, mínimo con
FXDWURSURFHVDGRUHVSDUDORJUDUUHVXOWDGRV¿DEOHV
4. Validar el estudio, en el presente trabajo se exponen dos de las
121
formas aplicadas, las cuales son: (a) Cálculo manual comparado
con el computacional, donde el umbral de diferencia debe ser del
DSUR[LPDGDPHQWH VLQ HPEDUJR QR HV XQ PpWRGR ¿DEOH SRU OD
susceptibilidad a errores de cálculo, (b) El método del control de reloj de
arena (Hourglass) que implica comparar las energías desarrolladas por
efecto de impacto y evitar que la energía del Hourglass sea mayor a un
10% que la energía interna.
5. Utilizar un software posprocesador de datos para obtener información
a modo de curvas de los distintos parámetros logrados en el análisis
computacional, así se efectiviza un adecuado análisis de comportamiento
del material ante impactos.
La evaluación de la superestructura se puede efectuar mediante la comparación
entre: las propiedades físicas y mecánicas intrínsecas del material constitutivo,
frente al comportamiento matemático de la carrocería a carga de impacto, en el
presente trabajo este proceso se lo ha efectuado mediante obtención de curvas
de esfuerzo versus deformación, energía de deformación versus tiempo, energía
de hourglass versus tiempo entre otras, esto a permitido conocer en que instante
WLHPSR HVSHFt¿FR GHO VXFHVR HO PDWHULDO WUDEDMD HQ UDQJR HOiVWLFR X D VX YH]
plástico o simplemente falla; esta posibilidad de análisis, permite generar puntos de
vista, que serían de suma utilidad para aportar a la generación de una normativa
de diseño y construcción de superestructuras de autobuses para transporte
interprovincial que regule aspectos de ingeniería útiles para mejorar la posibilidad
de supervivencia ante un choque frontal.
En virtud del comportamiento del material determinado en el estudio, el cual pasa
a zona plástica en un tiempo muy pequeño y esfuerzos relativamente bajos seria
óptimo pensar en la inclusión de nuevos materiales en los procesos de diseño y
manufactura de las carrocerías, sin embargo, se deberá considerar que los costos
se incrementarían en virtud de la falta de estudios y la carencia de opciones de
material en el medio.
Las deformaciones son considerables a tiempos de suceso pequeño ocasionados
por cargas de impacto a una velocidad de 56 Km/h según normas internacionales,
sin embargo, los índices de accidentes en el país indican que la velocidad de
impacto oscila entre 100 a 120 Km/h, lo que conlleva a concluir que se presentan
deformaciones mucho mayores que son capaces de invadir el habitáculo de
seguridad de los buses.
122
Es necesario destacar que, si bien es cierto el acero galvanizado es un material
fácil de conseguir en el mercado ecuatoriano a un costo relativamente bajo, no
presenta un comportamiento requerido en las condiciones de diseño, mismas que
puntualizarían una aplicación de resistencia a impacto cuando este ocurre a más
de 56 Km/h.
5.2 RECOMENDACIONES
•
Dibujar la carrocería en el software SpaceClaim de ANSYS que permite obtener
un proceso idóneo para trabajar con LS DYNA, con otros softwares no se ha
tenido éxito.
•
8WLOL]DU HO FULWHULR GH )ODQDJDQ %HO\WVFKNR 6WLႇQHVV FRQ XQ FRH¿FLHQWH GH
0,1 como método de corrección del fenómeno de Hourglass, para estudios de
impacto similares al desarrollado.
•
Se recomienda que para tiempos de suceso relativamente grandes (seg{un el
criterio de la dinámica explícita), utilizar procesadores de alta capacidad para
lograra resultados veraces.
•
Se requiere que el dibujo tridimensional del modelo sea construido con
VXSHU¿FLHV SDUD REWHQHU UHVXOWDGRV IDYRUDEOHV \ HQ WLHPSRV FRUWRV GH
SURFHVDPLHQWR VHJ~Q YHUL¿FDFLRQHV UHDOL]DGDV \ DSOLFDGDV HQ HO SUHVHQWH
•
caso.
En el posproceso obtener información de elementos críticos y sus circundantes
de manera que la estadística que se pueda plantear a partir de ello, permita
•
distinguir singularidades en el estudio.
El análisis de resultados se lo debe realizar en grupos de nodos para poder
detectar posibles singularidades que a la vez pueden generar resultados poco
•
FRQ¿DEOHVRHUUyQHRV
Fomentar investigaciones nacionales para el estudio y caracterización de
las propiedades mecánicas en los principales materiales utilizados en la
construcción de las carrocerías, dentro de la zona plástica para obtener valores
de referencia que permitan mejores aproximaciones en los resultados de las
simulaciones.
•
Impartir en posgrados asignaturas tendientes a aplicaciones netamente
industriales de forma que exista un mejor desempeño profesional sobre todo
en áreas en las que predomina la matemática y las ciencias computacionales.
123
REFERENCIAS BIBLIOGRAFICAS
AGENCIA NACIONAL DE TRANSITO “Estadísticas de transporte terrestre y
seguridad vial” 2015 [En línea] Recuperado: http://www.ant.gob.ec/index.php/
noticias/estadisticas#.Virc5EqxZER (febrero, 2015)
AGENCIA NACIONAL DE TRANSITO”Normas y Reglamentos INEN aplicados
al Transporte, Tránsito y Seguridad Vial “[En línea] Recuperado: http://www.
ant.gob.ec/old/index.php/normas-y-reglamentos-inen-aplicados-al-transporte
(febrero, 2015)
ANSYS Help Viewer, “Specify Analysis Settings for Explicit Dynamics Analyses”
ANSYS Help Viewer, “Hourglassing”
ANSYS Help Viewer, “Solid and Shell Elements”
ANSYS Help Viewer,. “Appendix F. Explicit Dynamics Theory Guide”
Applus IDIADA “Departamento de Homologación” [En línea] Recuperado: http://
www.applusidiada.com/es/ (febrero, 2015)
CANFACECUADOR “Reseña Histórica”
[En línea] Recuperado: http://www.
canfacecuador.com/index.php/quienes-somos/resena-historica. (febrero 2015)
CONDES NOVILLO J. “Simulación de ensayos de choque en vehículos: validación
GH XQ PRGHOR GH GXPP\ HQ GLPHQVLRQHV 3UR\HFWR ¿Q GH FDUUHUD GH OD
Universidad Carlos III de Madrid, Julio 2015 [En línea] Recuperado: http://earchivo.uc3m.es/bitstream/handle/10016/7532/PFC_David_Illesca_Perez.
pdf?sequence=1
CRASH TEST [En línea] Available: https://en.wikipedia.org/wiki/Crash_test
ECUABUSES [En linea] Recuperado: http://www.ecuabus.net/Buses%20Scania.
html (febrero, 2015)
ELYSIUM, . [En línea] Recuperado: http://elysiuminc.com/products/caddoctor-for-nx/
124
EMPRESA PÚBLICA METROPOLITANA DE MOVILIDAD Y OBRAS PÚBLICAS
[En línea] Recuperado:http://www.epmmop.gob.ec/epmmop/images/stories/
doc_gestion_movilidad/listado_carroserias_(28-08-2012).pdf (Abril,2015)
H.J. BUNGE, K. PÖHLANDT, A. ERMAN TEKKAYA, “Formability of Metallic
Materials: Plastic Anisotropy, Formability Testing” .Springer. 2000
JAC Motors [En linea] Recuperado http://www.jacecuador.com/busetas/
LIVERMORE SOFTWARE TECHNOLOGY CORPORATION -2015 [En línea]
Recuperado: http://ftp.lstc.com/anonymous/outgoing/jday/hourglass.pdf
LIVERMORE SOFTWARE TECHNOLOGY CORPORATION -2015 [En línea]
Recuperado: www.lstc.com ( mayo, 2015)
LS-DYNA ABOUT 2015 [En línea] Recuperado: http://www.lstc.com/products/
ls-dyna
NORMALIZACIÓN [En linea] Recuperado http://www.normalizacion.gob.ec/wpcontent/uploads/downloads/2013/11/rte_041_2r.pdf
NOVILLO GEOVANNY, “Análisis estructural de carrocerías para autobuses”
Proyecto previo a la obtención del titulo de Master en Diseño , Escuela Superior
Politécnica de Chimborazo, Universidad de Oriente, Riobamba, Ecuador, 1999
PATTAROM JONGPRADIST ET AL, “Improvement of Crashworthiness of bus
Structure under Frontal Impact”. The 2015 World Congress on Advances in
Structural Engineering an Mechanics (ASEM15) Incheon, Korea, August 25-29,
2015
PAUL DU BOIS . ET ALL. “Vehicle Crashworthines Ans Occupant Protection”
American Iron and Steel Institute 2004
R. COURANT, K. FRIEDRICHS AND H. LEWY,³2QWKHSDUWLDOGLႇHUHQFHHTXDWLRQV
of mathematical physics”, IBM Journal, March 1967, pp. 215-234
SCT IMT Instituto Mexicano del Transporte, Secretaria de Comunicaciones
y Transporte
“Comportamiento al Choque de los Vehículos. Algunas
125
investigaciones Relacionadas” [En línea] Recuperado: http://imt.mx/archivos/
Publicaciones/PublicacionTecnica/pt129.pdf
6+(15:8DQG/(,*8,QWURGXFWLRQWRWKHH[SOLFLW¿QLWHHOHPHQWPHWKRG
for nonlinear transient dynamics, Editorial WILEY .
TED BELYTSCHKO , WING KAM LIU, BRIAN MORAN, KHALIL I. ELKHODARY
,(2014) “Nonlinear Finite Elements for Continua and Structures” Second Edition.
UNIVERSIDAD POLITÉCNICA DE MADRID “Instituto de Investigación del
Automóvil” [En línea] Recuperado: http://www.upm.es/institucional/UPM/
Centros/CampusSur/INSIA
XIDATEL [En línea] Recuperado: http://www.xitadel.com/ls-dyna
YUCHENG LIU , STEFAN J. CHU, AND RAUL VIERA
“Analysis of
structural impact and crashworthiness using experimental, analytical and
computational techniques: an overview and recent developments” [En
línea]Recuperado:https://www.academia.edu/5800918/Analysis_of_struct
ural_impact_and_crashworthiness_using_experimental_analytical_and_
computational_techniques_an_overview_and_recent_developments
126
127
128
129
130
131
ANEXO C
Figura 1. Vista transversal del espacio de superviciencia (nota 2)
(VSHFL¿FDFLyQGHOHVSDFLRGHVXSHUYLYHQFLD
Disposiciones laterales
132
133
Figura 2. Vista longitudinal del espacio de superviciencia
134
ANEXO D
135
136
137
138
139
140
141
142
143
144
1
1150
155
410
213
223,31
500
1499,76
210
54
°
2
62
°
35°
1344
760
°
55
1570
760
802,5
1340
760
46°
1570
3
1340
760
°
70
760
213,28
1190
Escala: 1:2
65
Detalle B-B'
575
1570
760
760
1570
20°
28°
12000
223,31
545
401
750
1650
760
1075
760
°
70
4
830
37°
760
53°
1712
58
°
1710
830
150,11
148
A'
50
Escala: 1:2
2
Detalle A - A'
900
B'
B
A
5
5
987
1325
183
± 2mm
19°
°
92
458,39
877,34
95
5,1
71
91
°
89
°
887
765
0,52
500,08
250,87 250,87
55,2
100
7
5,3
73
50
90,29
44°
840
150
270
415
4
Edición
990
6
100
5,1
95
0,52
71
9
2°
458,39
50
Modificación
500,08
809,24
Fecha Nombre
42°
3032
Apro
Dib
Rev
±
05-07-16
449,71
46°
289,18
265,08
1998,24
2550
2490
450,02
Nombre
49000 N
Peso
47°
7
EPN
Manjarrés/Santillán
440,94
956,98
174,16
226,78
875,24
377,12
Fecha
5 mm
Tolerancia
86
°
F
E
D
C
B
650
175
394,71
455,2
,2
85
10
1050,8
802,78
954,93
90,29
495
3
50
197,56
400
2
50,33
A
1
1340
695
650
950
660
1390
57,29
100
150
360
200
545
465
585
305
230
330
760
810
630
695
295
400
410
810
380
280
580
810
440,94
174,16
377,12
167
164
R250
226,78
AISI 304
Para todas las
conexiones a 90°
± 2mm
R249,61
R250
172
Para todos los
puntos de
soldaadura
E6011
8
L_EPN_001
PROTOTIPO BUS
INTERPROVINCIAL
289,18
265,08
449,71
47°
956,98
810
810
810
20°
810
32°
812
58°
808,52
47°
884
47°
877,49
47°
950
°
251,83
42
31°
38°
36°
47°
10
178,14
178
1:50
Escala
E
D
C
B
A
1
3053
2
360
897
500
3000
4000
3
530
534
1234
840
952
530
534
760
300
Para todas las
conexiones de los
perfiles
estructurales
± 2mm
4
Edición
5
Modificación
958
E6011
Fecha Nombre
Para todas las
conexiones de los
perfiles
estructurales
°
180
395
746
Apro
Dib
Rev
±
220
05-07-16
Fecha
5 mm
Tolerancia
92
404
6
°
58
2404
358
1900
635
2500
740
220
380
145
Peso
Nombre
EPN
Manjarrés/Santillán
180
400
13720 N
450
88
°
9°
11
F
E
D
C
B
180
482
155
223
412
4
32°
3
250
2
155
505
746
395
404
R200
AISI 304
8
L_EPN_002
PROTOTIPO CABINA
BUS INTERPROVINCIAL
450
7
R247
1660
A
1
535
780
255
255
30°
480
415
47°
535
36°
150
700
147,64
°
120
58
976,59
°
88
°
54
950
1158
190
800
860
1:50
Escala
E
D
C
B
A